Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPL260W7.125ON55152027310.0
Smik_6.4677.125ON54851825920.0
Skud_16.187.125ON55051825420.0
Suva_16.447.125ON54951925200.0
NCAS0E021307.125ON52651420220.0
TDEL0H028707.125ON58752719230.0
NDAI0E036707.125ON52250919110.0
SAKL0F05390g7.125ON59551619000.0
CAGL0H09108g7.125ON53251118920.0
KNAG0L009407.125ON54951718620.0
KLLA0D14355g7.125ON58850918500.0
ZYRO0C05192g7.125ON58852818420.0
KLTH0F12540g7.125ON59551018160.0
Kwal_55.208327.125ON57551117730.0
TBLA0A009307.125ON58651217190.0
Ecym_83527.125ON57952417080.0
KAFR0L004607.125ON51150816420.0
Kpol_322.77.125ON53449815970.0
TPHA0C016107.125ON55151315490.0
ADL019W7.125ON52546714170.0
Kpol_1062.587.125ON4914414594e-50
TPHA0F026206.70ON918101820.25
NCAS0A024504.238ON1928184800.44
AFR429C1.524ON25875770.65
AFR357W1.479ON434121751.3
YLR457C (NBP1)7.531ON31994741.6
KLLA0A04884g4.105ON105984723.7
TBLA0E043708.254ON67647724.0
Smik_15.893.149ON45185714.8
TBLA0B042408.609ON844105706.8
SAKL0B02288g8.68ON1228131706.9
SAKL0H00506g5.14ON1788111707.7
KAFR0G032004.238ON1869101699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL260W
         (551 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...  1056   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...  1003   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   983   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   975   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   783   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   745   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   740   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   736   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   733   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   721   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   717   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   714   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   704   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   687   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   666   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   662   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   637   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   619   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   601   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   550   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   181   4e-50
TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {O...    36   0.25 
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    35   0.44 
AFR429C Chr6 complement(1208115..1208891) [777 bp, 258 aa] {ON} ...    34   0.65 
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...    33   1.3  
YLR457C Chr12 complement(1055812..1056771) [960 bp, 319 aa] {ON}...    33   1.6  
KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} simil...    32   3.7  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...    32   4.0  
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    32   4.8  
TBLA0B04240 Chr2 (977985..980519) [2535 bp, 844 aa] {ON} Anc_8.6...    32   6.8  
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    32   6.9  
SAKL0H00506g Chr8 (59093..64459) [5367 bp, 1788 aa] {ON} highly ...    32   7.7  
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    31   9.9  

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/520 (100%), Positives = 520/520 (100%)

Query: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120
           LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER 180
           STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER 180

Query: 181 KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 240
           KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT
Sbjct: 181 KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 240

Query: 241 MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 300
           MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK
Sbjct: 241 MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 300

Query: 301 FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE 360
           FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE
Sbjct: 301 FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE 360

Query: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420
           NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
Sbjct: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420

Query: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF 480
           LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF
Sbjct: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF 480

Query: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQNST 520
           YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQNST
Sbjct: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQNST 520

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/518 (94%), Positives = 503/518 (97%)

Query: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120
           LDDIRKNSHETPAKSAATLIH+TELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER 180
           STVESLLEHLNESNVFTHHDLSPIKERL+EISKIVEQKNSS  Y+EDGNDDRLREIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER 180

Query: 181 KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 240
           KKNKIEEDLLLRAKLKHCKDEYD LE KLEEIDPSLS+VMEKLFRIRRGLLSLVASAKKT
Sbjct: 181 KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKKT 240

Query: 241 MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 300
           MSKS  N NSLL+EQND Q NN  L DDKHLVSQEYVHEKLSVLK+EL+ELESNRDDSGK
Sbjct: 241 MSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK 300

Query: 301 FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE 360
           FKSLE+HQVA  GQSVLNGLLDDCHDL+NDLSHQ NGGL+LDPYLQPIYEQLIDIKTTLE
Sbjct: 301 FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE 360

Query: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420
           NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
Sbjct: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420

Query: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF 480
           LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT+GIF
Sbjct: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 480

Query: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQN 518
           YDSDGNIPEGQGILNALLAECFDILHELKVEAEE+AQN
Sbjct: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQN 518

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/518 (93%), Positives = 498/518 (96%), Gaps = 1/518 (0%)

Query: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MF+SAGQ HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFSSAGQ-HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 59

Query: 61  LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120
           LDDIRKNSH+TPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 60  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 119

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER 180
           STVESLLEHLNESNVFTHHDLSPIKERL+EISKIVEQKNSSP Y+ED ND R+REIDNER
Sbjct: 120 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNER 179

Query: 181 KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 240
           K+NKIEEDLLLRAKLKHCKDEYD LE KLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT
Sbjct: 180 KQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 239

Query: 241 MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 300
           MSKS  N NSLLQE NDLQ N+  L DDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK
Sbjct: 240 MSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 299

Query: 301 FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE 360
           FKSLE+H+V EKGQSVLNGLLDDCHDL++DLSHQ NGGL LDP+LQP YEQLIDIKTTLE
Sbjct: 300 FKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLE 359

Query: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420
           NLMITRRWTLRETDLFSYQKKLNEID+KRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
Sbjct: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 419

Query: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF 480
           LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT GIF
Sbjct: 420 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIF 479

Query: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQN 518
           YDSDGNIPEGQGILNALLAECFDI+HELKVEAEE+A N
Sbjct: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERALN 517

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/519 (91%), Positives = 502/519 (96%), Gaps = 1/519 (0%)

Query: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MF+SAGQQHPQIVPKEEESILNYLLEVRS+LAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120
           LDDIRKNSH+TPAKSAATLIHSTELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER 180
           STVESLLEHLNESNVFTHHDLSPIKERLEEI KIVE KN+ P YDEDGNDD+LREIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVE-KNTGPNYDEDGNDDQLREIDNER 179

Query: 181 KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 240
            KN+IEEDLLLRAKLKHCKDEYD LE KLEEIDPSLSTVMEKLF+IRRGLLSLVASAKKT
Sbjct: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239

Query: 241 MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 300
           MS+S++N +SLLQ+ NDL+TNN  L DDKHLVSQEYV+EKL+ LKNEL+ELESNRD+SGK
Sbjct: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299

Query: 301 FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE 360
           FKSLESH+VAE GQSVLNGLLDDCHDLVNDLSHQ NGGLTLDP LQPIYEQLIDIKTTLE
Sbjct: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359

Query: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420
           NLMITRRWTLRETDLFSYQKKLNEID+KR+ GKFPTK+QDSKGQSILLYLLRRCYAIIYK
Sbjct: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419

Query: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF 480
           LLESSEPVSEALQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT+GIF
Sbjct: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479

Query: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQNS 519
           YDSDGNIPEGQGILNALLAECFDI+HELKVEAEE+AQN+
Sbjct: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQNT 518

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/514 (76%), Positives = 441/514 (85%), Gaps = 18/514 (3%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ VPKEEE ILNYLL+VRS L+KLKQNRTQYLNSKDVQ TYQ+VLTKVRELD+IRKNS
Sbjct: 10  HPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEIRKNS 69

Query: 69  HETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
           H+TP+KSA TLIHS ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 70  HDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 129

Query: 129 HLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDR---LREIDNERKKNKI 185
           HL+ESN+FTHHDLSPIK+RL EISKIVE K+     DE  NDD    L++ID ER KNKI
Sbjct: 130 HLSESNIFTHHDLSPIKDRLNEISKIVE-KSCGKLPDEQLNDDEEQNLKDIDTERNKNKI 188

Query: 186 EEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSD 245
           E+DLLLRAKL+HC DEY  +E KLEEIDPSL++ MEKLF+IRRGLLSL AS KK M++  
Sbjct: 189 EQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAASTKKNMNQGS 248

Query: 246 INTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLE 305
           + +   L+              +KHLVSQEYV++KL  L+ E+  LE+NRD+SGKFKSLE
Sbjct: 249 LTSEKELE--------------NKHLVSQEYVNKKLHALEAEVQALEANRDESGKFKSLE 294

Query: 306 SHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMIT 365
           +++VAE GQ+VLNGLLDDC DL+NDLSHQ NG L LDP LQPIYE LIDIKTTLENLMIT
Sbjct: 295 TNEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMIT 354

Query: 366 RRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 425
           RRWTLRETDLF+YQK+L EIDN R+ G+FPTK  DSKGQ ILLYLLRRCYAIIYKLLESS
Sbjct: 355 RRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLESS 414

Query: 426 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDG 485
           EPVSE+LQPIHNQLSTVRRCL+ELKRMGGV+N+RELYPYQMKLASLDNLR +G FYDS+G
Sbjct: 415 EPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEG 474

Query: 486 NIPEGQGILNALLAECFDILHELKVEAEEKAQNS 519
           NIPEGQG LNALLA CFDI+HELKVEAEE+ + S
Sbjct: 475 NIPEGQGTLNALLAACFDIMHELKVEAEEREEQS 508

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/527 (71%), Positives = 441/527 (83%), Gaps = 34/527 (6%)

Query: 3   ASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 62
           A++  QHPQ VPKEEESILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD
Sbjct: 8   AASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELD 67

Query: 63  DIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 122
            IRK++H+TP+ SA TLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 68  QIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 127

Query: 123 VESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGN-----DDRLREID 177
           V+ LLEHLNESNVFT HDL PI+ERL EISKIVE  NSS   +  G+     D++L E D
Sbjct: 128 VQRLLEHLNESNVFTQHDLRPIRERLLEISKIVE--NSSYKNEVSGDNLEDIDEKLPEAD 185

Query: 178 N----ERKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSL 233
                ER KNKIEEDLLLRAKL+HC DEY   E K+EEIDP L+T+MEKLF IRRGLLSL
Sbjct: 186 RKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSL 245

Query: 234 VASAKKTMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELES 293
            AS+K++                     N SL  +K  +SQE+VHE++  L+++L+ELES
Sbjct: 246 AASSKRS---------------------NPSL--EKSPLSQEHVHEQVEKLESQLTELES 282

Query: 294 NRDDSGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLI 353
           +RD++GKFKSLE+ +V +KGQ+VLNGLLDDCHDL++DLSHQKNGG+ LD  LQPIYEQLI
Sbjct: 283 HRDENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLI 342

Query: 354 DIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRR 413
           DIKT+LENL++TRRWTLRETDLF++QK+L+EID+ R++GKFPT S  SKGQSILLYLLRR
Sbjct: 343 DIKTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRR 402

Query: 414 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 473
           C+AIIYKLLESSEPVSE+LQPIHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD+
Sbjct: 403 CFAIIYKLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDD 462

Query: 474 LRTEGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQNST 520
           LRT+G FYDSDGNIPEGQG LNALLAECFDI+HELK+EA+E+A+  +
Sbjct: 463 LRTDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKIEAQERAETES 509

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/509 (73%), Positives = 429/509 (84%), Gaps = 22/509 (4%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ+VPKEEE IL YLL+VR+ L  LK+NRTQYLNS+ VQ TYQ VLTKVRELD+IRKN+
Sbjct: 14  HPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELDEIRKNN 73

Query: 69  HETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
           H TP+ SA TLIHS ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 74  HATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 133

Query: 129 HLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDR----LREIDNERKKNK 184
           HLNESN+FTHHDL PIKERL++ISKIVE+  S     ++  DD+    L E + E+ +NK
Sbjct: 134 HLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDETELEQNQNK 193

Query: 185 IEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKS 244
           IE+DLLLRAKL+HC DEY  +E KLEEIDPSL++++EKLF+IRRGLLSLVASAKK     
Sbjct: 194 IEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAKK----- 248

Query: 245 DINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSL 304
               NSLL ++           D+KHL+S EY+++KL  L+ E  +LESNRD+ GKFKSL
Sbjct: 249 ----NSLLSQKE---------LDEKHLISPEYLNKKLLELEKEFKDLESNRDEFGKFKSL 295

Query: 305 ESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMI 364
           E+ ++ E GQ+VL GL DDC+DL+NDLSHQ NG LTLDP LQP+YEQLI+IKTTLE LMI
Sbjct: 296 ETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEKLMI 355

Query: 365 TRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLES 424
           TRRWTLRETDLF+YQKKL EIDN R+ GKFP+KS DSKGQ I+LYLLRRCYAIIYKLLE 
Sbjct: 356 TRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKLLEC 415

Query: 425 SEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSD 484
           SEPVSE+LQPIHNQLSTVRRCLL++KR+GGV+NERELYPYQMKLASLDNLR +GIFYDSD
Sbjct: 416 SEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFYDSD 475

Query: 485 GNIPEGQGILNALLAECFDILHELKVEAE 513
           GNIPEGQG LNALLA CFDI+HE+KVEAE
Sbjct: 476 GNIPEGQGTLNALLAACFDIVHEMKVEAE 504

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/516 (72%), Positives = 421/516 (81%), Gaps = 32/516 (6%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ VPKEEE ILNY L+VRS L+KLKQNR+Q+LNSKDV  TYQ VLTKVRELDD RK+S
Sbjct: 5   HPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTRKSS 64

Query: 69  HETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
           H TPA SA TLIHS +LHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LLE
Sbjct: 65  HNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 124

Query: 129 HLNESNVFTHHDLSPIKERLEEISKIVEQ------------KNSSPAYDEDGNDDRLREI 176
           HLNESNVFTHHDL PIKERL+E+S+IVE+            K   P   ED  D  L++ 
Sbjct: 125 HLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIELKKA 184

Query: 177 DNERKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVAS 236
           D E+ KNK+EEDLLLRAKLKHC  EY  +E KLEEIDP+L ++MEKLF+IRRGLLSL AS
Sbjct: 185 DIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSLAAS 244

Query: 237 AKKTMSKSDINTNSLLQEQNDLQTNNESLTDDK--HLVSQEYVHEKLSVLKNELSELESN 294
            K+                     + ESL D K  H VS  +V+ KL+ L+ ELSELES+
Sbjct: 245 TKRNAR------------------SKESLEDKKRTHTVSPNFVNSKLNELQVELSELESH 286

Query: 295 RDDSGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLID 354
           RD SGKFKSLE+ +V E+GQSVLNGLLDDCHDL+NDLSHQ + G++LD  LQPIY+ LID
Sbjct: 287 RDPSGKFKSLETDKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLID 346

Query: 355 IKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRC 414
           IKTTLENL++TRRWTLRETDLF+YQK+L EIDN R++GKFPT+S DSKGQSILLYLLRRC
Sbjct: 347 IKTTLENLLVTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRC 406

Query: 415 YAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNL 474
           YAIIYKLLESSEPVSEALQ IHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLDN+
Sbjct: 407 YAIIYKLLESSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNM 466

Query: 475 RTEGIFYDSDGNIPEGQGILNALLAECFDILHELKV 510
           R +G FYD+DGNIPEGQG LNALLAECFDILHELK+
Sbjct: 467 RVDGKFYDADGNIPEGQGTLNALLAECFDILHELKI 502

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/511 (71%), Positives = 421/511 (82%), Gaps = 18/511 (3%)

Query: 2   FASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 61
            + +G  HPQ VPKEEE ILNYLLEVRS L+KLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65

Query: 62  DDIRKNSHETPAK--SAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 119
           D IRK+S +   +   A TLIH T++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125

Query: 120 LSTVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNE 179
           LSTV+ LLEHL ESNVFTHHDL PIKERL+EISKIVE+   S   DE       +EID E
Sbjct: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVA---EFKEIDTE 182

Query: 180 RKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKK 239
           R KN+IE+DLLL+AKL+HC DEY+ LE KLEEI P LS +ME+LF++RRGLLSL AS+KK
Sbjct: 183 RNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKK 242

Query: 240 TMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSG 299
            +   +    +              L D KH++SQEY+   L   K E++++E+ RD++G
Sbjct: 243 NIPDENYKEPA-------------KLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENG 289

Query: 300 KFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTL 359
           +F S  + +  ++GQ++LNGLLDDC+DL+NDLSHQ NGGLTLDPYLQPIYE+LIDIKTTL
Sbjct: 290 QFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTL 349

Query: 360 ENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIY 419
           ENLMITRRWTLRETDLF+YQK+L EIDN R++GKFPTKS DSKGQSI+LYLLRRCYAIIY
Sbjct: 350 ENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIY 409

Query: 420 KLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGI 479
           KLLESSEPVSE+LQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR +G 
Sbjct: 410 KLLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGK 469

Query: 480 FYDSDGNIPEGQGILNALLAECFDILHELKV 510
           FYDSDGNIPEGQGILNALLA CFDILHELKV
Sbjct: 470 FYDSDGNIPEGQGILNALLAGCFDILHELKV 500

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 80/151 (52%), Gaps = 12/151 (7%)

Query: 378 YQKKLNEIDNKRI-NGKFPTKS---QDSKGQSILLYLLRRCYAIIYKLLESSE---PVSE 430
           Y+K++ +++  R  NG+F +KS    + +GQ+IL  LL  C  +I  L   +     +  
Sbjct: 274 YKKEVAKMEAMRDENGQFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDP 333

Query: 431 ALQPIHNQLSTVRRCL--LELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDGNIP 488
            LQPI+ +L  ++  L  L + R   +  E +L+ YQ +L  +DN+R  G F     +  
Sbjct: 334 YLQPIYEKLIDIKTTLENLMITRRWTLR-ETDLFTYQKQLTEIDNMRVHGKFPTKSPD-S 391

Query: 489 EGQGILNALLAECFDILHELKVEAEEKAQNS 519
           +GQ I+  LL  C+ I+++L +E+ E    S
Sbjct: 392 KGQSIILYLLRRCYAIIYKL-LESSEPVSES 421

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/517 (69%), Positives = 431/517 (83%), Gaps = 14/517 (2%)

Query: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67
           Q  Q VPKEEE ILNY L+VR++L++LK+NRTQYLNS +VQ TYQ VLTKVRELD IRK 
Sbjct: 10  QPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKK 69

Query: 68  SHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127
           +H+  A +  TLIH+ +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL
Sbjct: 70  NHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 129

Query: 128 EHLNESNVFTHHDLSPIKERLEEISKIVE----QKNSSPAYDEDGNDDRLREIDNERKKN 183
           +HL E+ ++THHDL PIK+RL EISKIVE    Q N+     E+  +  +++ID ER +N
Sbjct: 130 QHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDAERTRN 189

Query: 184 KIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT--- 240
           K+E++LLL+AKLKHC D Y+ +E KLE+IDP+L++VMEKLF+IRRGLLSLVAS++     
Sbjct: 190 KLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQ 249

Query: 241 MSKSDINTNSLLQEQNDLQT---NNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDD 297
           +S+ D++T+S    Q+++     N       K+ +S + V EK  VL+N+L  LE++RD+
Sbjct: 250 ISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDE 309

Query: 298 SGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGG----LTLDPYLQPIYEQLI 353
            GKFKSLE+ +VAE GQ VLNGLLDDC+DLV+DLSHQ   G    L++DP LQP+YE+L+
Sbjct: 310 DGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLL 369

Query: 354 DIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRR 413
           +IKTTLENLMITRRWTLRETDLFSYQKKLNEIDN R+NG+FPT++ DS+GQSILLYLLRR
Sbjct: 370 EIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRR 429

Query: 414 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 473
           CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN
Sbjct: 430 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 489

Query: 474 LRTEGIFYDSDGNIPEGQGILNALLAECFDILHELKV 510
           LR +GIFYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 490 LRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/509 (70%), Positives = 420/509 (82%), Gaps = 14/509 (2%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HP  VP EEE IL Y L+VRS L+K+KQNR+Q+LNSKDV  TYQ VLTKVRELD++RKNS
Sbjct: 6   HPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNS 65

Query: 69  HETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
           H TP+ SA TLIHS+ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 66  HATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLE 125

Query: 129 HLNESNVFTHHDLSPIKERLEEISKIVEQK---NSSPAYDEDGNDDRLREI----DNERK 181
           HLNESNV+THHDL PIKERL E+S IVEQ    ++S     + + D + E     D E  
Sbjct: 126 HLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELN 185

Query: 182 KNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTM 241
           KNKIEEDLLLRAKLKHC DEY+ +E KLEEI P L + ME LF+IRRGLLSL +S K+  
Sbjct: 186 KNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPH 245

Query: 242 SKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKF 301
            K  +   ++L  +++        ++ K+++  + + EKL  L+ +L +LES+RD +GKF
Sbjct: 246 QKQLVPDPAVLSVESEA-------SEKKNVLPDQVIDEKLKQLQEQLEKLESHRDINGKF 298

Query: 302 KSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLEN 361
           KSLE+ +V EKGQ+VLNGLLDDCHDLVNDLSHQK+GG++LD  LQPIY+QL+DIKTTLEN
Sbjct: 299 KSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLEN 358

Query: 362 LMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKL 421
           L++TRRWTLRETDLF+YQKKL EIDN R+NGKFPT   DSKGQSILLYLLRRCYAIIYKL
Sbjct: 359 LLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKL 418

Query: 422 LESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFY 481
           LESSEPVSE+LQ +HNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R +G FY
Sbjct: 419 LESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFY 478

Query: 482 DSDGNIPEGQGILNALLAECFDILHELKV 510
           D+DGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 479 DTDGNIPEGQGTLNALLAECFDIIHELKI 507

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/528 (67%), Positives = 422/528 (79%), Gaps = 36/528 (6%)

Query: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67
           QHPQ VP+EEE +LNY LE+R+ L++LKQNRT+YL+SK VQ TY+ VLT+VRELDD+RK+
Sbjct: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73

Query: 68  SHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127
           +HETP+ SA TLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTV+ LL
Sbjct: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133

Query: 128 EHLNESNVFTHHDLSPIKERLEEISKIVEQK---------------NSSPAYDEDGNDDR 172
           EHLNESNVFT HDL PIKERL EI KIVE+                 ++P  DE      
Sbjct: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEAD---- 189

Query: 173 LREIDNERKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLS 232
            R +  E ++NKIEEDLLLRAKL+HC DEY   E K+E +DPSLS +M+KLF+IRR LLS
Sbjct: 190 -RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRELLS 248

Query: 233 LVASAKKTMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELE 292
           L ASAKKT S +                + E   ++KH+++ E V+ ++ +L+ EL+E+E
Sbjct: 249 LAASAKKTTSSA----------------SAEKELENKHVLAPESVNTRVELLQKELNEIE 292

Query: 293 SNRDDSGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQL 352
           S RD++GKFKS ES Q AEKGQ+VLNGLL DC+DL+ DLSHQKNGG+ LDP LQPIY +L
Sbjct: 293 SYRDETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKL 352

Query: 353 IDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLR 412
           IDIKTTLENL+ITRRWTLRETDLF+YQK+L EID+ R+N KFPT S D+KGQ+ILLYLLR
Sbjct: 353 IDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLR 412

Query: 413 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 472
           RCYAIIYKLLESSEPVSE+LQP+HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD
Sbjct: 413 RCYAIIYKLLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLD 472

Query: 473 NLRTEGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQNST 520
            LR +G FYD DGNIPEGQ  LNALLAECFDI+HE+K+EAEEK ++ T
Sbjct: 473 GLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESET 520

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/510 (70%), Positives = 413/510 (80%), Gaps = 22/510 (4%)

Query: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67
           +HPQ VP EEES L Y LEVR+ L++LKQNR+QYLNSKDV +TYQ VLTKVRELD IRK+
Sbjct: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62

Query: 68  SHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127
           SH  PA SA TLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 128 EHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYD-EDGNDDRLREIDNERKKNKIE 186
           EHL+ESNVFTHHDL PIKERL+EIS+IV Q +     +  DG  D   +I +E+ +NKIE
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRID-FAKIQDEKDRNKIE 181

Query: 187 EDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKK-TMSKSD 245
           EDLLLRAKL+HC  EY+ +E KLEEIDP L + MEKLF++RRGLLSL AS K+  MSK  
Sbjct: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQG 241

Query: 246 INTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLE 305
           + T                      L+ QE + ++L  L+ EL+E+ES+RD SGKF SLE
Sbjct: 242 VKTPD-------------------SLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLE 282

Query: 306 SHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMIT 365
           + ++A KGQ+VLNGLLDDCHDL+NDLSH  N  ++LD  LQPIY+ LIDIKTTLENL++T
Sbjct: 283 TGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVT 342

Query: 366 RRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 425
           RRWTLRETDLFSYQK+L+EID  R+ GKFPT++ D+KGQ+ILLYLLRRCYAIIYKLLE S
Sbjct: 343 RRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECS 402

Query: 426 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDG 485
           EPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R +G FYD DG
Sbjct: 403 EPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDG 462

Query: 486 NIPEGQGILNALLAECFDILHELKVEAEEK 515
           NIPEGQG LNALLAECFDILHELK+EAEE+
Sbjct: 463 NIPEGQGTLNALLAECFDILHELKIEAEER 492

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/511 (68%), Positives = 406/511 (79%), Gaps = 25/511 (4%)

Query: 7   QQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRK 66
            +HPQ VP EEE+ L Y LEVR+ L++LKQNR+QYLNSK+V + YQ VLTKVRELD+IRK
Sbjct: 2   HKHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRK 61

Query: 67  NSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESL 126
            SH  P  SA TLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ L
Sbjct: 62  RSHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 121

Query: 127 LEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDR----LREIDNERKK 182
           LEHL+ESNVFTHHDL PIKERL+EIS+IV Q   S  + E G  +       +I +E+ +
Sbjct: 122 LEHLDESNVFTHHDLRPIKERLDEISEIVTQ---SSFFKEGGEINNGSIDFTKISDEKDR 178

Query: 183 NKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMS 242
           NKIEEDLLLRAKLKHC  EY  +E KLEEIDP L   MEKLF +RRGLLSL AS K+   
Sbjct: 179 NKIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKR--- 235

Query: 243 KSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFK 302
                 N++L++ +    +          +SQE V EKL  L+ +L+++ES R+ SG F 
Sbjct: 236 ------NAMLKDGHKAPESP---------LSQESVKEKLHSLEAKLTQIESQRNASGYFV 280

Query: 303 SLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENL 362
           S ++ ++ E+GQSVLNGLLDDCHDL+NDLSH  N  +TLD  LQPIY+ LI+IKTTLENL
Sbjct: 281 SADTGEIVERGQSVLNGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENL 340

Query: 363 MITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLL 422
           ++TRRWTLRETDLF+YQK+L+EID  R+ GKFPT+S D+KGQ+ILLYLLRRCYAIIYKLL
Sbjct: 341 LVTRRWTLRETDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLL 400

Query: 423 ESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYD 482
           E SEPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R +G FYD
Sbjct: 401 ECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYD 460

Query: 483 SDGNIPEGQGILNALLAECFDILHELKVEAE 513
            DGNIPEGQG LNALLAECFDILHELK+EAE
Sbjct: 461 EDGNIPEGQGTLNALLAECFDILHELKIEAE 491

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/512 (64%), Positives = 411/512 (80%), Gaps = 22/512 (4%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQIVP EEE ILN+LLEVR+ LAKLKQNRTQ+LN+K VQ TYQ VLTKVRELD+IRKNS
Sbjct: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73

Query: 69  HETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
             TPAK+A TLIH ++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLSTV+ LLE
Sbjct: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133

Query: 129 HLNESNVFTHHDLSPIKERLEEISKIVEQK-------NSSPAYDEDGNDDRLREIDNERK 181
           HLNES +FT HDL PIKERL+EI +IVE+        N S        +  L EI+NER 
Sbjct: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHELIEIENERT 193

Query: 182 KNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTM 241
           +N+IEEDLL+RAKL+ C ++++ +E +LE+I+P+LS++++KL+ IRRGLLSL +    T+
Sbjct: 194 RNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTNDTL 253

Query: 242 SKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKF 301
           SKSD          N + + N +++D  H   +E V   L  +K +L E+ES RD++G +
Sbjct: 254 SKSD---------NNHIASTNHNVSDKSH---KELV---LLKMKKQLVEIESQRDENGYY 298

Query: 302 KSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLEN 361
           KSLE+++V  +GQ ++N L+DDC+DL+NDLSH +NG +  DPYLQ IY+ LIDIKT L N
Sbjct: 299 KSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLAN 358

Query: 362 LMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKL 421
           LM+TRRWTLRETDLFSYQKKL EID+ R+NGKF + + D+KGQSI+LYLLRRCYAIIYKL
Sbjct: 359 LMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKL 418

Query: 422 LESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFY 481
           LESSEP+SE+LQ IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD LR +G FY
Sbjct: 419 LESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFY 478

Query: 482 DSDGNIPEGQGILNALLAECFDILHELKVEAE 513
           D++G+IPEGQGILNA+LAECFD++HELK +AE
Sbjct: 479 DANGDIPEGQGILNAMLAECFDMVHELKCDAE 510

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/524 (65%), Positives = 417/524 (79%), Gaps = 25/524 (4%)

Query: 4   SAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDD 63
           S+  Q  Q +PKEEE IL+Y LE+R+ L++LKQNR Q+L SKDV  TYQ VLTKVRELD 
Sbjct: 2   SSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDK 61

Query: 64  IRKNSHETPAK--SAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 121
           IRK +HE+        TLIHS +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLS
Sbjct: 62  IRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLS 121

Query: 122 TVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRL--REIDNE 179
           TV+SLL+HLNESNV+TH+DL PIKERL+EIS+IVE KNS      DG D      +++++
Sbjct: 122 TVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVE-KNSYWNIPTDGGDGNAFADDLEDK 180

Query: 180 RKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKK 239
           RK+N IEE+LLLRAKL++C   Y+ +E KLE I   L   ME+LF+IRRGLLSL ASAK 
Sbjct: 181 RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKS 240

Query: 240 TMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSG 299
            + + +       Q++ND         D+  ++S E ++E+L  L+ EL+++ S+R++SG
Sbjct: 241 RVEQEE-------QDEND---------DELCILSHEKINERLKALETELADVRSHRNESG 284

Query: 300 KFKSL-ESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTT 358
           KF S+ + + V EKGQ VLNGLLDDCHDL+ DLSHQ + GL LDP++QPIY+ L+ IKT 
Sbjct: 285 KFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTI 344

Query: 359 LENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAII 418
           LENL++TRRWTLRETDLF+YQKKL E+D+ R+NGKFP++S DSKGQ+ILLYLLRRCYAII
Sbjct: 345 LENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAII 404

Query: 419 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEG 478
           YKLLESSEPVSE+L+ IHNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R +G
Sbjct: 405 YKLLESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDG 464

Query: 479 IFYDSDGNIPEGQGILNALLAECFDILHELKVEA---EEKAQNS 519
            FYD DGNIPEGQG LNALLAECFDILHE+K+EA   EE AQ++
Sbjct: 465 KFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREEAAQSN 508

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/508 (65%), Positives = 395/508 (77%), Gaps = 43/508 (8%)

Query: 11  QIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRK---- 66
           Q VPKEEE  L+YLL+VR +L+ LKQNR+Q+LNSKD+Q TYQ VLTKVRELD+IR+    
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 67  NSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESL 126
           NS ET  K   T +HS ELHNRVD+VLDDVFQLLSLCF+T GLKNSAPATYASLSTV+SL
Sbjct: 70  NSQETEIK---TFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSL 126

Query: 127 LEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDE----DGNDDRLREIDNERKK 182
           LEHL ES ++THHDL PIKERL+EI+KIV+Q   S  Y +    D +D+ +  IDNER K
Sbjct: 127 LEHLIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSRIDNERNK 186

Query: 183 NKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMS 242
           NKIE++LLL+AKL HC  EY+ +E +LEE+DPS ++++EKLF+IRR L+SLV  +K    
Sbjct: 187 NKIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVEISK---- 242

Query: 243 KSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFK 302
                +N+ +Q+Q D                     +KL  L+ +L+E+E+NRD  G F 
Sbjct: 243 -----SNTGVQDQID---------------------KKLKHLQLQLNEIENNRDPDGNFV 276

Query: 303 SLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENL 362
           S+ES     KG +VLNGL DDCHDL++DL+H       LDP LQ +Y+ LID+K +LENL
Sbjct: 277 SIESGNPIIKGSNVLNGLSDDCHDLISDLTHHTKT--FLDPDLQNVYDNLIDVKGSLENL 334

Query: 363 MITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLL 422
           M+TRRWTLRETDLFSY KKLNEIDN R++GKFPTKS  +KGQ+ILLYLLRRCY +IYKLL
Sbjct: 335 MVTRRWTLRETDLFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLL 394

Query: 423 ESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYD 482
           ESSEPVSEALQPIHNQLSTVRRCLL+LKRMGGVNNERELYPYQMKLASLDNLR +G FYD
Sbjct: 395 ESSEPVSEALQPIHNQLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYD 454

Query: 483 SDGNIPEGQGILNALLAECFDILHELKV 510
           S GNIPEGQGILNALLA CFDILHELK+
Sbjct: 455 SKGNIPEGQGILNALLAGCFDILHELKI 482

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/498 (65%), Positives = 391/498 (78%), Gaps = 24/498 (4%)

Query: 13  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHETP 72
           VPKEEESIL YLL+VR+ LAKLK NR+Q+LNSK+VQ  +Q VLTKVRELDDIRK      
Sbjct: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79

Query: 73  AKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLEHLNE 132
           A  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTV+ LLEHL+E
Sbjct: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139

Query: 133 SNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNERKKNKIEEDLLLR 192
           SN+FT+HDL PIK+RL+EIS IVE  NS   YD D  +    E + +R KNKIEEDLLLR
Sbjct: 140 SNIFTNHDLRPIKDRLDEISTIVEN-NSYRNYDFDLTNPA-DETEEKRNKNKIEEDLLLR 197

Query: 193 AKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSDINTNSLL 252
           AKLKHC DEY+ +  KLEEI P LS++MEKL+ IRR LLSL + ++K  ++ D +     
Sbjct: 198 AKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKIDTREDFSQ---- 253

Query: 253 QEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLESHQVAEK 312
                  ++ ES              E LS L+ EL ELES+RD++G FKSLE+ +V  K
Sbjct: 254 -----FNSSKES-------------QEALSSLEQELEELESHRDENGNFKSLETGEVVLK 295

Query: 313 GQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMITRRWTLRE 372
           GQ+VL GL+D+CHDL+ND ++  NG   +DP L+PIY++LI+IKT L NLMITRRWTLR+
Sbjct: 296 GQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRD 355

Query: 373 TDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESSEPVSEAL 432
           TDLF YQKKL  IDNKR+NGKFPTKS D+KGQ+ILLYLLRRCYAIIYKLLESS PVSE+L
Sbjct: 356 TDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESL 415

Query: 433 QPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDGNIPEGQG 492
           Q IHNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR +G F+D++G IPEGQG
Sbjct: 416 QSIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQG 475

Query: 493 ILNALLAECFDILHELKV 510
            LNALLAECFDI+HEL++
Sbjct: 476 TLNALLAECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/513 (61%), Positives = 385/513 (75%), Gaps = 30/513 (5%)

Query: 13  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS---- 68
           VP+ E  IL YL++VR  L +LK NR++YLNSK+V+  +Q VLTKVRELDDIRK+     
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 69  --HETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESL 126
              ++  +   TL+ +  LHN+VDS++DDVFQLLSLCFLTVGLKNSAPATY SLSTV+ L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 127 LEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDN-ERKKNKI 185
           LEHL+ESN+FT+HDL PIKERL+EISKIV Q NS   Y+ + ++    ++D+ E K+N I
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIV-QNNSYKNYEFNEDEINPNQVDDDEIKQNLI 195

Query: 186 EEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSD 245
           EEDLLLRAKLK C DE+  +  KLEEIDP L+++MEKL+ IRR LLSL +   K  +  +
Sbjct: 196 EEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPTHKIDTTEN 255

Query: 246 INTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLE 305
           I+             N ES    KHL              +EL+ELE++RD+ G FKSLE
Sbjct: 256 ISI---------FNNNEESRKMLKHL-------------SDELTELETHRDEDGNFKSLE 293

Query: 306 SHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMIT 365
           +++V  KGQ+ L GL+D+CHDL+ND ++       LD  LQPIY  LI+IKT L NLMIT
Sbjct: 294 TNEVKLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMIT 353

Query: 366 RRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 425
           RRWTLRETDLF YQK+L EID++R+NGKFP++S ++KGQSILLYLLRRCYAIIYKLLESS
Sbjct: 354 RRWTLRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESS 413

Query: 426 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDG 485
           EPVSE+LQPIHNQLST RRCLL LKRMGGVN+ RELYPYQ+KLASLD LR +G FYDS G
Sbjct: 414 EPVSESLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSG 473

Query: 486 NIPEGQGILNALLAECFDILHELKVEAEEKAQN 518
            IPEGQG LNALLAECFD+LHEL++E+EE   N
Sbjct: 474 EIPEGQGTLNALLAECFDMLHELEIESEESVDN 506

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/467 (62%), Positives = 353/467 (75%), Gaps = 22/467 (4%)

Query: 49  TTYQHVLTKVRELDDIRKNSHETPAKSAA-TLIHSTELHNRVDSVLDDVFQLLSLCFLTV 107
            TYQ VLTKVR LD +RK  H     +   TLIHS  LHNRVDSVLDDVFQLLSL FLTV
Sbjct: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61

Query: 108 GLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDED 167
           GLKN+APATYASLSTV+ LLEH+ E+NV+T+ DL PIKERL+EI +IVE KNS  +  ED
Sbjct: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVE-KNSYMSMVED 120

Query: 168 GNDDRLREIDNERKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIR 227
             +  L E+  E++ NK+EEDLL+RAKL+HC D Y  ++ K   I P L  + +KLF IR
Sbjct: 121 --EAPLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIR 178

Query: 228 RGLLSLVASAKKTMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNE 287
           R LLSL ASAK   +  + +T     E++    +  +L              +L  L++ 
Sbjct: 179 RELLSLAASAKTDRAAGEGST-----ERSTTPASPNTLA------------SRLKDLESM 221

Query: 288 LSELESNRDDSGKFKSLE-SHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQ 346
           + E+ES+RDDSGKF S +    V +KGQS LNGLLDDC +L  DLSHQ +G L LDP LQ
Sbjct: 222 ILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQ 281

Query: 347 PIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSI 406
           PIYE+L++IKTTLENL++TRRWTLRETDLF+YQK+L E+DN R+N K P+ S  SKGQ++
Sbjct: 282 PIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQAL 341

Query: 407 LLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQM 466
           +LYLLRRCYA IYKLLESSEPVSE+LQ IHNQLSTVRRCL ELKRMGGV++ER+LYPYQM
Sbjct: 342 ILYLLRRCYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQM 401

Query: 467 KLASLDNLRTEGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAE 513
           KLASLDN+R +G FYD+DGNIPEGQG LNALLAECFDILHE+K+EAE
Sbjct: 402 KLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAE 448

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 96/213 (45%), Gaps = 31/213 (14%)

Query: 335 KNGGLTLDPYLQPIYEQLIDIKTTLENLMITRRW--------TLRETD------LFSYQK 380
           K+   T+ P LQP+ ++L  I+  L +L  + +         T R T       L S  K
Sbjct: 157 KSKPATIPPELQPLSDKLFHIRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLK 216

Query: 381 KLN----EIDNKRIN-GKFPTK----SQDSKGQSILLYLLRRCYAIIYKLLESSEPV--- 428
            L     E+++ R + GKF +     +   KGQS L  LL  C  +   L   +  V   
Sbjct: 217 DLESMILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHL 276

Query: 429 SEALQPIHNQLSTVRRCL--LELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDGN 486
              LQPI+ +L  ++  L  L + R   +  E +L+ YQ +LA LDNLR       S   
Sbjct: 277 DPQLQPIYEELLEIKTTLENLLVTRRWTLR-ETDLFAYQKRLAELDNLRVNRKSPSSSSA 335

Query: 487 IPEGQGILNALLAECFDILHELKVEAEEKAQNS 519
             +GQ ++  LL  C+  +++L +E+ E    S
Sbjct: 336 S-KGQALILYLLRRCYATIYKL-LESSEPVSES 366

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  181 bits (459), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 134/441 (30%), Positives = 233/441 (52%), Gaps = 65/441 (14%)

Query: 115 ATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNS-------------- 160
           + Y+S+  ++ LL  LN+SN+FT +DLSP+K RL+EI  I+E   S              
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 161 -----------------------SPAYDEDGNDDRLREIDNERKKNKIEEDLLLRAKLKH 197
                                  +P    D  + +L++ D+   K  I ++L        
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQEL------DD 186

Query: 198 CKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSDINTNSLLQEQND 257
           C   ++++E K + ID +LS++++K+  +R+ LL +V S  K++         +L++ N 
Sbjct: 187 CYKVHNVIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCF----VLKDPNH 242

Query: 258 LQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLESHQVAEKGQSVL 317
           +  +    T DK L     +   L V+K + +E +  +    K      ++    GQ +L
Sbjct: 243 MSNS----TFDKKL---NEIQRNLDVIKEKNTEYDEGQSQRNK------NEGNINGQRIL 289

Query: 318 NGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMITRRWTLRETDLFS 377
           NGL+D C ++++D+       +  D     ++E+ + +K  LE +++T R +L+  DLF+
Sbjct: 290 NGLVDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFN 348

Query: 378 YQKKLNEIDNKRINGKFPTKSQDS-KGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIH 436
             K+L++++ + I        +DS + +SI+++ LRRC+ IIYK+LESSEPV   L+P++
Sbjct: 349 LHKELSKLEKRTIRH---YNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLY 405

Query: 437 NQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDGNIPEGQGILNA 496
           NQLST+ R LL+LK  GGV    +L P ++KL ++ + R    F D  GNIP GQ  LNA
Sbjct: 406 NQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNA 465

Query: 497 LLAECFDILHELKVEAEEKAQ 517
           LL EC ++L  L+++ E + +
Sbjct: 466 LLHECMELLKILEIDFEGRTR 486

>TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {ON}
           Anc_6.70 YLR273C
          Length = 918

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 50/101 (49%), Gaps = 12/101 (11%)

Query: 288 LSELESNRDDSGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQP 347
           L + E N D+  KF   E++  +++G S L+ L+++ +    DL  + N   T  P  +P
Sbjct: 172 LRQFEINNDNDSKFPFFENNDDSDEGDSELDHLINNSYLFSKDLFFKSNKNYTFSP--KP 229

Query: 348 IYEQ---------LIDIKTTLENLMITRRWTLRETDLFSYQ 379
           + +           ID  T+L   + T+ W L ++++ S++
Sbjct: 230 MNQNQNIDDAINDFIDC-TSLHRAVTTKNWKLLKSNVSSFE 269

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 86/184 (46%), Gaps = 29/184 (15%)

Query: 76   AATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLEHLNESNV 135
            +A L H TEL N +  + ++           V L        + +S +E  +++L +SN 
Sbjct: 960  SANLSHETELKNNIKQMTEN----------NVTLTTENKGLISKISNLELTIDNLKKSND 1009

Query: 136  FTHHDLSPIKERLEE-ISKIVEQKNSSPAYDEDGNDDRLREIDNERKKNKIEEDL-LLRA 193
                  S  K  LEE I  + EQ N   A          +EI NERK N +E  L  +++
Sbjct: 1010 AKSAQFSDDKNELEESIMHLNEQLNEIEAE---------KEI-NERKVNDLEGQLNSVKS 1059

Query: 194  KLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRI---RRGLLSLVASAKKTMSKSDINTNS 250
            +L    DE  +L+ KL+ ++  L+T  +KL      +R L  L+ ++K  M    I++N+
Sbjct: 1060 ELTKNMDEITLLKTKLDTVNEDLTTSKQKLIESENEKRELSKLLENSKNAM----IDSNN 1115

Query: 251  LLQE 254
             L+E
Sbjct: 1116 KLEE 1119

>AFR429C Chr6 complement(1208115..1208891) [777 bp, 258 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL207W
          Length = 258

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 208 KLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSDINTNSLLQEQNDLQTNNESLTD 267
           KL  + P +S VM  +  +RR L+ L+ S  K++ ++ +  N  + +   + TN  SL +
Sbjct: 19  KLWVLLP-ISVVMILVGVVRRYLMILLTSKVKSVPRATVTENQYISKAIAMLTNGSSLHE 77

Query: 268 DKHLVSQEYVHEKLS 282
           +   + QEY+   LS
Sbjct: 78  EAFRMRQEYLAGVLS 92

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 28/121 (23%)

Query: 269 KHLVSQEYVH--------------EKLSVLKNELSELESNRDDSGKFKSLESHQVAEKGQ 314
           KHL    Y H              E +SVL+  + EL+S  D++ +F ++E  Q  + GQ
Sbjct: 81  KHLSEMTYPHNLVDLSFLVSDSKDETMSVLRQHVRELQSQPDNARQFGNIEIFQ-KDFGQ 139

Query: 315 SVLNGLLDDCHDLVND------LSHQKN--GGLTLDPYLQPIYEQLIDIKTT----LENL 362
           ++      D H           ++  +N  G + L PY   +Y + +D++T     +E+L
Sbjct: 140 AIGQS-FSDRHGFAAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETVPQTIIEDL 198

Query: 363 M 363
           M
Sbjct: 199 M 199

>YLR457C Chr12 complement(1055812..1056771) [960 bp, 319 aa] {ON}
           NBP1Spindle pole body (SPB) component, required for the
           insertion of the duplication plaque into the nuclear
           membrane during SPB duplication; essential for bipolar
           spindle formation; component of the Mps2p-Bbp1p complex
          Length = 319

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 20/94 (21%)

Query: 415 YAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNL 474
           Y I+  LL+SS         IH   +  RR +  L R        E+ P ++ L+     
Sbjct: 210 YRILEDLLDSSN--------IHPSYTKSRRTMSNLAREND-----EIKPLKIDLSPSPIR 256

Query: 475 RTEGIF-------YDSDGNIPEGQGILNALLAEC 501
           RT  +F       Y+ DGNIPE Q +   +   C
Sbjct: 257 RTNSLFTSSPMKTYNRDGNIPEMQPLQENISPAC 290

>KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} similar
           to uniprot|P32767 Saccharomyces cerevisiae YGL016W
           KAP122 Karyopherin beta responsible for import of the
           Toa1p-Toa2p complex into the nucleus binds to
           nucleoporins Nup1p and Nup2p may play a role in
           regulation of pleiotropic drug resistance
          Length = 1059

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 18/84 (21%)

Query: 72  PAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGL------KNSAPATYASLSTVES 125
           PA ++  L+  T+L +            LSL FLT+         N  PA    ++T   
Sbjct: 99  PAAASNLLVTITKLMSN-----------LSLIFLTINSDAIGADSNKIPAWRNPVNTCIK 147

Query: 126 LLEHLNESNVFTHH-DLSPIKERL 148
           LL+H NESN+F    D S I ERL
Sbjct: 148 LLQHCNESNLFEWRTDNSEIAERL 171

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 100 LSLCFLTVGLKNS------APATYASLSTVESLLEHLNESNVFTHHD 140
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54

>Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W
           (REAL)
          Length = 451

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 3/85 (3%)

Query: 272 VSQEYVHEKLSVLKNELSELESNRDDSGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDL 331
           +S++ + + L  L  ++ ELESNRD   K  + +  +++E G   LN LL +    ++DL
Sbjct: 218 ISKQSIFKDLEALSFQIVELESNRDKLIKISNTDIRELSE-GIKELNNLLTERKKTLHDL 276

Query: 332 S-HQKNGGLTLDPYLQPIYEQLIDI 355
           S  QKN   T+  + + I  +L D+
Sbjct: 277 STQQKNLQATVTTF-ETIISELYDV 300

>TBLA0B04240 Chr2 (977985..980519) [2535 bp, 844 aa] {ON} Anc_8.609
           YOR198C
          Length = 844

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 57/105 (54%), Gaps = 13/105 (12%)

Query: 204 ILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSDINTNSLLQEQNDLQTNNE 263
           +L+G++++ID  L  +  +L  + +G      +  +TM        ++++EQNDL++N  
Sbjct: 51  VLQGQIKKIDIELEKIKSELNDVSKG-----TNQSQTMKSLQDRRKAIVKEQNDLKSN-- 103

Query: 264 SLTDDKHLVSQEYVHEKLSVLKNEL-SELESNR--DDSGKFKSLE 305
            L  DK +   E V++ +    NE+ ++LESN      GK K++E
Sbjct: 104 RLQIDKQM---ELVNQSIKKKNNEINTKLESNNKLKSKGKMKTVE 145

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1228

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 51/131 (38%), Gaps = 34/131 (25%)

Query: 36  QNRTQYLNSKDVQTTYQ--HVLTKVRELDDIRKNSHET---------------------- 71
           Q++ +  NSK+ +  Y+   VL K   LDD+  N  ET                      
Sbjct: 479 QSKIESTNSKEYELNYKLREVLVK---LDDLSANQRETNKERKLRENVATLKRLFPGVRG 535

Query: 72  -------PAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 124
                  P K    +  ST L    DSV+ D F +   C   +  + S  A++  L T++
Sbjct: 536 LVHDLCHPKKDKYAVAVSTVLGKNFDSVIVDNFSVAQECISYLKRQRSGVASFIPLDTID 595

Query: 125 SLLEHLNESNV 135
           ++  +L  SN 
Sbjct: 596 AITANLPVSNT 606

>SAKL0H00506g Chr8 (59093..64459) [5367 bp, 1788 aa] {ON} highly
           similar to uniprot|Q04952 Saccharomyces cerevisiae
           YMR306W FKS3 Protein of unknown function has similarity
           to 1,3-beta-D-glucan synthase catalytic subunits Fks1p
           and Gsc2p
          Length = 1788

 Score = 31.6 bits (70), Expect = 7.7,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 17/111 (15%)

Query: 230 LLSLVASAKKTMSKSDINTNSLLQEQNDLQTNN-ESLTDDKHLVSQEYVHEKLSVLKNEL 288
           LL+L    K+  SKS I   +LL+    L  N  E    D  L++ E      S+ KN++
Sbjct: 739 LLTLKEIIKEESSKSRI---TLLEYLKQLHPNEWECFVRDTKLLALENGQISRSIEKNDI 795

Query: 289 SELESNRDDSGKFKSLESHQVAEKGQ-SVLNGLLDDCHDL-----VNDLSH 333
               + +       SLE+HQV + G+  +L   +DD  DL     +NDL +
Sbjct: 796 DTTSTMK------SSLENHQVRDDGEGQILPSTIDD-RDLIIQSKINDLPY 839

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1869

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 2/101 (1%)

Query: 197 HCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSDINTNSLLQEQN 256
             K++Y+ LEGK ++++ SL  V  +L  I +   +L A+ KK       N   +   ++
Sbjct: 762 RLKNDYEFLEGKHKKVEKSLENVSTRLIEITKDKENLTAANKKITETFASNKKKIEAYES 821

Query: 257 DLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDD 297
            + T    L D      +E   E ++ +  EL  LE N++D
Sbjct: 822 KINTLESKLRD--ITSKKEQAEEGINKMSRELFNLEKNKED 860

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,867,795
Number of extensions: 2778650
Number of successful extensions: 14586
Number of sequences better than 10.0: 714
Number of HSP's gapped: 15225
Number of HSP's successfully gapped: 891
Length of query: 551
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 436
Effective length of database: 40,294,809
Effective search space: 17568536724
Effective search space used: 17568536724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)