Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPL259C (APM1)7.127ON47547524630.0
Suva_16.457.127ON47847823390.0
Smik_6.4667.127ON47647623320.0
Skud_16.197.127ON47647622990.0
NCAS0E021407.127ON48147518880.0
CAGL0K00539g7.127ON45647618730.0
KNAG0L009507.127ON46148018720.0
KAFR0L004707.127ON46547418690.0
TBLA0A009507.127ON46947718550.0
NDAI0E036807.127ON44447518290.0
ZYRO0C05236g7.127ON44747418250.0
SAKL0F05346g7.127ON44747418170.0
TDEL0H028907.127ON44247418160.0
Kpol_1062.567.127ON45047318150.0
Kwal_55.208437.127ON44147317640.0
Ecym_83507.127ON44547417640.0
TPHA0C043207.127ON45447617600.0
KLTH0F12584g7.127ON44147317540.0
ADL017C7.127ON44347417510.0
KLLA0D14311g7.127ON44347417110.0
Ecym_52393.165ON4644895671e-66
KLTH0F06534g3.165ON4665035373e-62
SAKL0C07414g3.165ON4825195183e-59
Kwal_33.141823.165ON4675075138e-59
NCAS0C035803.165ON4915105095e-58
KLLA0C03894g3.165ON4754995033e-57
CAGL0C05203g3.165ON4755164972e-56
TDEL0D045803.165ON4825124885e-55
NDAI0G029203.165ON4865104861e-54
SAKL0D13090g2.555ON4995504826e-54
Kpol_1045.443.165ON4695094631e-51
ZYRO0B04840g3.165ON4765084613e-51
Kwal_26.81462.555ON5055574563e-50
ADR315W3.165ON4923944537e-50
TBLA0F008403.165ON4815114519e-50
ABR047W2.555ON4984864405e-48
KLTH0D07502g2.555ON5045534405e-48
YOL062C (APM4)3.165ON4915204203e-45
Suva_15.1033.165ON4915184133e-44
Skud_15.913.165ON4915124133e-44
TPHA0P006603.165ON4734444062e-43
KLLA0F25432g2.555ON5075514073e-43
Smik_15.963.165ON4913144012e-42
Ecym_45912.555ON5015063914e-41
KNAG0K011503.165ON4745063712e-38
TPHA0I023902.555ON5593603522e-35
ZYRO0E05874g2.555ON5493563338e-33
TDEL0B064302.555ON5253483257e-32
NCAS0A126502.555ON5883593214e-31
Kpol_1056.132.555ON5413643143e-30
CAGL0K03223g2.555ON5983913101e-29
Smik_8.232.555ON6033653073e-29
KAFR0A020602.555ON5403573045e-29
Skud_8.262.555ON5963843039e-29
KAFR0C010203.165ON4285002943e-28
YHL019C (APM2)2.555ON6053882941e-27
Suva_8.332.555ON5963862904e-27
KNAG0C055502.555ON5823762878e-27
TBLA0B067602.555ON6572552142e-17
NDAI0B016102.555ON6722541921e-14
KLLA0E18789g2.522ON4973301358e-08
TPHA0C041302.522ON5331631312e-07
SAKL0A09218g2.522ON4732881242e-06
TDEL0A029702.522ON4961571222e-06
KAFR0D035602.522ON4551831195e-06
KLTH0D06556g2.522ON4561601196e-06
Kwal_26.79572.522ON4561481152e-05
TBLA0I006202.522ON6091671143e-05
AGL061W2.522ON4111541124e-05
KLLA0D11396g3.575ON5361371081e-04
Kpol_1018.422.522ON5751641062e-04
ZYRO0E09746g3.575ON5381371053e-04
NCAS0A048702.522ON4893341010.001
Suva_4.5482.522ON4841531000.001
CAGL0A04741g3.575ON536203980.002
Skud_2.4192.522ON484150970.003
YBR288C (APM3)2.522ON483161970.003
NCAS0F040103.575ON547137970.003
ZYRO0B01738g2.522ON492158950.005
Smik_2.4302.522ON484149940.006
KLTH0H11770g1.388ON15692890.007
AFR274C3.575ON532122940.007
KLTH0G00528g3.575ON633137930.010
TBLA0E001403.575ON543159920.012
Ecym_60073.575ON537122910.015
Kwal_47.192923.575ON538139900.020
NDAI0B063203.575ON540122890.025
TDEL0D064303.575ON536137890.026
CAGL0L02145g2.522ON54336890.026
SAKL0F00594g3.575ON545122880.031
Skud_6.1423.575ON546122870.047
Smik_7.3713.575ON598122860.068
YFR051C (RET2)3.575ON546122850.071
SAKL0D08074g1.388ON15687790.13
NDAI0G052101.388ON156134790.14
TBLA0A012601.388ON156120780.23
Ecym_72662.522ON517150810.25
CAGL0B04983g1.388ON156119770.26
TPHA0G037003.575ON539137800.28
ZYRO0E05236g1.388ON15687760.38
Suva_12.63.575ON546122790.45
TDEL0B061901.388ON156107750.46
KNAG0A069702.522ON50545760.83
ZYRO0E03102g1.463ON1117124760.99
NDAI0K019302.522ON612156761.1
CAGL0D04510g3.443ON248077761.2
KAFR0J001303.575ON543123751.3
Kpol_380.133.575ON535122741.6
KNAG0B029807.277ON28867732.0
KLLA0B06545g1.505ON14854702.2
KLLA0F22814g1.388ON15672693.6
YLR170C (APS1)1.388ON15690683.7
Kpol_507.73.575ON533116714.3
AGL161C8.352ON77043705.0
NCAS0F024305.285ON86262697.2
NCAS0A087901.388ON156134667.3
TPHA0B035701.388ON15677667.9
Smik_12.2321.388ON15672668.7
TBLA0C069905.21ON51138689.3
AFR124W1.388ON15679659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL259C
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   953   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   905   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   902   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   890   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   731   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   726   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   725   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   724   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   719   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   709   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   707   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   704   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   704   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   703   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   684   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   684   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   682   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   680   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   679   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   663   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   223   1e-66
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   211   3e-62
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   204   3e-59
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   202   8e-59
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   200   5e-58
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   198   3e-57
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   196   2e-56
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   192   5e-55
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   191   1e-54
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   190   6e-54
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   182   1e-51
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   182   3e-51
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   180   3e-50
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   179   7e-50
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   178   9e-50
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   174   5e-48
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   174   5e-48
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   166   3e-45
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   163   3e-44
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   163   3e-44
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   160   2e-43
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   161   3e-43
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   159   2e-42
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   155   4e-41
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   147   2e-38
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   140   2e-35
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   132   8e-33
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   129   7e-32
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   128   4e-31
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   125   3e-30
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   124   1e-29
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   122   3e-29
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   121   5e-29
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   121   9e-29
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   117   3e-28
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   117   1e-27
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   116   4e-27
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   115   8e-27
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    87   2e-17
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    79   1e-14
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    57   8e-08
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    55   2e-07
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    52   2e-06
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    52   2e-06
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    50   5e-06
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    50   6e-06
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    49   2e-05
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    49   3e-05
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    48   4e-05
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    46   1e-04
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    45   2e-04
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    45   3e-04
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    44   0.001
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    43   0.001
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    42   0.002
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    42   0.003
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    42   0.003
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    42   0.003
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    41   0.005
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    41   0.006
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    39   0.007
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    41   0.007
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    40   0.010
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    40   0.012
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    40   0.015
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    39   0.020
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    39   0.025
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    39   0.026
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.026
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    39   0.031
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    38   0.047
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    38   0.068
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    37   0.071
SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {O...    35   0.13 
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    35   0.14 
TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.38...    35   0.23 
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    36   0.25 
CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly ...    34   0.26 
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    35   0.28 
ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {O...    34   0.38 
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     35   0.45 
TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {...    33   0.46 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   0.83 
ZYRO0E03102g Chr5 complement(240333..243686) [3354 bp, 1117 aa] ...    34   0.99 
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    34   1.1  
CAGL0D04510g Chr4 (440080..447522) [7443 bp, 2480 aa] {ON} simil...    34   1.2  
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    33   1.3  
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    33   1.6  
KNAG0B02980 Chr2 (576330..577196) [867 bp, 288 aa] {ON} Anc_7.27...    33   2.0  
KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly ...    32   2.2  
KLLA0F22814g Chr6 complement(2119266..2119736) [471 bp, 156 aa] ...    31   3.6  
YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}  ...    31   3.7  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    32   4.3  
AGL161C Chr7 complement(394886..397198) [2313 bp, 770 aa] {ON} S...    32   5.0  
NCAS0F02430 Chr6 (480483..483071) [2589 bp, 862 aa] {ON} Anc_5.2...    31   7.2  
NCAS0A08790 Chr1 (1739972..1740442) [471 bp, 156 aa] {ON} Anc_1....    30   7.3  
TPHA0B03570 Chr2 complement(834660..835130) [471 bp, 156 aa] {ON...    30   7.9  
Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {O...    30   8.7  
TBLA0C06990 Chr3 complement(1686545..1688080) [1536 bp, 511 aa] ...    31   9.3  
AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic hom...    30   9.5  

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/475 (97%), Positives = 463/475 (97%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNATRPPVALTNSVSWRPEGITHKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
           SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475
           ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/478 (92%), Positives = 454/478 (94%), Gaps = 3/478 (0%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDH+GKPLLSRRYRDDIPLSAIDKFP LLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VAI TSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNATRPPVALTNSVSWRPEGI+HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIP-S 239
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDD +N+P +
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 240 ASATTSDNNTE--TDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPP 297
           AS TTSDN T+  TDKKPSITSSS  +K+KVNIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 298 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 357
           DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 358 DADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKS 417
           DADTPTFKYSHGSLKYVPEKSAILWK+RSFPGGKEYSMSAELGLPSISN  DG++T+PK+
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 418 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475
           NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/476 (93%), Positives = 458/476 (96%), Gaps = 1/476 (0%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDHNGKPLLSRRYRDD+PLSAIDKF  LLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VAIVTSL+ANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNATRPPVALTNSVSWRPEGITHKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLD+D+NIPSA
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 241 -SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 299
            SA TSDNNT+TDKKPSITSSS T+K+KVNIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 300 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 359
           KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 360 DTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNA 419
           DTPTFKYSHGSLKYVPEKSAILWK+RSFPGGKEYSMSAELGLPSIS ++DG+RT+PKSNA
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 420 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475
           ++LKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/476 (92%), Positives = 451/476 (94%), Gaps = 1/476 (0%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP LLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VAIVTSL ANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            RNATRPPVALTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPS- 239
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDD+N P  
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 240 ASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 299
            SA TSDN T+TDKKPSITSSS T+K+KVNIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 300 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 359
           KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEI+IPVPDDA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 360 DTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNA 419
           DTPTFKYSHGSLKYVPEKSAILWK+RSFPGGKEYSMSAELGLPSISN+ +G+R +PKSNA
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 420 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475
           EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/475 (75%), Positives = 403/475 (84%), Gaps = 25/475 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCD  G PLL+RRYRDDIP+SAI+KFP LLSDLEE++NL+PPCL++NG++YLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+Y+VAI  S+SANAA IF FL+KLV+VL +YLKTVEEESIRDNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNA RPP ALTNSVSWR   I +KKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           DI+ESINMLMTQKGQ+LRSEIIG+VKV S+LSGMPDLKLGINDKGIFSK++DDD      
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDD------ 265

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
               S NN     + +  +SS T+KKK NIELEDLKFHQCVRLSKFE EKIITFIPPDG 
Sbjct: 266 ----SLNN-----EGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGD 316

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           F+LMNYRLST+IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KSTATNV+I+IPVP+DAD
Sbjct: 317 FELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDAD 376

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           TP FKYSHGS+KYVPEK+ I+WKIRSFPGGKEYSMSA++ LPSI N E+           
Sbjct: 377 TPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKA-------- 428

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475
             K PVQIKFQIPYFTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 429 --KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/476 (74%), Positives = 403/476 (84%), Gaps = 21/476 (4%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASA+YFCD+ G+PLLSR+YRDDIP SAID+FPILLS+ EE++NLIPPC+ HNG+++LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VAI TS+S NAA IF+FLHK++EVLS+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITE KMLKQYITQ            RNA RPP +LTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTN-IPS 239
           DI+ESINMLMTQKGQVLRSEIIG+VKV SKLSGMPDLKLGINDKG+FSKYL+ D N +P 
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 240 ASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 299
           A     D+++  + KP         K+  N+ELEDLKFHQCVRLSKFENEK ITFIPPDG
Sbjct: 241 A----PDDSSVDESKPK-------KKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDG 289

Query: 300 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 359
            F+LM+YRLST IKPLIWCDVN++ HS SRIEI C+AKAQIK+KSTATNVEILIPVP+DA
Sbjct: 290 DFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDA 349

Query: 360 DTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNA 419
           DTP FKYSHGS+KYVPEK+AILWKIR+FPG KEYSM+AE+GLPS +  E+         +
Sbjct: 350 DTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEE---------S 400

Query: 420 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475
           E LK PVQ+KFQIPYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 401 EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/480 (73%), Positives = 400/480 (83%), Gaps = 26/480 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCD  GKPLLSRRY+DD+PLSAIDKF  LL+DLE++S +IPPC+NHNG+EYLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYVVA+ TSL+ N A +F FLHKL+ VL +YLKTVEEESIRDNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITE +MLK+YITQ            RNA RPP  L NSVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDD---TNI 237
           DIVESINML+TQKGQVLRSEIIG VK+ S+LSGMPDLKLGIND+GIF+KYL+ +    NI
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 238 PSASATTSDNNTETDKKPSITSSSATN---KKKVNIELEDLKFHQCVRLSKFENEKIITF 294
           P      S           +  SS TN   K+K NIELEDLKFHQCVRLSKFENEKIITF
Sbjct: 241 PDPQEHGS----------GVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITF 290

Query: 295 IPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIP 354
           IPPDG+FDLMNYRL+T+IKPLIWCDV++QVHS SRIEI C+AKAQIK+KS A NV+ILIP
Sbjct: 291 IPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIP 350

Query: 355 VPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTM 414
           VPDDADTP+FKYSHGS+KYVPE+SAILWKI+SFPGGKEY+M AE+GLPS+ + E+     
Sbjct: 351 VPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEE----- 405

Query: 415 PKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
           PK     +K PVQ+KF+IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 406 PK-----VKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/474 (72%), Positives = 404/474 (85%), Gaps = 9/474 (1%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDH GKPLLSR+YRDDIPLSAIDKF  LLSD EE+SNL+PPC++HNG++Y+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+ A+ TS+ AN + IF FLHK+++VL  YLKTVEEESIRDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YG+PQITETKMLK+YIT             RNA RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           DI+ESINML+TQKGQVLRSEI+G+V+V S+LSGMPDLKLGIND+GIF+KYL+ + NI  A
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGN-NIGIA 239

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
                ++  +T+ + SI  S  +NK+K NIELEDLKFHQCVRLSKFENEKII+FIPPDG+
Sbjct: 240 KNGDDEDADDTNNESSIV-SEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGE 298

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           FDLMNYRLST+IKPLIWCDV++Q +   RIEIHCKAKAQIK+KS ATNVEILIPVP+DAD
Sbjct: 299 FDLMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDAD 355

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           +P FKYSHG +KY+PEK+ +LWKI SFPGGKEYSM+A++GLPSIS  +D N  +   +  
Sbjct: 356 SPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQS-- 413

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
             K PVQ+KF+IPYFTTSGIQVRYLK+NEPKLQYK+YPWVRYITQSGDDYTIR+
Sbjct: 414 --KKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/477 (73%), Positives = 403/477 (84%), Gaps = 13/477 (2%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S++ FCD  GK LLSR+YRDDIPL+AID F  LL  LEE+S+++PPCL HNG+ YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VA+ TSLS NA+ +FTFLHKLVEV+S+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNA RPP ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           DIVESINMLMTQ+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL+  ++  ++
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 241 SATTS---DNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPP 297
           +   S   +++  +  +PS      +++K  N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 298 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 357
           DG F+LM+YRL+T IKPLIWCDVN+ VHS SR+EIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 358 DADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKS 417
           DADTP+F+YSHGS+K+VPEK+AILWKIRSF GGKEYSM+A+LGLPSI +NE      PK 
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEK-----PK- 414

Query: 418 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
               LK PVQIKFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 415 ----LKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/475 (74%), Positives = 394/475 (82%), Gaps = 33/475 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASA+YFCD  G+PLLSR+YRDDIPL+AIDKF  LL+DLEE+S++IPPCL +N  +YLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QH+D+Y+VAI   L  N A +F FL+K+++VL DYLKTVEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +NA RPP ALT+SVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYL-DDDTNIPS 239
           DIVESINMLMTQKGQ+LRSEI+G VK+ S+LSGMPDLKLGINDKGIFSK L +DDTN   
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTN--- 237

Query: 240 ASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 299
                  NN             AT+KK+  IELEDLKFHQCVRLSKFE EKIITFIPPDG
Sbjct: 238 -------NN-------------ATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDG 277

Query: 300 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 359
            F+LMNYRLST+IKPLIWCD+NVQVHSNSRIEIHC+AKAQIK+KSTATNVEILIPVP+DA
Sbjct: 278 DFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDA 337

Query: 360 DTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNA 419
           DTP FKYSHGS+K+VPEKSAILWKIRSFPGGKEYSM+AEL LPS S+         KS  
Sbjct: 338 DTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSS---------KSEE 388

Query: 420 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
              K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 389 VQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/474 (71%), Positives = 389/474 (82%), Gaps = 29/474 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M SAVYFCD  G+P+LSRRYRDDIP+SAIDKF  LL  LEE+S++IPPCL+H+G++YLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYVVA+ TSL+ N A +F FLHKL+EVL +YLK+VEEES+RDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            + A RPP  +TNSVSWR   I HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           DIVESINMLM Q+GQVLRSEIIG +KV SKLSGMPDLKLGINDKGIFSKY++ D++    
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---- 236

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
                           +T++    KKK NIELEDLKFHQCVRLSKFENEKIITFIPPDG 
Sbjct: 237 ---------------PVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGA 281

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           F+LMNYRLS  +KPLIWCDVNVQVHS SRIEIHC+A+AQIK++S A +VEILIPVPDDAD
Sbjct: 282 FELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDAD 341

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           TP+FKY+HGS+K+VP+K+AILWKIRSF GGKEYSMSA++GLPSI+  +      PK    
Sbjct: 342 TPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDK-----PK---- 392

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
            +K PVQIKFQIPYFTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 393 -VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/474 (70%), Positives = 391/474 (82%), Gaps = 28/474 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD  GK +LSRRY+DDIP +AIDKFP+LL + E++S++IPPCL HNG++YLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYV+ +  SLS N A +F FL+K+VEVL++Y+K VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +N  RPP+ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           D+VESINML+TQ+GQVLRSEI+G VKV S LSGMPDLKLG+NDKGIFS ++         
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHV--------- 231

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
           S    D   +          SAT KKK NIELEDLKFHQCVRLSKFENEKIITFIPPDG 
Sbjct: 232 SGGVEDEADDL---------SATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGD 282

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           F+LM+YRL+T IKPLIWCD+ +QVHS SRIE+HC+AKAQIK+KSTA NVEILIPVP+DAD
Sbjct: 283 FELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDAD 342

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           +P F+YSHGS+K+ PEK+AILWKI+SFPGGKEYSM+A+LGLPS+S+ E+           
Sbjct: 343 SPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEE----------P 392

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
           ++K PVQ+KFQIPYFTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 393 VMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/474 (72%), Positives = 386/474 (81%), Gaps = 33/474 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD  G+P+LSRRYRDDIPLSAID+F  LL+DLEE+S++IPPCLNH G++YLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           +H DLYVVA+ TSL+ NAA +FTFLHKLVE L DYLKTVEEES+RDNFVIIYELLDE+MD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +   RPP  LTNSVSWR +GIT+KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           DIVESINM+M Q+GQVLRSEIIG V V S+LSGMPDLKLGINDKGIF++  D +T     
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTR--DPETG---- 234

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
                             S     KKK + ELEDLKFHQCVRLSKFENEKIITFIPPDG+
Sbjct: 235 -----------------ESQVTAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGE 277

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           F+LM+YRL+T +KPLIWCDVNVQVHS SRIEIHC+AKAQIK+KS A NVEILIPVPDDAD
Sbjct: 278 FELMSYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDAD 337

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           TP+F+YSHGS+K+VPEK+AILWKIRSF GGKEYSM+A++GLPSI+  E      PK    
Sbjct: 338 TPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSINGVEK-----PK---- 388

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
             K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQ+GDDYTIRL
Sbjct: 389 -FKRPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIRL 441

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/473 (73%), Positives = 393/473 (83%), Gaps = 23/473 (4%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S VYFCD +GKP+LSRRYRDDIPLSAIDKF  +L + EE+S+++PPCL + G+ YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QH+D+YVVA+ TS   N A IF FLH+LV VL DYLK+VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            RNA RPPVALTNSVSWR EGI +KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           DI+ESINMLM Q+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL+++ +    
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
               +D++T             TN KK NIELEDLKFHQCVRLSKFENEKIITFIPPDG+
Sbjct: 241 VQIINDDST-------------TNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGE 287

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           F+LMNYRL+T IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KS A NVEILIPVPDDAD
Sbjct: 288 FELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDAD 347

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           TPTFKYSHGS+K++PEK+AILWK+RSF GGKEYSM+A+LGLPS+   E      PK    
Sbjct: 348 TPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEP-----PK---- 398

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
            +K PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 399 -VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/473 (68%), Positives = 383/473 (80%), Gaps = 34/473 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI++FP LL + E++S+++PPCL HNGL+Y+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+YV+ +  SLS N A +F+FL+KLVEVL++YLKTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +N  RPP  LT SVSWRPEGIT+KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           D+ ESINML+T  GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF             
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIF------------- 227

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
           ++    NN E             + KK NIELEDL+FHQCVRLSKFENEKII+FIPPDG 
Sbjct: 228 TSEEGGNNAE-----------GGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGD 276

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           FDLMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+DAD
Sbjct: 277 FDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDAD 336

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           +P F+YSHGSLKYVPEKSAILW+I++F GGKEYS +A+LGLPS+++ E     +PK+   
Sbjct: 337 SPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVE-----VPKA--- 388

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
             K P+Q+KFQIPYFTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 389 --KRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/474 (67%), Positives = 388/474 (81%), Gaps = 29/474 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S +YFCD  GK LLSRRY+DDIP+SAI++FP LL + E++SN+IPPC +HNG++YLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY++ +  S+ AN A +F+FLH LV+VL +Y+K VEEESI+DNFVIIYELLDEVMD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
            GIPQIT+TKML+QYITQ            +N  RPP +LT +VSWRPEGI +KKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           D++ESINM+MTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++  +++ + PS+
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSS 240

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
                        +PSIT      +KK NIELEDLKFHQCVRLSKFENEKIITFIPPDG 
Sbjct: 241 -------------QPSIT------RKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGD 281

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           F+LM+YRLST IKPLIWCD  +QVHS SR+E+HC+AKAQIK KSTA NVEILIPVP+DAD
Sbjct: 282 FELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDAD 341

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           +P F+YSHGS+K+VPEK+AILWKI+SFPGGK+YSM+AE+GLPS+++  D N         
Sbjct: 342 SPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYN--------- 392

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
             K PVQIKFQIPYFTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 393 -FKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/476 (69%), Positives = 387/476 (81%), Gaps = 26/476 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD+ GKP+L+RRYRDDI ++AID F  LL  LEE++ +IPPC+ H G+ YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           +H+D+YVVA+ TS   N A IF FLH+LVEVL +Y+K V EES+RDNFVIIYELLDE+MD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXX--XXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEA 178
           +GIPQITETKMLK+YITQ              +NA RPP  LTNSVSWRPEGIT+KKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIP 238
           FLDI+ESINML+TQ+GQVLRSEI+G V+V S+LSGMPDLKLGIND+GIFS YL+++ N+ 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEEN-NVD 239

Query: 239 SASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPD 298
            +S++T       DKKP              IELEDLKFHQCVRLSKFENEKIITFIPPD
Sbjct: 240 GSSSSTPIPEGVEDKKP-------------QIELEDLKFHQCVRLSKFENEKIITFIPPD 286

Query: 299 GKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDD 358
           G+FDLMNYRL+T IKPLIWCDVN+QVHS SRIEIHC+AKAQIK+KS A NVEILIPVPDD
Sbjct: 287 GEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDD 346

Query: 359 ADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSN 418
           ADTP F+YSHGS+K++PEK+AILWK+RSF GGKEYSMSA+L LPS+   E      PK  
Sbjct: 347 ADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEP-----PK-- 399

Query: 419 AEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
              ++ PVQ+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 400 ---VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/473 (69%), Positives = 383/473 (80%), Gaps = 34/473 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI+KFP LL + E++S+++PPCL HNG++YLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+YV+ +  SLS N A +F+FL+KLVEVL++Y+KTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           YGIPQITETKMLKQYITQ            +N  RPP  LT SVSWRPEGIT+KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           D+ ESINML+T  GQVLRSEI+G V V S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVE--------- 231

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
                          S +SS AT  KK NIELEDLKFHQCVRLSKFENEKIITFIPPDG 
Sbjct: 232 ---------------SASSSEATEGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGD 276

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           F+LMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+DAD
Sbjct: 277 FELMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDAD 336

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           +P F+YSHGSLKYVPEKSAILWKI++F GGKEYS +A+LGLPS+++ E     +P++   
Sbjct: 337 SPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAE-----VPRA--- 388

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
             K P+Q+KFQIPYFTTSGIQVRYLKINEPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 389 --KRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/474 (67%), Positives = 384/474 (81%), Gaps = 31/474 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD  GK LLSRRY+DDIP +AI++FP LL + E++S+++PPC + NG++YLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYV+ +  S+S N A +F++LHKL+EVL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
           +GIPQIT+TKML+QYITQ            +N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           D+VESINML+TQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++  DDD    ++
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGAS 240

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
             T                     KKK NIELEDLKFHQCVRL+KFENEKIITFIPPDG 
Sbjct: 241 GGT---------------------KKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGD 279

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           F+LM+YRLST IKPLIWCDV +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+DAD
Sbjct: 280 FELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDAD 339

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           +P F+YSHG++K+VP ++AILWKI+SFPGGK+YSM+AE+GLPS+S+N D           
Sbjct: 340 SPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHK--------- 390

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
            LK PVQIKFQIPYFTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 391 -LKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/474 (67%), Positives = 377/474 (79%), Gaps = 31/474 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS V FCD  GKPLLSRRY+DD+  SA++ F  LL + E++S+++PPC +HNG+ Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           Q+ND+YV+A+  S+S NA  +F F++KL+ V+ +Y+K VEEESIRDN++IIYELLDE+MD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
            G+PQ+TETKMLKQYITQ            +N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240
           D++ESINMLMTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF             
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIF------------- 227

Query: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300
               + N+ E   +P ++S     KK  NIELEDLKFHQCVRLSKFENEKIITFIPPDG+
Sbjct: 228 ----TTNDQEDSPEPVVSS----KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGE 279

Query: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360
           FDLM YRLST IKPLIWCDV VQVHS SRIEIHC+AKAQIK+KS A NVEILIP+P+DAD
Sbjct: 280 FDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDAD 339

Query: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420
           +PTFKYS G++K+VPEK+AILWK  SF GGKEYSM+A+LGLPS+S+ E      PK    
Sbjct: 340 SPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEP-----PK---- 390

Query: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
            LK PVQIKFQIPYFTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 391 -LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  223 bits (567), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 149/489 (30%), Positives = 249/489 (50%), Gaps = 42/489 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++     G  ++S+  +D+I L   + F I ++++L+ +S    P L      +  
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           I+ N    +  V+  + ++A I+ FL+   ++L  Y     E+S++ +F++ YE+LD V+
Sbjct: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DYGIPQITETKMLKQYITQXXXX-------------XXXXXXXXRNATRPPVALTNS--V 164
           D GIP+ TE   +  YI++                         R  +   + LT+    
Sbjct: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175

Query: 165 SWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK 224
            WR EGI +KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234

Query: 225 GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLS 284
                YL      PS++  +S N+   +++    + +  N    ++ LED KFHQCV+L 
Sbjct: 235 -----YLS-----PSSNTQSSGNDGWAEEENG--TKAIKNAITGSVILEDCKFHQCVQLD 282

Query: 285 KFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKS 344
           KF+ E++I F+PPDG F+LM Y +   +         V       +E     K+    K 
Sbjct: 283 KFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKL 342

Query: 345 TATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSI 404
            A +VE+ IP P D        S G  K++PE++AI+WKI  + G  E   SA + +P  
Sbjct: 343 CAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMG 401

Query: 405 SNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 464
           + N+  N        +  + P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI+
Sbjct: 402 NGNDSLNL------EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYIS 455

Query: 465 QSGDDYTIR 473
           +SG  Y +R
Sbjct: 456 KSG-AYEVR 463

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  211 bits (537), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 158/503 (31%), Positives = 255/503 (50%), Gaps = 68/503 (13%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++     G+ L+S+  R  +P S  + F I ++++L+ +S    P L      +  
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQH-NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
           ++   +L++VA+  S +A++AAI+ FL+KL  +L  +    E E ++++F+  YELLD V
Sbjct: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114

Query: 119 MDYGIPQITE-----TKMLKQYITQXXXXXXXXXXXXRNATR-PPVA------------- 159
           ++ G+P  TE     +KM  +                    R  PVA             
Sbjct: 115 LEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLH 174

Query: 160 -----LTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214
                + +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 175 DSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234

Query: 215 PDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELED 274
           P  + G+ND               S S    DN + T  K +I  ++A      ++ LED
Sbjct: 235 PVCRFGLNDS-------------LSVSTPFGDNESPTTNKKAIPKAAAG-----SVMLED 276

Query: 275 LKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIH 333
            KFHQCV+L KF++E+ I FIPPDG F+LM Y +   +  P     V     +NS I+  
Sbjct: 277 CKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANS-IDYR 335

Query: 334 CKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEY 393
              K+    K TA +V++ IPVP +        S+G  K+VPE+SAI+WK   + G  E 
Sbjct: 336 VTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTEN 395

Query: 394 SMSAELGLPSISNNEDGNRTMPKSNAEI---LKGPVQIKFQIPYFTTSGIQVRYLKINEP 450
           S+SA   +P           M  S   I    K P+ +KF+I  F+ SG+ VR+  ++E 
Sbjct: 396 SLSAT-AVP-----------MKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEG 443

Query: 451 KLQYKSYPWVRYITQSGDDYTIR 473
              YK   W++Y+++SG  Y +R
Sbjct: 444 DRNYKMVKWIKYLSKSG-AYEVR 465

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  204 bits (518), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 153/519 (29%), Positives = 251/519 (48%), Gaps = 84/519 (16%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ ++S+  RD I  S  + F I ++++L+ +S    P L      +  
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQHN-DLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
           I+ + +L++VA+  S +A++AAI+ FL+K   +L  Y     EES+++ F+  YELLD V
Sbjct: 57  IRSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVV 114

Query: 119 MDYGIPQITE-----TKMLKQYITQXXXXXXXXXXXXRNAT------RPPVALTNSVS-- 165
           ++ G+P  TE     +KM ++ +                A       R P  L       
Sbjct: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSS 174

Query: 166 -------------------WRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVK 206
                              WR  GI +KKNE FLD+ E IN+L+++ G +L+S + G V 
Sbjct: 175 SSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234

Query: 207 VNSKLSGMPDLKLGINDK-----GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSS 261
           + + LSG P  + G+ND      G  S+ LD  +              E   K +I  ++
Sbjct: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEY------------EVKNKKAIPKAA 282

Query: 262 ATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDV 320
           A      +++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +   +  P     +
Sbjct: 283 AG-----SVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPI 337

Query: 321 NVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAI 380
                +N  +E     K+    K TA +V + IPVP          S+G  ++VPE++A+
Sbjct: 338 FSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAV 397

Query: 381 LWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEIL------KGPVQIKFQIPY 434
           LWK   + G  E ++SA               T+P  N   L      + P+ + F+I  
Sbjct: 398 LWKFAKYQGLTENTLSA--------------LTVPMDNQSSLNLQQWSRPPMSLTFEILM 443

Query: 435 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
           F+ SG+ VR+ K++E    Y +  WV+YI++SG  Y +R
Sbjct: 444 FSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG-AYEVR 481

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  202 bits (513), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 154/507 (30%), Positives = 254/507 (50%), Gaps = 75/507 (14%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ L+S+  +  +  S  + F I ++++L+ +S    P L      +  
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQH-NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
           I+   +L++VA+  S +A++AAI+ FL++L E+L  +     E  +++ F+I YELLD V
Sbjct: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114

Query: 119 MDYGIPQITETKMLKQY----------------------------ITQXXXXXXXXXXXX 150
           ++ G+P  TE   +                               ++Q            
Sbjct: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174

Query: 151 RNATRPPVALTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSK 210
             A+  P    +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + 
Sbjct: 175 DIASEAP----SNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTH 230

Query: 211 LSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNI 270
           LSGMP  + G+ND    S    DD           D    T+KK +I  ++A      ++
Sbjct: 231 LSGMPVCRFGLNDALSVSTPFGDD-----------DEYQVTNKK-AIPKAAAG-----SV 273

Query: 271 ELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSR 329
            LED KFHQCV+L KF++E+ I FI PDG F+LM Y +   +  P     +   V SNS 
Sbjct: 274 MLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS- 332

Query: 330 IEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPG 389
           I+     K+    K TA +V++ IPVP +  +     S+G  K+VPE+SAI+WK   + G
Sbjct: 333 IDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQG 392

Query: 390 GKEYSMSAELGLP---SISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLK 446
             E S+SA   +P   S  N E   R            P+ +KF+I  F+ SG+ VR+  
Sbjct: 393 LTENSISAT-AVPMKDSTLNIEQWPRP-----------PISLKFEIVMFSNSGLVVRFFN 440

Query: 447 INEPKLQYKSYPWVRYITQSGDDYTIR 473
           ++E    YK   W++Y+++SG  Y +R
Sbjct: 441 VSERDRNYKMVKWIKYLSKSG-AYEVR 466

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  200 bits (509), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 147/510 (28%), Positives = 253/510 (49%), Gaps = 57/510 (11%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A+      G+ ++S+ ++  +  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQH---NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
           I+    ++L++VA V+  + ++AAI+ FL+KL  +L  Y     EE +++ F+I++ELLD
Sbjct: 57  IKSTRGDNLWIVA-VSRNNVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLD 114

Query: 117 EVM--DYGIPQITETKMLKQYITQXXXXXXXXXXXXRNA------------------TRP 156
            +M    GIP +TE  ++   ++              N                   + P
Sbjct: 115 VMMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGP 174

Query: 157 PVALTNSVS------------WRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGD 204
            +   NS S            WRP+GI HKKNE  L + E IN+L+++ G VL++ + G 
Sbjct: 175 KLLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGS 234

Query: 205 VKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATN 264
           + + + LSG P  + G+ND    S    D     + +    D N +   K  ++ +S   
Sbjct: 235 IDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVG- 293

Query: 265 KKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQ 323
               ++ LED KFHQCV L KF+ ++II F+PPDG  +LM Y +   +  P     +   
Sbjct: 294 ----SVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTN 349

Query: 324 VHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWK 383
             + + +E     K+    + +A NV + IPVP +        ++GS K++PE+SA++W+
Sbjct: 350 TRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWR 409

Query: 384 IRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVR 443
              F G  E ++SA + +P+  N +        S  +  K P+ + F+I  F+ SG+ VR
Sbjct: 410 FNKFNGLTENTLSA-VTIPTKDNTQ-------LSLQQWSKPPMSLDFEILMFSNSGLVVR 461

Query: 444 YLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
           Y  I E   +YK+  W++YI++SG  Y IR
Sbjct: 462 YFTITERDQKYKAVKWIKYISRSG-SYEIR 490

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  198 bits (503), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 135/499 (27%), Positives = 256/499 (51%), Gaps = 51/499 (10%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++  +  G  L+S+  +D +  S  D F   +++D   +S ++   L     +++ 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58

Query: 60  IQHND---LYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
            + +D   +++VA+  S + +++ I+ +LHKL +++  +    +E+ ++D F+++YE+L+
Sbjct: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116

Query: 117 EVMDYGIPQITETKMLKQYITQX-------------------XXXXXXXXXXXRNATRPP 157
             ++ GIPQ T+   +   +++                               R+++   
Sbjct: 117 LTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSIA 176

Query: 158 VALTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDL 217
           ++  +   WRP G+ +KKNE +LDI E I +L+ + G +++S + G V   S LSGMP  
Sbjct: 177 LSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLC 236

Query: 218 KLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKF 277
           +LG+ND   +S + ++ + +   S     +  +   K +I +++A      ++ LED KF
Sbjct: 237 QLGLNDT--YSIHGNEKSEL---SIVEMMSEYDIKNKKAIPNAAAG-----SVILEDCKF 286

Query: 278 HQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAK 337
           HQCV+L+K+E   +I F+PPDG F LM YR+   I         V++  NS +      +
Sbjct: 287 HQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLR 346

Query: 338 AQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSA 397
           +      +A +V + IPVP       F  S G  KY   +  ++WK   + G  E ++S 
Sbjct: 347 SLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSG 406

Query: 398 ELGLPSISNNEDGNRTMPKSNAEILKG---PVQIKFQIPYFTTSGIQVRYLKINEPKLQY 454
           ++ +P+ S++           +++L+    P+ + F+I  F+ SG+ VR+LK  EP+L Y
Sbjct: 407 KVAIPATSHDL----------SDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNY 456

Query: 455 KSYPWVRYITQSGDDYTIR 473
           +   W++YI+ SG  Y IR
Sbjct: 457 QPVKWIKYISHSG-AYEIR 474

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  196 bits (497), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 148/516 (28%), Positives = 251/516 (48%), Gaps = 85/516 (16%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SAV      G+ ++S+ +++++  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56

Query: 60  IQHN----DLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115
           I+ N    DL++V++  S + N  A++ FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114

Query: 116 DEVM-DYGIPQITE----TKMLKQYITQXXXXXXXXXXXXRNATRPPVA----------- 159
           D ++ + G P  T+     K +    ++            +N+T P +            
Sbjct: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174

Query: 160 ------------LTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
                       +   + WRP+GI+HKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234

Query: 208 NSKLSGMPDLKLGINDK--------GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITS 259
            + LSG P  + G+ND         G    Y+ +   IP A+A +               
Sbjct: 235 VTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGS--------------- 279

Query: 260 SSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWC 318
                     + LED KFHQCV L KF+ ++II F+PPDG  +LM Y + + I  P    
Sbjct: 280 ----------VLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVS 329

Query: 319 DVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKS 378
            +     S + +E     K+    K TA NV + IPVP +        S+GS K+ PE+ 
Sbjct: 330 PIVTYSSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEK 389

Query: 379 AILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSN-AEILKGPVQIKFQIPYFTT 437
           A+LW    + G  E ++SA     +I+     ++  P+ N  +  K P+ + F+I  F+ 
Sbjct: 390 AMLWTFNKYNGLTENTLSA----VTIT-----SKDAPRLNIQQWQKPPISLDFEIMMFSN 440

Query: 438 SGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
           SG+ VRY  I E + +YK+  W+RY+++SG  Y IR
Sbjct: 441 SGLVVRYFTIKESE-RYKTVKWIRYVSKSG-SYEIR 474

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  192 bits (488), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 150/512 (29%), Positives = 255/512 (49%), Gaps = 70/512 (13%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA+      G+ ++++  +  +  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHN---DLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
           I+ +    L++VA+  S +AN+ AI+ FL+KL  V+ D     +E ++++NF+  YE+LD
Sbjct: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114

Query: 117 EVMDYG-IPQITE-----TKML----KQYITQXXXXXXXXXXXXRNATRP---------P 157
            V++ G IP  TE     +KM     KQ                 N + P         P
Sbjct: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174

Query: 158 VALT---------------NSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII 202
             LT               +++SWRP GI +KKNE  L++ E I++L+++ G +L+S + 
Sbjct: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234

Query: 203 GDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSA 262
           G + + + LSGMP  + G+ND    S    DD        + S+     +KK +I  ++A
Sbjct: 235 GTIDLTTHLSGMPICQFGLNDS--LSVEFGDD--------SISEVEDFANKK-AIPKAAA 283

Query: 263 TNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVN 321
                  + LED KFHQCV L KF  +++I F+PPDG  +LM Y +   +  P     + 
Sbjct: 284 G-----RVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV 338

Query: 322 VQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAIL 381
             +   + I+     K+    K +A +V + IPVP          S+G  K+VPE+SA++
Sbjct: 339 TSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMI 398

Query: 382 WKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQ 441
           WK   + G  E ++SA + +PS    +   +  P+        P+ + F+I  F+ SG+ 
Sbjct: 399 WKFTKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRP-------PMSLNFEIMMFSNSGLV 450

Query: 442 VRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
           VRY K+++   +Y++  W++YI++SG  Y IR
Sbjct: 451 VRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  191 bits (486), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 147/510 (28%), Positives = 255/510 (50%), Gaps = 60/510 (11%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M + +      G+ ++S+ ++  +  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQH----NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115
           I+     ++L++VA  T  +AN+AAI+ FL+KL  +L +Y    +EE +++ F+I++ELL
Sbjct: 57  IRSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114

Query: 116 DEVM-DYGIPQITE-TKMLKQYITQXXXXXXXXXXXX---------RNATRPPVALT--- 161
           D ++   GIP  TE +K++ +   +                      N    P  L    
Sbjct: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRND 174

Query: 162 -----------NSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSK 210
                      N  SWRP+ I HKKNE  L + E IN+L+ + G +L++ + G + + ++
Sbjct: 175 SSQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234

Query: 211 LSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNK----- 265
           LSG P  + G+ND         +D+   S +  T +N      K S+  S+ +NK     
Sbjct: 235 LSGTPVCQFGLNDSLTLG---SNDSEYSSRNGRTGNN------KSSMLDSNLSNKVLSKA 285

Query: 266 KKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQV 324
              N+ LED KFHQCV L KF+ E+II F+PPDG  +LM Y +   +  P     +    
Sbjct: 286 SVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNS 345

Query: 325 HSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKI 384
            +   ++     K+    + +A  V + IPVP          S+G+ K+VP ++A++WK 
Sbjct: 346 VTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKF 405

Query: 385 RSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRY 444
             + G  E ++SA + +PS    ++ N+T  +  A   + P+ + F+I  F+ SG+ VRY
Sbjct: 406 NKYNGLTENTLSA-VTVPS----KEVNQTTLQQWA---RPPMSLDFEILMFSNSGLVVRY 457

Query: 445 LKINEPKLQYKSYPWVRYITQSGDDYTIRL 474
             I+E    YK+  W++Y+++SG  Y +R 
Sbjct: 458 FTISEGHQNYKAVKWIKYVSKSG-SYEVRF 486

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  190 bits (482), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 141/550 (25%), Positives = 245/550 (44%), Gaps = 127/550 (23%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S +Y  D   +PL+ + ++    +S  ++   L      +  ++P   ++ G+ +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK---AISNGEESIELFQQAHSKHPMVP-VFHYKGIHFVYI 56

Query: 61  QHNDLYVVAIVTSLSA--------NAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVI 110
           + +  Y ++ V  ++         N  AI T+L     +L  Y  +  +    I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELLDEVMDYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRP-------------- 156
           IYELLDE +D+G+PQ+T+  +++ YI              +  ++               
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 157 ---PVALTNSVSWRPEGITHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLS 212
                  T+++SWRP+GI + KNE FLD++E I   M   K ++ ++ + G ++  S LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIEL 272
           GMP LK+G++                                  ITSS    +++    +
Sbjct: 237 GMPKLKIGLS---------------------------------KITSSLPKEREQF---M 260

Query: 273 EDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSN 327
            + KFHQCV L   + + I++FIPPDG+F L  Y+L   ++      L+  DV  +    
Sbjct: 261 NNAKFHQCVSLEDLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKR 319

Query: 328 SRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSA 379
            +I I        K +++ + + I IP+         D A  P FK   G++ +      
Sbjct: 320 PKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDL 379

Query: 380 ILWKIRSFPGGK---EYSMSAELGL--------------------------------PSI 404
           +LW++ S  GG    E+SM  E  L                                  +
Sbjct: 380 LLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQV 439

Query: 405 SNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 464
             NE+ NR+            V ++F+IPY+T SG++V+YLKI E +LQY S+PWVRY T
Sbjct: 440 HENENTNRSR----------LVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKT 489

Query: 465 QSGDDYTIRL 474
            + ++Y  ++
Sbjct: 490 VNDEEYAYQI 499

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  182 bits (463), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 149/509 (29%), Positives = 245/509 (48%), Gaps = 77/509 (15%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M + V      G+ ++S+  + +   S  D F + ++++L+ +S    P L      +  
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHND---LYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
           I+ N    L++VA+  S +AN+ AI+ FL+K   +L+ +     E ++++ F+  YELLD
Sbjct: 57  IRSNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAF-GLDNETTLKEEFMTCYELLD 114

Query: 117 EVMDY-GIPQITETKMLKQYITQX----------------XXXXXXXXXXXRNATRPPVA 159
            +++  G+P  TE   +   ++                             RN     V 
Sbjct: 115 LMLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVD 174

Query: 160 LTNS----VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMP 215
             N+      WRP GI +KKNE FL+I E I++L+++   +L++ + G V + S LSG P
Sbjct: 175 TMNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTP 234

Query: 216 DLKLGINDKGIFSK---YLDDDT------NIPSASATTSDNNTETDKKPSITSSSATNKK 266
             + G+ND     +   Y  DD       NIP A+A T                      
Sbjct: 235 TCQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGT---------------------- 272

Query: 267 KVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHS 326
              + LED KFH+CV L KF  ++II F+PPDG  +LM Y +   I        NV ++S
Sbjct: 273 ---VVLEDCKFHECVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV-INS 328

Query: 327 NSR--IEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKI 384
            SR  ++     K+    K +A +V + IPVP          S+G  ++VPE+S I+WK 
Sbjct: 329 RSRTGLDYRITLKSLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKF 388

Query: 385 RSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRY 444
             + G  E  +SA     ++S+N D  + M +  A   + P+ + F+I  F+ SG+ VRY
Sbjct: 389 AKYNGLTENKLSA----VTVSSN-DTTQLMLQQWA---RPPISLDFEIMMFSNSGLVVRY 440

Query: 445 LKINEPKLQYKSYPWVRYITQSGDDYTIR 473
           LKI E   +Y++  W++YI++SG  Y +R
Sbjct: 441 LKIMEKDQKYRTVKWIKYISRSG-SYEVR 468

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  182 bits (461), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 141/508 (27%), Positives = 242/508 (47%), Gaps = 68/508 (13%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ ++S+ + + +  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHN--DLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
           I+ N  D   +  V+  +AN+ AI+ FL+K   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115

Query: 118 VMDYG-IPQITETKMLKQYIT---------------QXXXXXXXXXXXXRNATRPPVALT 161
           V+  G IP  TE   +   I+                             N + P     
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 162 NSVS--------------WRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
           N+ S              WRP GI +KKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 NSKLSGMPDLKLGINDKGI--FSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNK 265
            + LSG P  + G+ND     F   L  DT              E   K ++  ++A   
Sbjct: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQ-------------EFHNKKAVPKAAAG-- 280

Query: 266 KKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVH 325
              ++ LED KFHQCV L KF  E+II F+PPDG  +LM Y +   +  L +    V   
Sbjct: 281 ---SVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKITPVVTP 336

Query: 326 SNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIR 385
             S +E     K+    K +A +V + IPVP          S+G  K+  E++A++W+  
Sbjct: 337 CGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFN 396

Query: 386 SFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYL 445
            + G  E ++SA + +P+    +   +  P+        P+ + F+I  F+ SG+ VRY 
Sbjct: 397 KYHGLTENTLSA-VTVPTSDTTQLTLQQWPRP-------PMSLGFEIMMFSNSGLVVRYF 448

Query: 446 KINEPKLQYKSYPWVRYITQSGDDYTIR 473
           ++++   +Y+   W++YI++SG  Y +R
Sbjct: 449 RVSDKDEKYRVVKWIKYISKSG-SYEVR 475

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  180 bits (456), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 147/557 (26%), Positives = 242/557 (43%), Gaps = 135/557 (24%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S+++  D    PL+ + ++    +   + F     ++ + SN+  P + H G+ ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYVVAI-VTSLSANAAAIFTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYELLDE 117
             + LY V++ V SL ++  +   +L+    +L  YL+   ++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 VMDYGIPQITETKMLKQYI-----------------------TQXXXXXXXXXXXXRNAT 154
            +D+GIPQ+T+  +++  I                        +            ++  
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 155 RPPVALTNS---------VSWRPEGITHKKNEAFLDIVESINMLMTQKG-QVLRSEIIGD 204
           +      NS         +SWRP+GI + KNE F+D++ES   +M  K  QV ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATN 264
           +   S LSGMP +K+ IN      K L D     S++                       
Sbjct: 236 IICRSYLSGMPVVKICIN------KMLKDRDQFLSSA----------------------- 266

Query: 265 KKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCD 319
                      KFHQCV L    ++  I FIPPDG F L  Y++   I       LI   
Sbjct: 267 -----------KFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYK 315

Query: 320 VNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADT--------PTFKYSHGSL 371
           V V+     +++I  K +   K +++AT ++I +P+ D  +T        P FK   GS+
Sbjct: 316 V-VEKPKKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSI 374

Query: 372 KYVPEKSAILWKIRSFPGGKE---YSMSAEL----------------------------- 399
            +      +LWK     GG     +SM  E                              
Sbjct: 375 LFNLSDGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVR 434

Query: 400 --GLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSY 457
              L ++++ E G    P  N       +  +F++PYFT+SG++V YLKI E +LQY+S+
Sbjct: 435 MEELYALAHEEKGQINNPVRNM------ITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSF 488

Query: 458 PWVRYITQSGDDYTIRL 474
           PWVRY T +  +Y  ++
Sbjct: 489 PWVRYKTINDTEYAFQM 505

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  179 bits (453), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 120/394 (30%), Positives = 198/394 (50%), Gaps = 52/394 (13%)

Query: 65  LYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIP 124
           L++V +V   +A++AAI+ FL+ + ++L  Y    EE ++ D+F++ YELLD V+D G+P
Sbjct: 63  LWMVVVVRG-NADSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLP 120

Query: 125 QITETKMLKQYITQX-XXXXXXXXXXXRNATRPPVALTNSVS-------------WRPEG 170
           Q TE   +   +++              N+ R     T +VS             WR EG
Sbjct: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180

Query: 171 ITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKY 230
           I +KKNE +LD++E +++L+ + G +L++ + G V+  + LSGMP    G ND     + 
Sbjct: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQSLRQR 240

Query: 231 LDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEK 290
                  P    T        D++ S+              LED KFHQCV+L+KF+ E+
Sbjct: 241 SPRRQYAPRVFGT--------DERESVV-------------LEDCKFHQCVQLNKFDQER 279

Query: 291 IITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVE 350
           +I F+PPDG+F+LM Y +   ++P       V   +   IE     ++    K +A +VE
Sbjct: 280 VIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVE 339

Query: 351 ILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDG 410
           + IP P    +     S G  K+VPE++AI+WKI  F G  E ++SA         +E G
Sbjct: 340 LYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA-----VTIADEQG 394

Query: 411 NRTMPKSNAEIL----KGPVQIKFQIPYFTTSGI 440
           +       A++L    + P+ +K +I  F+T+ +
Sbjct: 395 H------YAQVLDQWPRPPISMKLEIMMFSTAAL 422

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  178 bits (451), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 137/511 (26%), Positives = 237/511 (46%), Gaps = 69/511 (13%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M +AV      G+ L+ + ++  +  +  D F +    +    N+  P L      + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRV---QVINNDNIRSPILTLGSTTFHFI 57

Query: 61  Q---HNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
           +    + L++VA+  S +A++ AI+ +L+KL  ++  Y  T  E+ ++D F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVYGLT-HEDILKDEFIVCHELLDI 115

Query: 118 VMDY-GIPQITE------------TKMLKQYITQXXXXXXXXXXXXRNAT---RPPVALT 161
            +   G+P  TE             ++L     +             N+T    P     
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 162 NS----------------VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDV 205
           NS                + WR   I +KKNE  ++++E IN+L+ +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNK 265
            + + LSGMP  ++G+ND       L       +A  T  D  +  D  P ++       
Sbjct: 236 DITAHLSGMPMCQIGMND-------LSTIQGGENAHWTNEDRASNRDAMPDVSGD----- 283

Query: 266 KKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PL-IWCDVNVQ 323
               + LE  KFHQCV L K+  + +I FIPPDG+F+LM Y +S  +  P  I   V + 
Sbjct: 284 ---RVILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLT 340

Query: 324 VHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWK 383
            H  + +    K K+   RK +A NV + IPVP          S G  K++PE++ ++W 
Sbjct: 341 SHGTA-LSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWS 399

Query: 384 IRSFPGGKEYSMSAE-LGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQV 442
              F G  E  ++A+ +   SI++      T P         P+ + F++  F+ +G+ V
Sbjct: 400 FHRFNGSTENHLNAQTVPTQSIASQSIKQWTRP---------PMSLDFKVLMFSNTGLIV 450

Query: 443 RYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
           RYLK+ E  + Y +  W++YI+ +G  Y +R
Sbjct: 451 RYLKVQEKNMHYNTIKWIKYISAAG-SYEVR 480

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  174 bits (440), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 127/486 (26%), Positives = 215/486 (44%), Gaps = 111/486 (22%)

Query: 48  PCLNHNGLEYLFIQHNDLYVVAIVTSL-SANAAAIFTFLHKLVEVLSDYL-KTVEEESIR 105
           P L+H G +Y++IQ + LY +++   + +     +F +L +L ++   YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEVMDYGIPQITETKMLKQYITQXXXXXXX---XXXXXRNATR------- 155
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+                   A R       
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 156 ----PPVA------------LTNSVSWRPEGITHKKNEAFLDIVESINMLMT-QKGQVLR 198
               P  A             T+++SWRP GI + KNE FLD+VE +  LM  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSIT 258
           +++ G +   S LSGMP L +G+N      K +  D +  S                   
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLN------KMVAQDRDFTS------------------- 255

Query: 259 SSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTI--KPLI 316
                           + FHQCV L +   ++ ITF+PPDG+F L +Y+L+     +PLI
Sbjct: 256 ---------------QVHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLI 300

Query: 317 ---WCDVNVQVHSN----SRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADT 361
               C   V+         R+ +        K +   + +++ +P+         D +  
Sbjct: 301 KLEECRAAVKPRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFP 360

Query: 362 PTFKYSHGSLKYVPEKSAILW---KIRSFPGGKEYSMSAELGL----------PSISNNE 408
           P FK   G + +      +LW   K +   G + ++M ++  L            +S + 
Sbjct: 361 PRFKCDAGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSM 420

Query: 409 DGNRTMPKSNAEIL------------KGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS 456
           D     P    E L               +++ F++PY T SG++V +LKI EP+LQY+S
Sbjct: 421 DPLPAHPGQQLEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQS 480

Query: 457 YPWVRY 462
           +PW+RY
Sbjct: 481 FPWIRY 486

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  174 bits (440), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 151/553 (27%), Positives = 234/553 (42%), Gaps = 128/553 (23%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S V+  D    PL+ R  +    ++  + + +    +  QS    P +   G+ Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLKS---IAHPEWYALYFKRVHPQSR--GPVIYSKGIIYIYI 55

Query: 61  QHNDLYVVAIVTS-LSANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYELLDE 117
             + LY V++    L  N   I  +L+    +L  YLK   V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 VMDYGIPQITETKMLKQYITQXXXXXXXXXXXXRNA---TRPPV---------------- 158
            +DYGIPQ+T+  +++  I               ++   + P +                
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 159 ------------ALTNSVSWRPEGITHKKNEAFLDIVESINMLMTQK-GQVLRSEIIGDV 205
                         T ++SWRP+GI + KNE F+DI+E  + LM  K  QV ++ + G +
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNK 265
              S LSGMP +++ IN      K L D      +S                        
Sbjct: 236 NCRSYLSGMPIVRVCIN------KMLKDKDLFLGSS------------------------ 265

Query: 266 KKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLI-WCDVNV 322
                     KFHQCV L    ++  I FIPPDG F L  Y+L   I   P+I   D  +
Sbjct: 266 ----------KFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKI 315

Query: 323 -QVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDD--------ADTPTFKYSHGSLKY 373
            +     R+ +    +   K +++AT ++I IP  D            P FK  HGS+ +
Sbjct: 316 NERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFF 375

Query: 374 VPEKSAILWKIRSFPGGK---EYSMSAELGLPSISNNEDGNRTMP--------------- 415
                 +LW  +   GG     YSM  E  L    + E+  R +                
Sbjct: 376 NLSDELLLWDAQGIKGGHGETSYSMHVEFAL---FDEEEHARKLEQIKKSMDPPPLREGA 432

Query: 416 ---------KSNAEILKGPVQ-----IKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVR 461
                    KSN E  KG  Q      +F++PY+T+SG++V YLKI+E  L+Y+S+ WVR
Sbjct: 433 HLEELYAQVKSNKE-GKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVR 491

Query: 462 YITQSGDDYTIRL 474
           Y T +  +Y  ++
Sbjct: 492 YKTINDTEYAYQV 504

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  166 bits (420), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 132/520 (25%), Positives = 243/520 (46%), Gaps = 77/520 (14%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F + ++++L+ +S ++   L      ++ 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
            +H D   +  +T  +AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD ++
Sbjct: 59  SRHGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIML 117

Query: 120 -DYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATR--------------------PPV 158
              GIP  TE   L   I Q             ++                      P  
Sbjct: 118 GGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKF 174

Query: 159 ALTNSVSWRPEG------------------ITHKKNEAFLDIVESINMLMTQKGQVLRSE 200
               S S+  +G                  I HKK+E FL + E IN+L+++ G +L+S 
Sbjct: 175 LTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSY 234

Query: 201 IIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSS 260
           + G + + + LSG P  + G+ND               S    + D      ++   + S
Sbjct: 235 VDGTIDITTHLSGTPICRFGLND---------------SLGMQSEDEKKWLAQQQRHSGS 279

Query: 261 SATNKKKV------NIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK- 313
              NK  +      ++ LED KFH+CV L KF    II F+PPDG  +LM Y +   I  
Sbjct: 280 DFGNKNFIPKAAAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINL 339

Query: 314 PLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKY 373
           P     +      ++ I+     K+    K +A +V + IPVP          S+G  K+
Sbjct: 340 PFKVTPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKF 399

Query: 374 VPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIP 433
           VPE++A++W+   + G  E ++SA     ++S ++    T   +  +  + P+ ++F++ 
Sbjct: 400 VPEENAMIWRFNKYNGLTENTLSA----VTVSTSD----TTQLNLQQWTRPPISLEFEVM 451

Query: 434 YFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
            F+ SG+ VRY  I+    ++++  W++YI+++G  Y +R
Sbjct: 452 MFSNSGLVVRYFTISGKDSKHRAVKWIKYISKAG-SYEVR 490

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  163 bits (413), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 139/518 (26%), Positives = 248/518 (47%), Gaps = 73/518 (14%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F + ++++L+ +S    P L      +  
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQH---NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
           I+    ++L++V I  S +AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD
Sbjct: 57  IRSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLD 114

Query: 117 EVM-DYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATR-------------------- 155
            ++   GIP  TE   L   I Q              +                      
Sbjct: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHF 171

Query: 156 PPVALTNSVSWRPEGITH------------------KKNEAFLDIVESINMLMTQKGQVL 197
           P      S S+  +G +H                  KK+E FL + E +N+L+++ G +L
Sbjct: 172 PKFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSIL 231

Query: 198 RSEIIGDVKVNSKLSGMPDLKLGINDK-GIFSKYLDDDTNIPSASATTSDNNTETDKKPS 256
           +S + G + + + LSG P  + G+ND  G+ S   +D  N  S     S N  E   K  
Sbjct: 232 KSYVDGTIDITTHLSGTPVCRFGLNDSLGMQS---EDQENWLSQQDQHSHNGFEN--KNC 286

Query: 257 ITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PL 315
              ++A      ++ LED KFH+CV + KF    II F+PPDG  +LM Y +   I  P 
Sbjct: 287 FPKAAAG-----SVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPF 341

Query: 316 IWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVP 375
               +      ++ ++     K+    K +A +V + IPVP          S+G+ K+VP
Sbjct: 342 KITPIVAHSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVP 401

Query: 376 EKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYF 435
           E++A++W+   F G  E ++SA     ++S ++    T   S  +  + P+ + F++  F
Sbjct: 402 EENAMIWRFNKFNGLTENTLSA----VTVSTSD----TTQLSLQQWTRPPMSLDFEVMMF 453

Query: 436 TTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
           + SG+ VRY  I+    ++++  W++YI++SG  Y +R
Sbjct: 454 SNSGLVVRYFTISSRDSKHRAVKWIKYISKSG-SYEVR 490

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  163 bits (413), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 131/512 (25%), Positives = 249/512 (48%), Gaps = 61/512 (11%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F + ++++L+ +S ++   L      ++ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
            +H D   +  +T  +AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD ++
Sbjct: 59  SKHGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIML 117

Query: 120 -DYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATR-----------------PPVALT 161
              GIP  TE   +   ++              + +                  P     
Sbjct: 118 GGNGIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLKK 177

Query: 162 NSVSWRPEG------------------ITHKKNEAFLDIVESINMLMTQKGQVLRSEIIG 203
           +S S+  +G                  I HKK+E FL + E +N+L+++ G +L+S + G
Sbjct: 178 SSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDG 237

Query: 204 DVKVNSKLSGMPDLKLGINDK-GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSA 262
            + + + L+G P  + G+ND  G+ S   +D+ N  +     S   ++   K  +  ++A
Sbjct: 238 TIDIVTHLNGTPVCRFGLNDSLGMQS---EDEKNWLAQQHQHS--RSDFGNKNFLPKAAA 292

Query: 263 TNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVN 321
                 ++ LED KFH+CV + KF    II FIPPDG  +LM Y +   I  P     + 
Sbjct: 293 G-----SVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIV 347

Query: 322 VQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAIL 381
                ++ I+     K+    K +A +V + IPVP          S+G  K+VPE++A++
Sbjct: 348 SHSTRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMI 407

Query: 382 WKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQ 441
           W+   + G  E ++SA     ++S ++    T   S  +  + P+ + F++  F+ SG+ 
Sbjct: 408 WRFNKYNGLTENTLSA----ATVSTSD----TTQLSFQQWTRPPMSLDFEVMMFSNSGLV 459

Query: 442 VRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473
           VRY  I+    ++++  W++YI++SG  Y +R
Sbjct: 460 VRYFTISGKDSKHRAVKWIKYISKSG-SYEVR 490

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  160 bits (406), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 123/444 (27%), Positives = 205/444 (46%), Gaps = 71/444 (15%)

Query: 65  LYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM-DYGI 123
           L++VAI  S +AN+  I+ FL+KL  +L+ Y     EE + + F++ YE++D ++    +
Sbjct: 65  LWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDVMLTSNAM 122

Query: 124 PQITETKMLKQYIT----QXXXXXXXXXXXXRNATRPPVALTNS---------------V 164
           P  TE   +   I+    +             N    P  LT +               +
Sbjct: 123 PINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQSDI 182

Query: 165 SWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK 224
            WRP GI +KKNE FL + E IN+L+++   +L++ + G + + S LSG P  + G+ND 
Sbjct: 183 PWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLND- 241

Query: 225 GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLS 284
                YL    N  S       ++   D+       S       ++++ED  FHQCV L 
Sbjct: 242 -----YLSMTGNNISNRGDEFRHDFMDDEDL-----STGRSSSSSVKIEDCTFHQCVSLD 291

Query: 285 KFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEI---HCKAKAQIK 341
           KF +E++I F+PPDG F+LM Y +          D+N+      R+ I    C  + +I 
Sbjct: 292 KFNDERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCSMRYKII 343

Query: 342 RKS------TATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSM 395
            KS      +A +  + IP+P          S G   +    +  +WK   + G      
Sbjct: 344 LKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKG------ 397

Query: 396 SAELGLPSISNNEDGNRTMPKSNAEIL------KGPVQIKFQIPYFTTSGIQVRYLKINE 449
                   ++ NE    T+P S+ +IL      + P+ + F+I  F+ SG+ V+YLK+ E
Sbjct: 398 --------LTENELILETVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVME 449

Query: 450 PKLQYKSYPWVRYITQSGDDYTIR 473
              +Y+   W++Y+++SG  Y IR
Sbjct: 450 RVQKYRPVKWIKYVSKSG-SYEIR 472

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  161 bits (407), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 136/551 (24%), Positives = 237/551 (43%), Gaps = 121/551 (21%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILL-SDLEEQSNLIPPCLNHNGLEYLF 59
           M+S     D   +PL+ R  R   P+  +D   + L ++L+       P    NG  Y  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IQHNDLYVVAIV-TSLSANAAAIFTFLHKLVEVLSDYLKT-VEEESIRDNFVIIYELLDE 117
           I  ++LY   I+  + S +  ++  +L ++ ++   ++   + + ++RDNF +I+E+++E
Sbjct: 58  ITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIEE 117

Query: 118 VMDYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATR--PP-------------VALTN 162
             DYGI Q+T   ++  +I               +     PP               +T+
Sbjct: 118 SSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMTS 177

Query: 163 SVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGI 221
           +VSWRP+GI + KNE FLD++E +  +M  +  V+R+ +I G +   S LSGMP L +G+
Sbjct: 178 AVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGL 237

Query: 222 NDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCV 281
           N                                          +K V+  ++ LKFH+CV
Sbjct: 238 N---------------------------------------KLMQKNVHF-MKRLKFHECV 257

Query: 282 RLSKF--ENEKIITFIPPDGKFDLMNYRLSTTI--KPLI-----WCDVNVQVHSNSRIEI 332
            L     E   +I FIPPDG+F+L NY+L+  +  +P+I           + +  ++ ++
Sbjct: 258 DLHTLIKEESPVIKFIPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKL 317

Query: 333 HCKAKAQIKRKSTATNVEILIPVP----------DDADTPTFKYSHGSLKYVPEKSAILW 382
             KA      K+  +  E+LI +P          D    P FK   G + +     +I+W
Sbjct: 318 LLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIW 377

Query: 383 KIRSFPGG---KEYSMSAELGLPSISNNE------------------------------- 408
           KI +  GG   K Y +     +     +E                               
Sbjct: 378 KINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGK 437

Query: 409 ----DGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 464
               DGN    +   +     + + F+IPY+  SG++V Y KI EP+L Y+S+PWVRY T
Sbjct: 438 TTEYDGNENQKEDVDKF--ALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKT 495

Query: 465 QSGDDYTIRLT 475
            + ++Y  +++
Sbjct: 496 VNDNEYIYQVS 506

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  159 bits (401), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/314 (30%), Positives = 168/314 (53%), Gaps = 21/314 (6%)

Query: 162 NSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGI 221
           N ++WRP+GITHKK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 222 NDK-GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQC 280
           ND  G+ S   +D+    +     S  N E+  K  I  ++A      ++ LED KFH+C
Sbjct: 256 NDSLGMQS---EDEKKWLAQQQHHSRGNFES--KNFIHKAAAG-----SVLLEDCKFHEC 305

Query: 281 VRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKAKAQ 339
           V L KF     I F+PPDG  +LM Y +   I  P     +      ++ I+     K+ 
Sbjct: 306 VSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRITLKSL 365

Query: 340 IKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAEL 399
              K +A +V + IPVP          S+G  K+VPE++A++W+   + G  E ++SA  
Sbjct: 366 FPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSA-- 423

Query: 400 GLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPW 459
              ++S ++    T   +  +  + P+ + F++  F+ SG+ VRY  I     ++++  W
Sbjct: 424 --VTVSTSD----TTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKW 477

Query: 460 VRYITQSGDDYTIR 473
           ++YI++SG  Y +R
Sbjct: 478 IKYISRSG-SYEVR 490

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 76/130 (58%), Gaps = 5/130 (3%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F + ++++L+ +S ++   L      ++ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
            +H D   +  +T  +AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD ++
Sbjct: 59  SRHGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIML 117

Query: 120 -DYGIPQITE 128
              GIP  TE
Sbjct: 118 GGNGIPIDTE 127

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  155 bits (391), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 129/506 (25%), Positives = 220/506 (43%), Gaps = 124/506 (24%)

Query: 48  PCLNHNGLEYLFIQHNDLYVVAIVTSLS-ANAAAIFTFLHKLVEVLSDYL-KTVEEESIR 105
           P L +   +Y+FIQ + LY +++   L+      +F++L++L  +   YL + + +  I 
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLIT 100

Query: 106 DNFVIIYELLDEVMDYGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPV------- 158
            NF +I+EL+DE +  G PQ+T+  +++ YI +            R AT           
Sbjct: 101 GNFHLIHELIDESIFMGTPQLTDYNIIRDYI-KVQVVKDSPEPATREATVTNTKKNKKKD 159

Query: 159 ----------------------ALTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQV 196
                                   T+++SWRP+GI + KNE +LD++E +  L+  +   
Sbjct: 160 SKKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMN 219

Query: 197 LRSEII-GDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKP 255
           ++S  + G ++  S LSGMP L +G+N                                 
Sbjct: 220 IKSNTVYGYIQCRSYLSGMPMLTIGLN--------------------------------- 246

Query: 256 SITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-- 313
            + S +    ++ N       FHQCV L +   +K+I+F PPDG+F L NY+L+  +   
Sbjct: 247 KLNSENEYFMRRAN-------FHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDP 299

Query: 314 PLIW---CDVNVQVHSNS----RIEIHCKAKAQIKRKSTATNVEILIPVP--------DD 358
           P+I    C V ++         R+ +        K + + + + I +P+         D 
Sbjct: 300 PMIKLEDCKVKLKPRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDL 359

Query: 359 ADTPTFKYSHGSLKYVPEKSAILWKIRSFPGG---KEYSMSAELGL----------PSIS 405
           +  P FK   G + +      +LW++    GG   K   M +E  L            +S
Sbjct: 360 SYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLS 419

Query: 406 NNED-----------------GNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKIN 448
           N+ D                      P S A +LK    ++F+IPY+T SG++V +LKI 
Sbjct: 420 NSMDPKPIRRGPHLEKLYQQTHELNSPTSEAALLK----VEFEIPYYTISGLKVEFLKIE 475

Query: 449 EPKLQYKSYPWVRYITQSGDDYTIRL 474
           E +LQ++S+PWVRY T + D Y  +L
Sbjct: 476 EKQLQFQSFPWVRYKTINHDIYAYQL 501

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  147 bits (371), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 125/506 (24%), Positives = 234/506 (46%), Gaps = 66/506 (13%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +AV      G+ ++S+ ++  +  S  D F + +++ L+ +S ++   L      Y+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 60  IQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
                L+VV+ V+  + N+AA + FL+K   +L+ Y +   EE +++ F++ +ELLD ++
Sbjct: 59  TPGEGLWVVS-VSRNNENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTMV 116

Query: 120 DYG-IPQITETKML---------------------KQYITQXXXXXXXXXXXXRNATRPP 157
           + G IP  T+   +                     +Q  T               A+ P 
Sbjct: 117 EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNP- 175

Query: 158 VALTNSVSWRP----EGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSG 213
                 +S  P    +G   K+NE  + + ESI++L+++ G +L++ + G + + +KL G
Sbjct: 176 ----GGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEG 231

Query: 214 MPDLKLGINDKGIFSKYLDDDTNI---PSASATTSDNNTETDKKPSITSSSATNKKKVNI 270
               + G+ND    S   D+ +N    P  S  T   N E             N     +
Sbjct: 232 AAVCQFGLND----SLSTDNSSNSKWDPLRSKETQGTNLEMK-----------NAHVGTV 276

Query: 271 ELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRI 330
            L D KFHQCV L +F+ ++II F PP+G  +LM Y +   +         V   +N+  
Sbjct: 277 LLRDCKFHQCVSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNET 336

Query: 331 EIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGG 390
           +     K+    K +A NV + IPVP          S+G+ K++PE++A++WK   + G 
Sbjct: 337 DYRVTIKSLFPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGL 396

Query: 391 KEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKI--- 447
            E  +SA + +P+         T   +  +  + P+ + F+I  ++ +G+ VRY  +   
Sbjct: 397 TENKLSA-ITVPT-------RDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDK 448

Query: 448 NEPKLQYKSYPWVRYITQSGDDYTIR 473
           +    ++K+  W++Y++ SG  Y +R
Sbjct: 449 HNNNTKFKTVKWIKYVSHSG-SYEVR 473

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  140 bits (352), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 113/360 (31%), Positives = 167/360 (46%), Gaps = 72/360 (20%)

Query: 161 TNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKL 219
           T +VSWR +GI + KNE FLD+VES+  LM  K +V+R  +I G +K  S LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 220 GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQ 279
            +N      K L DD      +           K     S ++ N K +    +DL+   
Sbjct: 282 ALN------KILQDDKQFLGHA-----------KFHQCVSLNSINIKDLE---KDLEGPN 321

Query: 280 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSN---SRIEIHCK 335
            +    F N+K I FIPPDG+F L  Y L   +K P +    +  +  N    R++I  K
Sbjct: 322 DISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFRVQISLK 381

Query: 336 AKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKIRSF 387
            +   KR+++ + + I IP+         D +  P FK   G + +   +  ++W+I + 
Sbjct: 382 IETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDAL 441

Query: 388 PGG---KEYSMSAELGL-------------------PSISN-------------NEDGNR 412
            GG    E  M AE  L                   P + N             NED   
Sbjct: 442 KGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDAED 501

Query: 413 TMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTI 472
           T  K   +     V ++F+IPY T SG++V YLKI E  L+Y+S+PWVRY T + D+Y  
Sbjct: 502 TALKMKTQY----VFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEYAF 557

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQ-SNLIPPCLNHNGLEYLF 59
           M+S ++  D   +PL+S+  +       +   P ++   +E  +   PP +  +   Y++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  IQHNDLYVVAIVTSL---SANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYEL 114
           ++ + L+ VA +  +     N   I  +L +L  +L +Y K   + +  I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDEVMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  +++ YI
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYI 136

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  132 bits (333), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 109/356 (30%), Positives = 157/356 (44%), Gaps = 87/356 (24%)

Query: 161 TNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKL 219
           T  VSWR +GI + KNE FLD+VE +  L   K +V+R  +I G +   S LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQ 279
            +N      K L  D    S S                                  KFHQ
Sbjct: 293 ALN------KLLQRDAQFMSHS----------------------------------KFHQ 312

Query: 280 CVRLSKFENEKIITFIPPDGKFDLMNYRLS-----TTIKPLIWCDVNVQVHSNSRIEIHC 334
           CV L    NEK + FIPPDG+F L  Y L      T I  +   ++  Q+    ++ I  
Sbjct: 313 CVALETL-NEKELEFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILL 370

Query: 335 KAKAQIKRKSTATNVEILIPVPD-------DADTPT-FKYSHGSLKYVPEKSAILWKIRS 386
             +   K +++ + + + IP+         D   PT FK + G + +      +LW+I  
Sbjct: 371 TIETHFKTRNSTSILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQ 430

Query: 387 FPGGK---EYSMSAELGL-------------------PSISNN----EDGNRTMPKSNAE 420
             GG    ++SM AE  L                   P +       E   +T  + + E
Sbjct: 431 MRGGHGETQFSMVAEFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPE 490

Query: 421 ILKGPVQ-----IKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 471
           +L   +Q     + F+IPY T SG++V YLKI E +LQY+S+PWVRY T S ++Y 
Sbjct: 491 VLVKSIQSQLVGMDFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 66/141 (46%), Gaps = 11/141 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEE-QSNLIPPCLNHNGLEYLF 59
           M+S +Y  D N +PL+S+       + +I     L+   +E  S+  PP + +    ++ 
Sbjct: 1   MSSCLYILDENLEPLISKN------IKSIPNLNTLVEVFQEVYSSNAPPIVFNRNWYFIH 54

Query: 60  IQHNDLYVVAIV--TSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
            + + L  ++ +  T  SANA  I  ++ +   +L  YL   + +       ++  L   
Sbjct: 55  TKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNLVLDNVLLVLELL 114

Query: 118 VM--DYGIPQITETKMLKQYI 136
               ++G+PQ+TE  ++K YI
Sbjct: 115 EESSEFGVPQMTEPSVMKDYI 135

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  129 bits (325), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 107/348 (30%), Positives = 151/348 (43%), Gaps = 83/348 (23%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + +NE FLD+VE +  LM     +++  +I G +   S LSGMP LK+   
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIA-- 273

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
               F+K    D    S S                                  KFHQCV 
Sbjct: 274 ----FNKLSQKDEQFISHS----------------------------------KFHQCVT 295

Query: 283 LSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIHCKAK 337
                NEK I FIPPDG F L  Y L   +K      L+   V  ++    +I++ C  +
Sbjct: 296 WPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKLVSFGVKPKL-KKYKIQMSCTIE 353

Query: 338 AQIKRKSTATNVEILIPVPD-------DADTPT-FKYSHGSLKYVPEKSAILWKIRSFPG 389
              K +++ + + + IP+         D   P  FK   G + +      +LW I    G
Sbjct: 354 THFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKG 413

Query: 390 GK---EYSMSAELGLPSI------------SNNEDGNRTMPK-----SNAEILKGP---- 425
           G    + SM+AE  L +             S N    R  PK           KGP    
Sbjct: 414 GHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMA 473

Query: 426 ---VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDY 470
              + +KF+IPY T SG+QV YLKI+E +LQY+S+PWVRY T + ++Y
Sbjct: 474 SRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S ++  D N +PL+S+  +    L  I +    +   E Q     P ++ +   ++ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPESQ-----PVISASSFHFVHI 55

Query: 61  QHNDLYVVAIVTSL--SANAAAIFTFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELLD 116
           + + L  V+++ +   SAN   I TFL +   +L  YL    +++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 EVMDYGIPQITETKMLKQYI 136
           E +D+G+ QIT+  +++ YI
Sbjct: 116 ESIDFGVIQITDASIMRDYI 135

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  128 bits (321), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 103/359 (28%), Positives = 164/359 (45%), Gaps = 72/359 (20%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +   M  K  V+R  +I G++   S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
              I  + +   +N+      + D+       P++        KK N E + L       
Sbjct: 310 --KILKQDVQFLSNVKFHQCVSLDSIRARSNPPAVEEDG----KKKNEEADTLG------ 357

Query: 283 LSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC---DVNVQVHSNSRIEIHCKAK 337
                N+  I FIPPDG+F L  Y L   +K  P+I     ++  ++H   +I+IH   +
Sbjct: 358 -----NKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLHK-FKIKIHVIIE 411

Query: 338 AQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKIRSFPG 389
              K  ++ + + + IP+         D +  P FK   G++ +      +LW++ +  G
Sbjct: 412 THFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGTMNG 471

Query: 390 G---KEYSMSAELGL-------------------------PSISN-----NEDGNR---T 413
           G      SM AE  L                         P +       +E+G+    +
Sbjct: 472 GHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSDEVS 531

Query: 414 MPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTI 472
             K N  +L     + F++PY T SG+++ YLKI E +LQY+S+PWVRY T S D+Y  
Sbjct: 532 TRKKNESLL----TMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYAF 586

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 81/143 (56%), Gaps = 13/143 (9%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEE--QSNLIPPC--LNHNGLE 56
           M+S+++  D   +P++ +  R      A+   P L++  +E  +SN + P   LN    +
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  YLFIQHNDLYVVAIVTSLS-ANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYE 113
           +L I+ + L  +++V + S  N   +FT+L +  ++L DYL    +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEVMDYGIPQITETKMLKQYI 136
           L+DE +D+G+ Q T++ ++K Y+
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYV 137

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  125 bits (314), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 98/364 (26%), Positives = 159/364 (43%), Gaps = 97/364 (26%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + KNE FLD++E +  LM    G++ ++ I G++K    LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K + +D    S S                                  KFHQCV 
Sbjct: 276 ------KLIKNDEQFISNS----------------------------------KFHQCVS 295

Query: 283 LSKFE------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWCDVNVQVH--- 325
           ++  +            + K I FIPPDG+F L  Y L   ++  P+I    N+++    
Sbjct: 296 INSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLS-NIEIKPKL 354

Query: 326 SNSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEK 377
              +I+IH   +   K++++ + + I IP+         D    P FK   G + +    
Sbjct: 355 KKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISD 414

Query: 378 SAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE-----ILKGP------- 425
             ++W++ S  GG   S +  +    I N E+ +R   +         + +GP       
Sbjct: 415 DFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYE 474

Query: 426 ------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSG 467
                             + +KF++PY T SG++V YLKI E ++ Y+S+PWVRY T + 
Sbjct: 475 QTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTIND 534

Query: 468 DDYT 471
           D+Y 
Sbjct: 535 DEYA 538

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 73/141 (51%), Gaps = 10/141 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S ++  D + +PL+S+  +    L+ I +F  L  + +E     PP        Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKL--NYKENG---PPVFTVLEWHYVFI 55

Query: 61  QHNDLYVVAIVTSLS---ANAAAIFTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYELL 115
           + + L+ +  +        N  A+  +L +L  +L  Y    +++   + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEVMDYGIPQITETKMLKQYI 136
           DE MD+GI Q+T+  ++K YI
Sbjct: 116 DESMDFGIVQLTDPSIIKDYI 136

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  124 bits (310), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 109/391 (27%), Positives = 161/391 (41%), Gaps = 127/391 (32%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLM-TQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + KNE FLD++E +  L+  + G V RS I G +   S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K L +D    S                                   ++FHQCV 
Sbjct: 309 ------KLLQNDKQFISQ----------------------------------VQFHQCVS 328

Query: 283 LSKFEN----------------------EKIITFIPPDGKFDLMNYRLSTTIK--PLI-W 317
           L   E                       E  I FIPPDG F L +Y L   I+  P++  
Sbjct: 329 LDSIEKVIKYAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKL 388

Query: 318 CDVNVQVH-SNSRIEIHCKAKAQIKRKSTATNVEILIPVPD-------DADTPT-FKYSH 368
           C   +       +++I    +   K  ++ + +++ IP+         D   P  FK S+
Sbjct: 389 CSFEITPKWKKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSN 448

Query: 369 GSLKYVPEKSAILWKIRSFPGGKEY-------------SMSAELGL-------------- 401
           G + Y      +LW+I    GGK +             +M+AE GL              
Sbjct: 449 GRVVYNISDDFLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERE 508

Query: 402 -----------PSISN-------NEDGNRTM---PKSNAEILKGPVQIKFQIPYFTTSGI 440
                      P + +         DG  ++   PK+N  +L     + F+IPY T SG+
Sbjct: 509 TSMNPPPLRTGPKLEDIYKETHEENDGYNSVGQKPKNNLNLL----SMDFEIPYCTCSGL 564

Query: 441 QVRYLKINEPKLQYKSYPWVRYITQSGDDYT 471
           +V YLKI+E +LQY+S+PWVRY T + D+Y 
Sbjct: 565 KVEYLKIDEDQLQYQSFPWVRYKTINDDEYA 595

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 79/141 (56%), Gaps = 10/141 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S++Y  D   +PL+S+  +    L  +++   L      QS    P ++     +++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG---LPNVNELGDLFRYHVRQSQ--NPIIDVYNWRFVYI 55

Query: 61  QHNDLYVVAIVTSLS---ANAAAIFTFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELL 115
           + + LY VA+V +     AN  AI T+L +L ++  DY+  K ++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEVMDYGIPQITETKMLKQYI 136
           DE +DYGI Q+TE  ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  122 bits (307), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 105/365 (28%), Positives = 164/365 (44%), Gaps = 81/365 (22%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K L+ D    S        N+   +  S+ S     K++   E ED        
Sbjct: 320 ------KILNRDAQFLS--------NSSFHQCVSLDSIKTIEKRE---EKED----DDTG 358

Query: 283 LSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC-DVNVQVH-SNSRIEIHCKAKA 338
           L    + K + F+PPDG+F L  Y L   +K  P+I   D  ++      +I+I  K + 
Sbjct: 359 LQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQT 418

Query: 339 QIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGG 390
             K  ++ + + + IP+         D +    FK + G + +      +LW+I++  G 
Sbjct: 419 NFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGH 478

Query: 391 KEY----------------SMSAELGLPSISNNEDGNRTMPKSNAE-----ILKGP---- 425
           +E+                SM AE  L    N E+ +R   +         +  GP    
Sbjct: 479 REHNTNKTSQDDNDPDACASMVAEFPL---FNQEEYDRLQEEKKTSMNPPPLRTGPRLEE 535

Query: 426 -------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQS 466
                              V I F+IPY T SG+++ YLK+ EP+LQY+S+PWVRY T S
Sbjct: 536 LYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTS 595

Query: 467 GDDYT 471
            D+Y 
Sbjct: 596 DDEYA 600

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 57/95 (60%), Gaps = 5/95 (5%)

Query: 47  PPCLNHNGLEYLFIQHNDLYVVAIVTSL---SANAAAIFTFLHKLVEVLSDY--LKTVEE 101
           PP L+ N   ++ ++ + L+ V+++ +    + +   I  FL +   +L +Y  +K + +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 102 ESIRDNFVIIYELLDEVMDYGIPQITETKMLKQYI 136
           + I DN +++ EL+DE +D+GI Q+T+  ++K YI
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  121 bits (304), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 97/357 (27%), Positives = 152/357 (42%), Gaps = 89/357 (24%)

Query: 163 SVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGI 221
           SVSWR +GI + KNE FLD++E +   M     +++  +I G++   S LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCV 281
           N      K +  D    S+                                   KFHQCV
Sbjct: 282 N------KIIYQDKQFLSSC----------------------------------KFHQCV 301

Query: 282 RLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIHCKA 336
                +  K++ F+PPDG F L  Y L   +       LI  +V  ++    ++++    
Sbjct: 302 MPDSVDEGKVLEFVPPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTI 360

Query: 337 KAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKIRSFP 388
           ++  K+ ++ T + I IP+         D +     +   G + +      +LW+I +  
Sbjct: 361 ESTFKKTNSTTKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMK 420

Query: 389 GGK-EYSMSAELGLPS------------ISNNEDGNRTMPK------------------- 416
           GG  +  M A+  L +             S N    RT PK                   
Sbjct: 421 GGNSQLKMGADFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRK 480

Query: 417 --SNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 471
             S+ E     +++ F+IPY T+SG++V YLKI EP LQY+++PWVRY T S D Y 
Sbjct: 481 GESSDETKGNLIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  121 bits (303), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 106/384 (27%), Positives = 163/384 (42%), Gaps = 119/384 (30%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++   S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K L+ D                    P   S+S               FHQCV 
Sbjct: 313 ------KILNRD--------------------PQFMSNS--------------NFHQCVS 332

Query: 283 LSKFE-------------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC-DV 320
           L                       + + I F+PPDG+F L  Y L   +K  P+I   D 
Sbjct: 333 LDSINTIEKGQEKEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDF 392

Query: 321 NVQVH-SNSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSL 371
            ++     S+I+I  K +   K  ++ + + + IP+         D +    FK ++G +
Sbjct: 393 EIKPKLKKSKIQILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKV 452

Query: 372 KYVPEKSAILWKIRSFPGGKEY----------------SMSAELGLPSISNNEDGNRTMP 415
            +      +LW+I++  G +E                 SM AE    S+ N E+ +R   
Sbjct: 453 VFNLSDDFLLWEIQTMKGHRERNASNAPQDDGDPSTCASMVAEF---SLFNQEEYDRLQE 509

Query: 416 KSNAE-----ILKGP-----------------------VQIKFQIPYFTTSGIQVRYLKI 447
           +         +  GP                       V I F+IPY T SG++V YLK+
Sbjct: 510 EMKTSMNPPPLRTGPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKV 569

Query: 448 NEPKLQYKSYPWVRYITQSGDDYT 471
            EP+LQY+S+PWVRY T + ++Y 
Sbjct: 570 EEPQLQYQSFPWVRYKTVNDEEYA 593

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 79/142 (55%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEE-QSNLIPPCLNHNGLEYLF 59
           M+S+++  D + +P++S+  R      A+     +LS  ++   +  PP L  N   ++ 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 60  IQHNDLYVVAIVTSL---SANAAAIFTFLHKLVEVLSDY--LKTVEEESIRDNFVIIYEL 114
           ++ + L++V+++ +    + +   I  FL +   +L  Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 115 LDEVMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYI 136

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  117 bits (294), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 125/500 (25%), Positives = 224/500 (44%), Gaps = 98/500 (19%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M SA+      G+ ++S+ YR++I  S  + F I + +     N+  P L      +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVIN---NFNVRSPILTLGSTTFHHI 57

Query: 61  QH-------NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYE 113
           +        ++L++V  V   +AN+AAI+ FL KL  +L  Y  T  E  ++D F+ ++E
Sbjct: 58  RSTANDPTDDELWLVC-VNRNNANSAAIWEFLQKLNLILQQYGIT-SESKLKDEFMTVHE 115

Query: 114 LLDE-VMDYGIPQITETKMLKQYI-------TQXXXXXXXXXXXXRNA--TRPPVALTNS 163
           +LD  ++  GI Q T+ K +   +       T             RN   T P    +  
Sbjct: 116 ILDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLI 175

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIND 223
            + R +   HKKNE F  + ES+N+L+++ G +L++ + G +++ S L+G P  +     
Sbjct: 176 PTNRHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQF---- 229

Query: 224 KGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRL 283
                + +DD T I                                    D KF QC+  
Sbjct: 230 -----ELVDDQTKIT-----------------------------------DFKFDQCIEK 249

Query: 284 SKFENEKIITFIPPDGKFDLMNYRLST-------TIKPLIWCDVNVQVHSNSRIEIHCKA 336
            +    + +     DG+ +++NY +          I P++     V+   + RI +    
Sbjct: 250 VQ---SRTVRVAATDGELEIVNYHVRDDKINIPFKITPIV---STVKDTVDYRISL---- 299

Query: 337 KAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMS 396
           K+   +  +AT+V + IPVP +        S+G  K+  E++A++W    F G  E ++S
Sbjct: 300 KSLFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLS 359

Query: 397 AELGLPSISNNEDGNRTMPKSNAEILKGP-VQIKFQIPYFTTSGIQVRYLKINEP-KLQY 454
           A     +I+   DG + M   N E    P +Q+ F+I  ++ SG+ +R L I +  K +Y
Sbjct: 360 A----ITIA---DGRQIM---NLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRY 409

Query: 455 KSYPWVRYITQSGDDYTIRL 474
           K+  W++YI+++G  Y +R 
Sbjct: 410 KASRWIKYISRAG-SYEMRF 428

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 105/388 (27%), Positives = 161/388 (41%), Gaps = 123/388 (31%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K L+ D                    P   S+S+              FHQCV 
Sbjct: 318 ------KILNRD--------------------PQFMSNSS--------------FHQCVS 337

Query: 283 LSKFE--------------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC-D 319
           L                        + + I FIPPDG+F L  Y L   +K  P++   D
Sbjct: 338 LDSINTIEKDEEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKD 397

Query: 320 VNVQVH-SNSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGS 370
             ++      +I+I  K +   K  ++ + + + IP+         D +    FK + G 
Sbjct: 398 FEIKPKLKKFKIQIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGK 457

Query: 371 LKYVPEKSAILWKIRSFPGGKEY-------------------SMSAELGLPSISNNEDGN 411
           + +      +LW+I++  G +E+                   SM AE  L    N E+ +
Sbjct: 458 VVFNLSDDFLLWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPL---FNQEEYD 514

Query: 412 RTMPKSNAE-----ILKGP-----------------------VQIKFQIPYFTTSGIQVR 443
           R   +         +  GP                       V I F+IPY T SG++V 
Sbjct: 515 RLQEEMKTSMNPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVE 574

Query: 444 YLKINEPKLQYKSYPWVRYITQSGDDYT 471
           YLK+ EP+LQY+S+PWVRY T S ++Y 
Sbjct: 575 YLKVEEPQLQYQSFPWVRYKTVSDEEYA 602

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 78/142 (54%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEE-QSNLIPPCLNHNGLEYLF 59
           M+S+++  D N +PL+S+  R      A+     +LS  ++   +  PP L+ N   ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 60  IQHNDLYVVAIVTSL---SANAAAIFTFLHKLVEVLSDY--LKTVEEESIRDNFVIIYEL 114
           ++ + L+ V+++ +    + +   I  FL +   +L  Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDEVMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYI 136

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  116 bits (290), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 107/386 (27%), Positives = 160/386 (41%), Gaps = 122/386 (31%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K L+ D                    P   S+S              KFHQCV 
Sbjct: 312 ------KLLNRD--------------------PQFMSNS--------------KFHQCVS 331

Query: 283 LSKFE------------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLI---WCD 319
           L                      + K I FIPPDG+F L  Y L   +K  P+I     +
Sbjct: 332 LDSINIIEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFE 391

Query: 320 VNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSL 371
           +  ++    +I+I  K +   K  ++ + + + IP+         D +    FK + G +
Sbjct: 392 IKPKL-KKFKIQIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKV 450

Query: 372 KYVPEKSAILWKIRSFPGGKEY---------------SMSAELGLPSISNNEDGNRTMPK 416
            +      +LW+I +  G +E                SM AE  L    N E+ +R   +
Sbjct: 451 VFNLSDDFLLWEIGTMKGHRERNTGTVPQEDDASTLASMVAEFPL---FNQEEYDRLQEE 507

Query: 417 SNAE-----ILKGP--------------------------VQIKFQIPYFTTSGIQVRYL 445
                    +  GP                          V + F+IPY T SG++V YL
Sbjct: 508 LKTSMNPPPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYL 567

Query: 446 KINEPKLQYKSYPWVRYITQSGDDYT 471
           K+ EP+LQY+S+PWVRY T S D+Y 
Sbjct: 568 KVEEPQLQYQSFPWVRYKTISDDEYA 593

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 79/142 (55%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNL-IPPCLNHNGLEYLF 59
           M+S+++  D + +PL+S+  R      AI     +LS  ++  +   PP L+ NG  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDLYVVAIVTSL---SANAAAIFTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYEL 114
           ++ + L+ ++++ +    + +  +I  FL +   +L  Y +   + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEVMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYI 136

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  115 bits (287), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 97/376 (25%), Positives = 158/376 (42%), Gaps = 118/376 (31%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FL+++E +   M     V++  +I G+++    LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K +++D                                     L + KFHQCV 
Sbjct: 313 ------KIVNEDKQF----------------------------------LANCKFHQCVS 332

Query: 283 LSKFE--NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWCDVNVQVH---------SNSR 329
           L+  E  + K + F+PPDG+F L  Y L   ++  P++   VN +V              
Sbjct: 333 LASLESSDHKDVEFVPPDGEFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKLLLT 391

Query: 330 IEIHCKAKAQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAIL 381
           IE H       K  +  + + + +P+         D +     K   G++ +      +L
Sbjct: 392 IETH------FKTTNATSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLL 445

Query: 382 WKIRSFPGGK---EYSMSAELGLPSISNNEDGNRT--MPKSNAE---ILKGP-------- 425
           W++ S  GG    + SM  E  L    N E+ +R   M K++     + +GP        
Sbjct: 446 WEVGSMSGGHGETQLSMGVEFAL---FNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQ 502

Query: 426 ------------------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYK 455
                                         + + F++PY T+SG++V YLKI EP+L+Y+
Sbjct: 503 IHEDDDDDDGNTEPVAEHRLQPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQ 562

Query: 456 SYPWVRYITQSGDDYT 471
           S+PWVRY T S  +Y 
Sbjct: 563 SFPWVRYTTLSDAEYA 578

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 70/138 (50%), Gaps = 6/138 (4%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S +Y  D N + L+S+  +    L    ++PI        SN  P    H+   + +I
Sbjct: 1   MSSVLYILDENLETLISKNIKAVPSL----EYPIAQFKKLYGSNAPPVIDYHDLFTFTYI 56

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELLDEV 118
           Q + L  V++V  +         +L    EVL +YL  K +++  + DN V+I EL++E 
Sbjct: 57  QRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIEET 116

Query: 119 MDYGIPQITETKMLKQYI 136
           +D+G  Q+T++ +L  YI
Sbjct: 117 IDFGAIQVTDSGLLADYI 134

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 59/255 (23%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E    +M  K  ++R  +I G +     LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K L  D                                     L  L+FHQCV 
Sbjct: 347 ------KLLQKDQQF----------------------------------LSQLRFHQCVS 366

Query: 283 LSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIHCKAK 337
           L   +N++I  FIPPDG+F L  Y L   +K      LI  ++  ++    +I+I+    
Sbjct: 367 LETIQNKEI-EFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKPKLKK-FKIQINLSIT 424

Query: 338 AQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKIRSFPG 389
              K +++ + + + IP+         D   +P FK + G +K+      +LW+I S  G
Sbjct: 425 TFFKVQNSTSILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKG 484

Query: 390 GKE---YSMSAELGL 401
           G      +M+AE  L
Sbjct: 485 GHGENIKAMTAEFFL 499

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 7/93 (7%)

Query: 386 SFPGGKEYSMSAELGLPS----ISNNEDGNRTMPKSNAEILKGP--VQIKFQIPYFTTSG 439
           S P     +  A +  P+    + N+   N+ +P   A +   P  + + F+IPY+  SG
Sbjct: 564 SIPSTGTTNAGANIATPASTSVVKNDTSSNKEIPLKKA-LSNKPQYLTVDFEIPYYACSG 622

Query: 440 IQVRYLKINEPKLQYKSYPWVRYITQSGDDYTI 472
           ++V YLKI E +L Y+S+PWVRY T +  DY  
Sbjct: 623 LKVEYLKIEEEQLLYQSFPWVRYKTTNDKDYVF 655

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 74/143 (51%), Gaps = 13/143 (9%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIP---PCLNHNGLEY 57
           M S ++  D N +PL+S+  R      AI  F  ++    +  +      P ++ N   +
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQHNDL-YVVAI-VTSLSANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYE 113
           + I+ + L ++ AI +    ++  ++  +L K   +L  +LKT  +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDEVMDYGIPQITETKMLKQYI 136
           L+DE +D+GI Q+T+  ++K Y+
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYV 137

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 114/254 (44%), Gaps = 31/254 (12%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +   M  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVR 282
                 K L +D+   S +      + ++    S       +   VN         +   
Sbjct: 355 ------KILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVN---------ENEN 399

Query: 283 LSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLI---WCDVNVQVHSNSRIEIHCKAK 337
             + + +K I FIPPDG F L  Y L   +K  P+I     D+  ++ S  +++IH   +
Sbjct: 400 HDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLKIHVIIE 458

Query: 338 AQIKRKSTATNVEILIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKIRSFPG 389
              K  +  + + + IP+         D +    FK   G + +    + ++W+I S  G
Sbjct: 459 THFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGSMKG 518

Query: 390 GK-EYSMSAELGLP 402
           G  E +MS     P
Sbjct: 519 GHGEVTMSMMAEFP 532

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 38/46 (82%)

Query: 426 VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 471
           ++I F+IPY+T SG+++ YLKI EP+LQY+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 85/165 (51%), Gaps = 34/165 (20%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLE---EQSNLIP--------PC 49
           M+S ++  D N +P+L++  R     S  + F +LL   E   +Q N I         P 
Sbjct: 1   MSSCIFILDENLEPILNKNIR-----SIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLPI 55

Query: 50  LNHN---------------GLEYLFIQHNDLYVVAIVTSLSANAAAI-FTFLHKLVEVLS 93
           LN N               G ++L I+ + L  V+I+ + S N+  I F++L +  ++L 
Sbjct: 56  LNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLK 115

Query: 94  DYLKT--VEEESIRDNFVIIYELLDEVMDYGIPQITETKMLKQYI 136
            YL    +++  + DNF+++ ELLDE +D+GI Q T++ ++K YI
Sbjct: 116 SYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYI 160

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 82/330 (24%), Positives = 137/330 (41%), Gaps = 69/330 (20%)

Query: 162 NSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMP--DLKL 219
           + V WR  GI +  NE F+D+ E IN ++ +KG++L   I G + +N+ LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQ 279
           G+ D  +            S   TT       DK  SI    A                 
Sbjct: 267 GLLDHKL------------SHLNTTFHRCILEDKANSINDLIA----------------- 297

Query: 280 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKP--LIWCDVNVQVHSNSRIEIHCKAK 337
                KF     +TF+PPDG+  L  Y L    +   L   DVN+Q     R++   + +
Sbjct: 298 ----GKFTK---LTFVPPDGRTRLCQYTLPLVKRDSNLGIIDVNLQSSLGKRLD-EFEVR 349

Query: 338 AQIKRKSTATNVE-----ILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKI-RSFPGGK 391
             +   +T   +E     I +           + +HG ++    +  + W + ++   G 
Sbjct: 350 VTVGMSTTVKEIENMSMTIRMNRNFKGIVRVMRNTHGGVETNMTRGEVNWHLDKNMVCGS 409

Query: 392 EYSMS--AELGLPSISNNEDGNRTM----PKSNAEILKGPVQIKF------QIPYFTTSG 439
              +   AEL     SN++  +R+     P S+   L  P  IK       Q+P    SG
Sbjct: 410 MAVLRCIAELEPELASNDQTSSRSSVVQPPSSHLTSLLQPSFIKCYYEHKSQLP----SG 465

Query: 440 IQVRYLKI--NEPKLQYKSYPWVRYITQSG 467
           I+++ + +    PK   K +  V+Y+T++G
Sbjct: 466 IKLQSIDVVNGGPK---KPFKGVKYLTKTG 492

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 67/163 (41%), Gaps = 60/163 (36%)

Query: 163 SVSWRPEGITHKKNEAFLDIVESINMLMTQKGQ----------VLRSEIIGDVKVNSKLS 212
           +V WR   + H  NE +LD+VESI++++  K +          ++   IIG   V S L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 213 GMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIEL 272
           G P +++ I+  G                                             +L
Sbjct: 261 GNPIVEMKIDMAGN--------------------------------------------DL 276

Query: 273 EDLKFHQCVRL------SKFENEKIITFIPPDGKFDLMNYRLS 309
           E +  H+CV+        +FEN K+I F+PPDG F L +Y ++
Sbjct: 277 ESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/288 (20%), Positives = 102/288 (35%), Gaps = 81/288 (28%)

Query: 53  NGLEYLFIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLK--TVEEESIRDNFVI 110
           +GL Y  +Q  +     I    + N    F FL  +  +L+ Y     ++   I  N+  
Sbjct: 72  DGLRYWCLQRTE-----IGEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDR 126

Query: 111 IYELLDEVMDYGIPQITETKMLKQY---------------------ITQXXXXXXXXXXX 149
           +  L + ++D G P IT+   LK+                      I+            
Sbjct: 127 VTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHS 186

Query: 150 XRNATRPPVALTN---SVSWRPEGITHKKNEAFLDIVESINMLMTQKGQV-----LRSEI 201
             +     V+  N   +V WR  G+ +  NE ++D+ E++N+++ +         +   I
Sbjct: 187 SNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSI 246

Query: 202 IGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSS 261
            G+V     LS  P ++L +N  G        D  IP+                      
Sbjct: 247 DGEVGFKCYLSENPLVELDLNTNG-------HDLGIPA---------------------- 277

Query: 262 ATNKKKVNIELEDLKFHQCVRLSKFE-NEKIITFIPPDGKFDLMNYRL 308
                          FH+CVR    + +   + FIPPDG F LM Y +
Sbjct: 278 ---------------FHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 61/157 (38%), Gaps = 56/157 (35%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLR----------SEIIGDVKVNSKLSG 213
           V WR  G+ +  NE ++D+ ESI+++  + G+  R            I G   V   LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELE 273
            P + L ++  G       +D  +P+                                  
Sbjct: 271 NPTVDLQLDLAG-------NDLGVPA---------------------------------- 289

Query: 274 DLKFHQCVRLSKFENEK--IITFIPPDGKFDLMNYRL 308
              FH+CV L   +N     + FIPPDG+F+LM Y +
Sbjct: 290 ---FHECVELDNHQNPSNCDLRFIPPDGRFNLMQYSI 323

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 77/183 (42%), Gaps = 61/183 (33%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLM------TQKGQVLRSEIIGDVKVNSKLSGMPDL 217
           V WR + I   +NE ++D+ E++ + +      + + ++L   I G V V+S + G+P L
Sbjct: 173 VPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPML 232

Query: 218 KL---GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELED 274
           ++   G + K I          IP                                    
Sbjct: 233 EVSFGGCDFKDI----------IP------------------------------------ 246

Query: 275 LKFHQCVRLSKF--ENEKIITFIPPDGKFDLMNYR--LSTTIKPLIWCD-VNVQVHSNSR 329
            KFH CV +++F   +  II FIPPDGKF LM Y   LS+    LI C+  N   +SN  
Sbjct: 247 -KFHDCVEVNEFLTNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDE 305

Query: 330 IEI 332
            EI
Sbjct: 306 FEI 308

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 64/160 (40%), Gaps = 49/160 (30%)

Query: 154 TRPPVALTNSVSWRPEGITHKKNEAFLDIVESINMLMTQK---GQV--LRSEIIGDVKVN 208
            + P A    V WR  G+ +  NE ++D+VE++++++ +    G++  +R  + G V   
Sbjct: 176 AKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFR 235

Query: 209 SKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKV 268
           S LSG P + L +  +G        D  +P+                             
Sbjct: 236 SHLSGNPVIALNLRLRG-------HDLGMPA----------------------------- 259

Query: 269 NIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRL 308
                    HQC   S       + F+PPDGKF LM+Y +
Sbjct: 260 --------LHQCCLDSYQGRPDQLRFVPPDGKFQLMHYSI 291

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 62/148 (41%), Gaps = 49/148 (33%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLM--TQK-GQV--LRSEIIGDVKVNSKLSGMPDLK 218
           V WR  G+ +  NE ++D+VE+I++++  T+K GQ+  +R  I G V   S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFH 278
           L +N  G        D  +P+                                      H
Sbjct: 246 LKLNLHG-------HDLGVPA-------------------------------------LH 261

Query: 279 QCVRLSKFENEKIITFIPPDGKFDLMNY 306
            C +     + + + F+PPDGKF LM Y
Sbjct: 262 PCCQAQYTGSPENLQFVPPDGKFRLMQY 289

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 74/167 (44%), Gaps = 50/167 (29%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKG------------------QVLRSEIIGDV 205
           V WR   + +  NE ++D++E I+++  ++                   +++R++IIG++
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNK 265
            V S LS  P +++ + D+                          +D+K   + +     
Sbjct: 316 NVRSYLSDNPMVEVTLVDRNY------------------------SDQKTGWSENDLF-- 349

Query: 266 KKVNIELEDLKFHQCVRL--SKFENEKI--ITFIPPDGKFDLMNYRL 308
           K++N+ L    FH CV +   K  N+    I FIPPDGKF LM Y +
Sbjct: 350 KQLNLGLP--MFHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 58/154 (37%), Gaps = 48/154 (31%)

Query: 158 VALTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQ---VLRSEIIGDVKVNSKLSGM 214
           V    +V WR     +  NE ++D+VE++N  + QKG    ++   + G + V   LSG 
Sbjct: 134 VEAGQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGN 193

Query: 215 PDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELED 274
           P ++L +   G                             P                L++
Sbjct: 194 PTVQLKLRTSG----------------------------HP----------------LDN 209

Query: 275 LKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRL 308
              H+CV L +      + F+PPDG+F L  Y +
Sbjct: 210 SALHRCVELGE-AGVATMNFVPPDGRFTLAEYAI 242

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV      GKPLLSR++RD   D  +  +  F  L+++  +Q   +        + Y++ 
Sbjct: 5   AVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+L +N       L+  V+ +   LK + EE + D+   I    DE++ 
Sbjct: 61  PFDDYYII-LITNLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIIT 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +K ++ 
Sbjct: 120 MGYKENLSLTQIKTFLA 136

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 69/164 (42%), Gaps = 64/164 (39%)

Query: 166 WRPEGITHKKNEAFLDIVESINML----------MTQKGQVLRSEIIGDVK----VNSKL 211
           WR + + H  NE ++D+VES++++          +T+  Q ++  + G +K    V S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIE 271
           +G P ++L +   G       +D   PS                                
Sbjct: 263 NGNPLVELQLELSG-------NDIGHPS-------------------------------- 283

Query: 272 LEDLKFHQCVRLSKF----ENEKI--ITFIPPDGKFDLMNYRLS 309
                FH+CV + ++    +N  I  + FIPPDGKF LM+Y ++
Sbjct: 284 -----FHECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 67/137 (48%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++R+   D  L  +  F  L+++L  +   +      N + Y++ 
Sbjct: 5   AASITTRSGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFV----EGNHVRYVYR 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N     + L+ L + +++ L + +E  I D+   I    DEV+ 
Sbjct: 61  PFDDYYII-LITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVI 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +   +  +  Y+T
Sbjct: 120 MGYKENLSSTQVTTYLT 136

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/334 (19%), Positives = 125/334 (37%), Gaps = 73/334 (21%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKG---------------QVLRSEIIGDVKVN 208
           V WR  GI   K E ++D+ E + +   +                 +++   I G + V 
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 209 SKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKV 268
             L+G P + L  +  G       +D  IPS  A     +   ++K      S       
Sbjct: 249 CYLNGNPTVSLMFDTMG-------NDLGIPSFHACVEQEDQVQEQKQEQEPES------- 294

Query: 269 NIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRL----STTIKPLIWCDVNVQV 324
                            F+ ++++ F+PPDGKF L  Y +       +   +  D  +QV
Sbjct: 295 -----------------FQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQV 337

Query: 325 HSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD-----------DADTPTFKYSHGSLKY 373
                + ++ K + ++ R     ++ ++ PV D           D++    + +HG+   
Sbjct: 338 SFEDGLGLN-KDEFEV-RLHVRESIAVVDPVEDLVVTLQFSNGNDSNVKMLRATHGTFVG 395

Query: 374 VPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIP 433
             E     W+  S     E S      LP +    D ++ + +     L   V +++  P
Sbjct: 396 QDEDRQCSWRFDS----DEISAGT---LPVLRGCIDDSKHVQQKKRSCLT-SVAVRYGYP 447

Query: 434 YFTTSGIQVRYLKIN--EPKLQYKSYPWVRYITQ 465
               SG +V  L ++   P+++ K +  VR +T+
Sbjct: 448 GELASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 52/153 (33%)

Query: 164 VSWRPEGIT-HKKNEAFLDIVESINMLMTQKGQVLR---SEIIGDVKVNSKLSGMPDLKL 219
           V WR    + H+ NE ++D++E+ ++++ +K   LR    +I G V V S L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQ 279
            +N  G       ++  IPS                                      H+
Sbjct: 259 KLNTMG-------NEIGIPS-------------------------------------LHE 274

Query: 280 CVRL---SKFENEKIITFIPPDGKFDLMNYRLS 309
           CV +    +F    I TFIPPDGKF L+ Y ++
Sbjct: 275 CVEINDDGEFTPSNI-TFIPPDGKFRLLEYSIN 306

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 83/203 (40%), Gaps = 15/203 (7%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR++R+   +  +  +  F  L+S++          L    + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTF----LEDEHVRYVYR 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+  +N     + L+     ++ YL + +E  I DN   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVT 119

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGITHKKNEAFL 180
            G  +      ++ Y+              RN     +  T     R + I  K+ E  L
Sbjct: 120 MGYKENLSISQVETYLAMESHEERIQEIIERNK---EIEATEERKRRAKEIARKEQERKL 176

Query: 181 DI----VESINMLMTQKGQVLRS 199
            I     E+ N++   + + + S
Sbjct: 177 GIYGGEFETANLVANSQNRFMAS 199

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 61/150 (40%), Gaps = 52/150 (34%)

Query: 164 VSWRPEGIT-HKKNEAFLDIVESINMLMTQKGQVLR---SEIIGDVKVNSKLSGMPDLKL 219
           V WR    + H+ NE ++D++E+ +++   K   LR     I G V V S L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQ 279
            +N  G       +D  +P+                                      H+
Sbjct: 259 KLNTMG-------NDIGVPT-------------------------------------LHE 274

Query: 280 CVRLSKFENEKI---ITFIPPDGKFDLMNY 306
           CV + K + E +   ITFIPPDGKF L+ Y
Sbjct: 275 CVEI-KDDGEFLPSNITFIPPDGKFRLLEY 303

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 65/161 (40%), Gaps = 59/161 (36%)

Query: 164 VSWRPEGIT-HKKNEAFLDIVESINMLMTQKGQVLR---SEIIGDVKVNSKLSGMPDLKL 219
           V WR    + H+ NE ++D++E+ +++  +K   LR     I G V V S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQ 279
            +N  G       +D  IPS                                      H 
Sbjct: 259 KLNTMG-------NDIGIPS-------------------------------------LHD 274

Query: 280 CVRLSKFENEKI-----ITFIPPDGKFDLMNYR--LSTTIK 313
           CV +    N+ +     ITFIPPDGKF L+ Y   LS+ +K
Sbjct: 275 CVEI----NDGVFSPSNITFIPPDGKFRLLEYSVDLSSQVK 311

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 62/137 (45%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR++R+   D  +  +  F  L+S +      +        + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N     + L+   + ++ YL + +E  + DN   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVV 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 120 MGYKENLTAAQVSTYLS 136

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 63/158 (39%), Gaps = 50/158 (31%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKG-----QVLRSEIIGDVKVNSKLSGMPDLK 218
           V WR   + +  +E ++DI+E+++++          Q++   I G V V S LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 219 LGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFH 278
           + ++  G       ++   PS                                      H
Sbjct: 252 MDMDLAG-------NEMYAPS-------------------------------------MH 267

Query: 279 QCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLI 316
           QCV + +  +   + FIPPDG  +L+NY +   + P +
Sbjct: 268 QCVEMPQ-GSPSSLCFIPPDGNCNLLNYTIDLDMNPKV 304

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 59/149 (39%), Gaps = 50/149 (33%)

Query: 164 VSWRPEGIT-HKKNEAFLDIVESINMLMTQKGQVLR---SEIIGDVKVNSKLSGMPDLKL 219
           V WR    + H+ NE +LD++E+ +++  +K   +R     I G + V S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQ 279
            +N  G       +D  IPS                                      H+
Sbjct: 259 KLNTMG-------NDIGIPS-------------------------------------LHE 274

Query: 280 CVRL--SKFENEKIITFIPPDGKFDLMNY 306
           CV +      +   ITFIPPDGKF L+ Y
Sbjct: 275 CVEINDGGVFSPSNITFIPPDGKFRLLEY 303

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 38.9 bits (89), Expect = 0.007,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 53  NGLEY-----LFIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDN 107
           N LEY     ++ ++  LY +  ++S S N       +H+ VE +  Y   V E  I  N
Sbjct: 50  NILEYQDHKVVYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFN 109

Query: 108 FVIIYELLDEVM--DYGIPQITETKMLKQYIT 137
           F   YE+L+EV+  D  + + ++  +L+  +T
Sbjct: 110 FTKAYEILNEVLVCDGSMTETSKQAILRSVMT 141

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV     +GKPL+SR+++D   D  +  +  F  L+++   Q   +        + Y++ 
Sbjct: 5   AVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFV----EEEHVRYVYK 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N       L+   + ++ +LK   E+ I DN   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDEIIS 119

Query: 121 YG 122
            G
Sbjct: 120 LG 121

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV      GKPLLSR++RD   D     +  F  L++    Q   +        + Y++ 
Sbjct: 101 AVSIVTRQGKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRYVYK 156

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N       L    + ++ YL + +E  I +N   I    DEV+ 
Sbjct: 157 PFDDYYII-LITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVIT 215

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 216 MGYKENLSISQINTYLS 232

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 64/159 (40%), Gaps = 8/159 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR++ D   D  +  +  F  L++    +   +        + YL+ 
Sbjct: 5   AASITTRNGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYK 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ I+T+  +N     + L    + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLI-IITNRQSNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIV 119

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXRNATRPPVA 159
            G  +      ++ Y+T             RN      A
Sbjct: 120 MGYKENLTMAQVETYLTMESHEERIQEIIERNKESEATA 158

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV     +GKPLLSR++RD   D  +  +  F  L++    +   +        + Y++I
Sbjct: 5   AVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRYIYI 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N       L+   + ++  LK   EE + ++   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDEIIS 119

Query: 121 YG 122
            G
Sbjct: 120 LG 121

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 12/139 (8%)

Query: 4   AVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLE-----YL 58
           AV      GKPLLSR++R+     + D+   LLS+   Q  +      H  +E     Y+
Sbjct: 5   AVSIVTRQGKPLLSRQFRE----ISKDRVTELLSNF--QGLVAKSSSQHTFVEDEHVRYV 58

Query: 59  FIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
           +   +D Y++ ++T+  +N       L    + ++ YL + +E  I +N   I    DEV
Sbjct: 59  YKPFDDYYII-LITNRQSNIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDEV 117

Query: 119 MDYGIPQITETKMLKQYIT 137
           +  G  +      +  Y++
Sbjct: 118 ITMGYKENLSMTQINTYLS 136

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 56/122 (45%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++RD   D  +  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRHGKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N     + L+   + ++  L   +E  I DN   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDEIVV 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 62/137 (45%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR++R+   D  L  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRTGKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFV----EDEHVRYVYR 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N     + L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVV 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 120 MGYKENLSITQVNTYLS 136

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 3/36 (8%)

Query: 277 FHQCV-RLSKFENEKI--ITFIPPDGKFDLMNYRLS 309
           FH CV + S  + EKI  ++FIPPDG+F LM Y ++
Sbjct: 314 FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV     +GKPLLSR++RD   D     +  F  L+++   Q   +        + Y++ 
Sbjct: 5   AVSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVANSSSQHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N       L+   + ++  L++ +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDEIIA 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 56/122 (45%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L+S++      +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFV----EDKHVRYVYR 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+  +N       L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L++++      +        + Y++ 
Sbjct: 58  AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFV----EDKHVRYVYR 113

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+  +N     + L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 114 PFDNYYII-LITNRQSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 172

Query: 121 YG 122
            G
Sbjct: 173 MG 174

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 56/122 (45%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L+S++      +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYR 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+  +N       L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 50  LNHNGLEYLFIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFV 109
           L +N  + ++ ++  LY V  V+    N       +H+ VE +  Y   V E  I  NF 
Sbjct: 52  LEYNDHKVVYKRYASLYFVCGVSPDKDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFN 111

Query: 110 IIYELLDEVM--DYGIPQITETKMLKQ 134
             Y +LDEV+  D  I + ++ ++LK 
Sbjct: 112 KAYSILDEVLICDGSITETSKKEVLKH 138

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 61/134 (45%), Gaps = 22/134 (16%)

Query: 12  GKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNH-----NGLEY-----LFIQ 61
           GK  L++ Y    PLS  +K  I+        NL+P  L+      N LEY      + +
Sbjct: 14  GKIRLTKWYA---PLSPKEKAKII-------KNLVPLILSRKAKMCNILEYSDHKVAYRR 63

Query: 62  HNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM-- 119
           +  LY +  +T    N       +HK VE +  Y   V E  I  NF   Y++L+E++  
Sbjct: 64  YASLYFICGITPDVDNELLTLEIIHKYVETMDQYFGNVCELDIIYNFTKAYDILNEMIMC 123

Query: 120 DYGIPQITETKMLK 133
           D  + + ++T +LK
Sbjct: 124 DGSLAETSKTVVLK 137

>TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.388
           YLR170C
          Length = 156

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 20/120 (16%)

Query: 10  HNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNH-----NGLEY-----LF 59
             GK  L + Y   IPL+  +K  IL        NL    L+      N +EY     ++
Sbjct: 12  RQGKIRLMKWY---IPLTQKEKAKIL-------RNLTTTILSRKPKMCNIVEYSDHKVVY 61

Query: 60  IQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
            ++  LY +  +T+   N   I   +H+ VE +  Y   V E  I  NF   Y++LDE++
Sbjct: 62  RRYASLYFICGITAEVDNELLILEVIHRYVEAMDSYFGNVCELDIIFNFSKAYDILDEMI 121

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 56/150 (37%), Gaps = 49/150 (32%)

Query: 164 VSWRPEGITHKKNEAFLDIVESINMLMTQKG----QVLRSEIIGDVKVNSKLSGMPDLKL 219
           V WR   +++  NE ++D+VE++ + + Q       V    I G + +   L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQ 279
            ++  G   K        PSA                                     H+
Sbjct: 255 NLHSAGHAFK--------PSA------------------------------------LHR 270

Query: 280 CVR-LSKFENEKIITFIPPDGKFDLMNYRL 308
           C+   S   +   + FIPPDGKF L+ Y +
Sbjct: 271 CLDPSSSSFDSSSLRFIPPDGKFTLLEYTI 300

>CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170c APS1 Clathrin coat assembly protein AP19
          Length = 156

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 20/119 (16%)

Query: 11  NGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNH-----NGLEY-----LFI 60
            GK  LS+ Y    PLS  +K  I+        +L P  L       N LEY     +F 
Sbjct: 13  QGKVRLSKWYA---PLSTKEKAKII-------KDLTPTILARKPKMCNILEYSDHKVVFR 62

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           ++  LY +  +T    N       +H+ VE +  Y + V E  I  NF   Y++LDE++
Sbjct: 63  RYASLYFICGITIGHDNELLTLELIHRYVETMDTYFENVCELDIIFNFHKAYDILDELV 121

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 63/137 (45%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR++ +   D  +  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFVEMSKDRVMELLSNFQGLVANISSDHTYVED----EHVRYVYK 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+  +N     + L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLI-LMTNRQSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEIIV 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +    + +  YI+
Sbjct: 120 MGHKENLTIQQVNNYIS 136

>ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 4/87 (4%)

Query: 33  PILLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVL 92
           P++LS   +  N++     ++  + ++ ++  LY +  +T  + N       +H+ VE +
Sbjct: 39  PLILSRKPKMCNIV----EYSDHKVVYRRYASLYFICGITPEADNELLTLEIIHRYVETM 94

Query: 93  SDYLKTVEEESIRDNFVIIYELLDEVM 119
             Y   V E  I  NF   Y +LDE++
Sbjct: 95  DTYFGNVCELDIIFNFGKAYAILDEML 121

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 55/122 (45%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVED----KHVRYVYR 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+  +N       L+   + ++ YL +  ++ I  N   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query: 30  DKFPILLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYVVAIVTSLSANAAAIFTFLHKLV 89
           D  P++LS   +  N++     ++  + ++ ++  LY +  +T    N       +H+ V
Sbjct: 36  DLTPLVLSRKAKMCNIVE----YSDHKVVYRRYASLYFICGITPEYDNELLTLELIHRYV 91

Query: 90  EVLSDYLKTVEEESIRDNFVIIYELLDEVM--DYGIPQITETKMLKQ 134
           E +  Y   V E  I  NF   YE+L+E++  D  I +  + ++L+Q
Sbjct: 92  ETMDSYFGNVCELDIIFNFSRAYEILNEMIMCDGSIAESGKAEVLQQ 138

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 269 NIELEDLKFHQCVRLSKF----ENEKIITFIPPDGKFDLMNYRLS 309
             +L     H CV L        +   + FIPPDGKF LM Y ++
Sbjct: 279 GCDLGTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>ZYRO0E03102g Chr5 complement(240333..243686) [3354 bp, 1117 aa]
           {ON} weakly similar to uniprot|P47107 Saccharomyces
           cerevisiae YJR039W Hypothetical ORF
          Length = 1117

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 18/124 (14%)

Query: 158 VALTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSK--LSGMP 215
           +A  N +SWR                 S+ +L+T     L    I +VK+ +K  +    
Sbjct: 576 IACMNVISWRG----------------SLRLLITDIDGKLCELDIKNVKICTKHKIGAQR 619

Query: 216 DLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDL 275
                + D+G F  Y  DD  + S++ T     T  D K  I+  +A +   ++I  +D 
Sbjct: 620 AEICAVTDRGFFLIYTRDDLLLLSSTETGKFELTRIDMKTRISKIAAKDGSAISILDDDS 679

Query: 276 KFHQ 279
           K HQ
Sbjct: 680 KIHQ 683

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 63/156 (40%), Gaps = 40/156 (25%)

Query: 164 VSWRPEGITHKKNEAFLDIVESI-----NMLMTQKGQVLRSEIIGDVKVN--SKLSGMPD 216
           V WR   I + KNE ++D+ E I     N +  +KG+   +     ++VN  S +  M  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 217 LKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLK 276
              G+ D      YL+ +  I      T  N+  T   PS+                   
Sbjct: 319 YITGVID---VRSYLNGNP-IVEMKLNTCGNDMGT---PSL------------------- 352

Query: 277 FHQCVRLS---KFENEKI---ITFIPPDGKFDLMNY 306
            H CV L      +++K+   + FIPPDGKF L  Y
Sbjct: 353 -HPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>CAGL0D04510g Chr4 (440080..447522) [7443 bp, 2480 aa] {ON} similar
           to uniprot|Q06116 Saccharomyces cerevisiae YPR117w
          Length = 2480

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 382 WKIRSFPGGK-EYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGI 440
           +++  FP    EYS S       +SN ED N ++    A I    V  +  IP  T   +
Sbjct: 421 FRMDKFPSFTLEYSFSNFTSTIGLSNEEDLNLSLFNVQAIICHSSVVDELSIPEMTLEKV 480

Query: 441 QVRYLKINEPKLQYKSY 457
           Q  ++K + PK ++ +Y
Sbjct: 481 QWSFIKSSSPKKEFSNY 497

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 8/123 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR+++D   D  L  +  F  L+S L+  SN      +H  + Y++ 
Sbjct: 5   AASITTSNGKPLLSRQFKDLSRDRVLELLSNFQNLVS-LKHSSNHTFVEDDH--VRYVYK 61

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKT-VEEESIRDNFVIIYELLDEVM 119
             +D Y++ ++T+  +N     + L+   + ++ +L    ++  I +    I    DE++
Sbjct: 62  PFDDFYII-LITNRQSNIVQDLSTLNLFSQTINAFLNNQFDQYEIYNKAFEILSSFDEIV 120

Query: 120 DYG 122
             G
Sbjct: 121 SMG 123

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++ +   D  +  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRSGKPLLSRQFTEITKDRVMELLSNFQGLVANISSDHTYVES----EHVRYVYK 60

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ +VT+  +N     + L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLI-LVTNRQSNIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSSFDEIIV 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>KNAG0B02980 Chr2 (576330..577196) [867 bp, 288 aa] {ON} Anc_7.277
           YER083C
          Length = 288

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%)

Query: 210 KLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVN 269
           K++G  D  L         K +   TN+  A+A + D   +    P++TS + T +K  N
Sbjct: 32  KITGQADSHLSTTSPLENEKKVTPTTNLGGATAFSEDAGKKQFSSPTVTSDTTTEEKDRN 91

Query: 270 IELEDLK 276
           IE+E LK
Sbjct: 92  IEVELLK 98

>KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly
           similar to uniprot|Q00381 Saccharomyces cerevisiae
           YJR058C APS2 Small subunit of the clathrin- associated
           adaptor complex AP-2 which is involved in protein
           sorting at the plasma membrane related to the sigma
           subunit of the mammalian plasma membrane clathrin-
           associated protein (AP-2) complex
          Length = 148

 Score = 31.6 bits (70), Expect = 2.2,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 26/54 (48%)

Query: 85  LHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIPQITETKMLKQYITQ 138
           +H  VEVL  +   V E  I  NF   Y ++DE+   G  Q T  K L + I Q
Sbjct: 90  IHLFVEVLDSFFGNVCELDILFNFYKTYLVMDEMFIAGEIQTTSKKELLERIGQ 143

>KLLA0F22814g Chr6 complement(2119266..2119736) [471 bp, 156 aa]
           {ON} highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 53  NGLEY-----LFIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDN 107
           N LEY     ++ ++  LY +A +   S N       +H+ VE +  Y   V E  I  N
Sbjct: 50  NILEYQDHKVVYKKYASLYFIAGIDLDSDNELLTLEIIHRFVETMDRYFGNVCELDIIFN 109

Query: 108 FVIIYELLDEVM 119
           F   Y +LDE++
Sbjct: 110 FSKAYSILDEMI 121

>YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}
           APS1Small subunit of the clathrin-associated adaptor
           complex AP-1, which is involved in protein sorting at
           the trans-Golgi network; homolog of the sigma subunit of
           the mammalian clathrin AP-1 complex
          Length = 156

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 30  DKFPILLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYVVAIVTSLSANAAAIFTFLHKLV 89
           D  P +L+   +  N+I     +N  + ++ ++  LY +  +T    N       +H+ V
Sbjct: 36  DLTPTILARKPKMCNIIE----YNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFV 91

Query: 90  EVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           E +  Y   V E  I  NF  +Y++L+E++
Sbjct: 92  ETMDTYFGNVCELDIIFNFSKVYDILNEMI 121

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 12/116 (10%)

Query: 12  GKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLE-----YLFIQHNDLY 66
           GKPLLSR++++      I+    LLS+   Q  +     +H  +E     Y++   +D Y
Sbjct: 13  GKPLLSRQFKELTKERVIE----LLSNF--QGLVSKSSSDHTYVEDEHVRYVYRPFDDYY 66

Query: 67  VVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYG 122
           ++ +VT+  +N     + L+   + ++ YL + +EE I  N   I    DE++  G
Sbjct: 67  LI-LVTNRQSNIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEIIVMG 121

>AGL161C Chr7 complement(394886..397198) [2313 bp, 770 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR144C
           (ACF2)
          Length = 770

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 200 EIIGDVKVNSKLSGMPDLKLGINDKGI--FSKYLDDDTNIPSA 240
           ++ G V  NSKL+G+ DL +GI    +  +  YLDD+  +P+A
Sbjct: 613 KLWGQVTNNSKLAGIGDLMIGILRTSLNHYFLYLDDNRTMPAA 655

>NCAS0F02430 Chr6 (480483..483071) [2589 bp, 862 aa] {ON} Anc_5.285
           YHR047C
          Length = 862

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 371 LKYVPEKSAILWKIRSFPGGKEYS-----MSAELGLPSISNNEDGNRTMPKSNAEILKGP 425
            KY   K+  LW+  S   GK+ S      + ++G P I+  EDGN+     N  +  G 
Sbjct: 422 FKYGNAKTEDLWEALSVASGKDVSAVMNIWTKKVGFPVITVKEDGNKITLTQNRYLSTGD 481

Query: 426 VQ 427
           V+
Sbjct: 482 VK 483

>NCAS0A08790 Chr1 (1739972..1740442) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 22/134 (16%)

Query: 12  GKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNH-----NGLEY-----LFIQ 61
           GK  L++ Y    PLS  +K  I+        NL P  L+      N LEY      + +
Sbjct: 14  GKVRLAKWY---TPLSPKEKNKII-------KNLTPLILSRKPKMCNILEYSDHKVAYRR 63

Query: 62  HNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM-- 119
           +  LY +  +T    N       +H+ VE +  Y   V E  I  +F   Y++L+E++  
Sbjct: 64  YASLYFICGITPEVDNELLTLEVIHRYVETMDSYFGNVCELDIIFHFTKAYDILNELIMC 123

Query: 120 DYGIPQITETKMLK 133
           D  + + ++ ++LK
Sbjct: 124 DGSLAETSKKEILK 137

>TPHA0B03570 Chr2 complement(834660..835130) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 58  LFIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
           ++ ++  LY +  ++  S N       +H+ VE +  Y   V E  I  NF   Y +LDE
Sbjct: 60  VYRRYASLYFICGISQNSDNELLTLEIVHRYVETMDTYFGNVCELDIIFNFEKAYNILDE 119

Query: 118 VM--DYGIPQITETKML 132
           ++  D  I + +++ +L
Sbjct: 120 MIMCDGSITETSKSNVL 136

>Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 53  NGLEY-----LFIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDN 107
           N +EY     ++ ++  L+ +  VTS   N       +H+ VE +  Y   V E  I  N
Sbjct: 50  NIIEYSDHKVVYKRYASLFFIVGVTSDVDNELLTLEVIHRFVETMDTYFGNVCELDIIFN 109

Query: 108 FVIIYELLDEVM 119
           F  +Y++L+E++
Sbjct: 110 FNKVYDILNEMI 121

>TBLA0C06990 Chr3 complement(1686545..1688080) [1536 bp, 511 aa]
           {ON} Anc_5.21 YMR300C
          Length = 511

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 328 SRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFK 365
           +RIE+  K    IK K +   ++++IPVPD A T   +
Sbjct: 281 TRIEMGTKLAENIKSKMSPDEIDVVIPVPDTARTCALQ 318

>AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR170C (APS1)
          Length = 156

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM- 119
           ++  L+ V  ++    N       +H+ VE +  Y   V E  I  NF   Y +LDE++ 
Sbjct: 63  RYASLFFVCGISPEEDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFTRAYNILDELIM 122

Query: 120 -DYGIPQITETKMLKQYIT 137
            D    + ++T +LK   T
Sbjct: 123 CDGSFVESSKTDVLKNMAT 141

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,316,333
Number of extensions: 2381936
Number of successful extensions: 11696
Number of sequences better than 10.0: 180
Number of HSP's gapped: 11893
Number of HSP's successfully gapped: 243
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)