Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR380W (RDR1)na 1ON54654627980.0
Skud_15.546na 1ON54254624170.0
Suva_8.436na 1ON54554623840.0
Smik_15.561na 1ON54654722120.0
Kwal_23.6537na 1ON55255415810.0
KLTH0C10516gna 1ON56155815390.0
KLTH0D07898g2.565ON6723721795e-13
SAKL0A02860g6.279ON7453721502e-09
Smik_5.9singletonOFF56481286e-09
Smik_10.251.128ON7723621412e-08
Skud_10.101.128ON8333861403e-08
KAFR0F014901.128ON6583471384e-08
KNAG0M021202.565ON6083441375e-08
SAKL0D13464g2.565ON6873741332e-07
KNAG0C059804.113ON968641332e-07
ZYRO0E06270g2.565ON912421322e-07
KLLA0F04609g2.231ON916401323e-07
TPHA0F008304.113ON1192871314e-07
ZYRO0G10252g4.113ON1036451305e-07
Skud_2.1064.113ON1010631296e-07
Kpol_1039.112.231ON992441296e-07
YBL005W (PDR3)4.113ON976711289e-07
TDEL0C044802.231ON852481271e-06
CAGL0A00451g4.113ON1107571261e-06
Kwal_23.47542.231ON812401261e-06
KLTH0G09108g2.231ON782401252e-06
TBLA0G026102.231ON1000371252e-06
TPHA0F013802.231ON890371252e-06
SAKL0B06732gna 2ON878501242e-06
KAFR0J017102.231ON848371242e-06
YIL130W (ASG1)2.231ON964371242e-06
NCAS0B065502.231ON906371242e-06
Suva_9.592.231ON926371242e-06
Smik_9.392.231ON1012371242e-06
Skud_9.372.231ON954371243e-06
NDAI0B038502.231ON930371243e-06
SAKL0E08998g2.231ON823481233e-06
KNAG0I005601.128ON663401224e-06
NCAS0A035804.113ON1113551234e-06
KNAG0E017602.231ON902371224e-06
KLTH0E05786gna 3ON8171631215e-06
KLLA0A02585gna 4ON370621196e-06
SAKL0C03938g1.128ON780371207e-06
Kpol_1033.158.283ON5943831199e-06
CAGL0G08844g2.231ON847451181e-05
SAKL0H24860gna 5ON971861181e-05
KLLA0C03201g1.128ON650511181e-05
YJL206C1.128ON7583811171e-05
KAFR0F034104.113ON995361172e-05
SAKL0H22374g4.121ON6402891162e-05
Suva_2.1214.113ON971371162e-05
AER370W2.231ON801431162e-05
Smik_11.2402.654ON976711162e-05
Kwal_47.175654.121ON6281111152e-05
NDAI0D035504.113ON1118581153e-05
ZYRO0D06688g8.283ON5953731143e-05
NCAS0A127202.565ON7594141153e-05
TPHA0C010808.283ON5913611143e-05
KAFR0C03730singletonON791371144e-05
Kwal_27.102328.845ON1209491144e-05
YKL015W (PUT3)2.654ON979631144e-05
Ecym_27321.380ON1198531144e-05
Smik_2.1154.113ON971371144e-05
TBLA0A007302.654ON1037441135e-05
Smik_7.2774.113ON1069841135e-05
ZYRO0G22550gsingletonON724881135e-05
KLTH0E08140g4.121ON6321951126e-05
KNAG0H002502.654ON896381126e-05
CAGL0L03377g1.277ON1209431126e-05
Ecym_53972.231ON826371126e-05
KLTH0C03762g8.845ON1206491127e-05
SAKL0B04620gna 4ON362511107e-05
KAFR0A021302.565ON707431118e-05
SAKL0D01100g4.113ON940591118e-05
KNAG0D035204.113ON1030361118e-05
YGL013C (PDR1)4.113ON1068361118e-05
Skud_7.2744.113ON1080361119e-05
KLTH0B09262gsingletonON820491119e-05
Ecym_7440na 2ON898491101e-04
Ecym_46168.845ON1577531101e-04
SAKL0G19470g2.654ON831421091e-04
NDAI0A034204.113ON1108361092e-04
KLLA0F22990g1.380ON1253561092e-04
KLTH0E00440gsingletonON688281082e-04
KLTH0B10076gsingletonON688281082e-04
NDAI0D034804.121ON7081031082e-04
Ecym_72354.113ON943371082e-04
KAFR0B028208.283ON664301082e-04
KLTH0C00814g2.654ON834411082e-04
Kwal_14.9152.654ON822501082e-04
TDEL0F023304.113ON1086431072e-04
KLTH0E07854g4.113ON938701072e-04
ZYRO0G14278g8.845ON1250491073e-04
Suva_7.2684.113ON1000361073e-04
KNAG0C011601.199ON835521063e-04
Kwal_47.175064.113ON924441063e-04
ZYRO0D02090g1.199ON842971063e-04
TDEL0C056801.128ON691451063e-04
KLLA0A09119g4.113ON1082361063e-04
TDEL0D00260singletonON647531063e-04
Skud_11.2142.654ON981671063e-04
Suva_13.4688.845ON1418461063e-04
TBLA0C040504.113ON1207771063e-04
Suva_11.2132.654ON985591064e-04
KAFR0B039508.845ON1246461064e-04
ZYRO0C18150g1.128ON571411054e-04
Smik_13.4938.845ON1433461064e-04
Skud_13.4528.845ON1432461054e-04
YMR280C (CAT8)8.845ON1433461054e-04
NCAS0A016304.113ON1043341054e-04
NDAI0B015402.565ON803671054e-04
NCAS0A03570na 6ON978451055e-04
Suva_13.1862.565ON894711055e-04
KLTH0E14454gna 2ON9021201055e-04
NDAI0D03540na 6ON1107421046e-04
KLLA0D10153gsingletonON655731046e-04
Suva_6.2851.128ON786541037e-04
TBLA0G005206.61ON878661037e-04
YMR019W (STB4)2.565ON949571038e-04
NCAS0A088401.380ON1478521039e-04
SAKL0C00242gna 3ON833501029e-04
KLLA0E18129g2.654ON865451020.001
Skud_13.1732.565ON920361020.001
AER183Cna 2ON879361020.001
KLTH0G13200g8.283ON566281010.001
TBLA0A012101.380ON1422421020.001
CAGL0F09229gna 3ON835491010.001
Kpol_1061.424.113ON1129361010.001
KLLA0C17050gna 5ON955471010.001
TDEL0B005308.845ON1301461010.001
TBLA0C062306.60ON795631010.001
SAKL0D01342g8.845ON1270371010.001
NCAS0H034202.654ON902391010.001
ACL058Wna 5ON817451000.002
Kpol_1061.261.380ON1274531010.002
KLLA0C14212gna 7ON1040371000.002
CAGL0M05907g1.199ON891881000.002
KNAG0G021308.283ON6323681000.002
Skud_5.331singletonON17039950.002
ZYRO0B14476gna 8ON70761990.002
AFL160C6.279ON648396990.002
ABL121C8.845ON128537990.002
TPHA0B036301.380ON142942990.002
TBLA0G005106.60ON93563990.002
Kwal_47.16939na 8ON66960990.002
YLR256W (HAP1)1.380ON150251990.002
NDAI0G052601.380ON158148990.003
Skud_12.3351.380ON147951990.003
Smik_12.3271.380ON150351990.003
Kwal_47.17233na 5ON94863980.003
AFR117C1.380ON115253980.003
Smik_13.1832.565ON91136980.003
KLLA0D01452g8.845ON144537980.003
KLLA0C18953gna 9ON703101970.004
NDAI0K003908.845ON149538980.004
TDEL0B062601.380ON124745970.004
KLLA0F09559gsingletonON65888970.004
AGL206Cna 10ON73567970.004
Kpol_467.11.380ON128949970.004
NDAI0A03410na 6ON98037970.004
Ecym_8404na 5ON88545970.004
KNAG0I014501.380ON147649970.004
Kwal_YGOB_0.1391.380ON124048970.004
Suva_10.3511.380ON32451950.004
TBLA0J003708.642ON47142960.005
Ecym_33922.654ON84740960.005
SAKL0D07898g1.380ON124448960.005
YBR297W (MAL33)na 11ON46833960.005
KAFR0G005701.199ON86269960.005
Smik_2.438na 11ON46933950.005
NCAS0C047803.109ON91470960.005
CAGL0B03421g1.380ON135550960.006
KLTH0E06666gna 5ON94640960.006
ZYRO0E05412g1.380ON124448960.006
SAKL0H00660gsingletonON91239950.006
TBLA0E019007.56ON84046950.006
Kwal_0.142singletonOFF62948950.006
KLLA0A06039g1.199ON65751950.006
KAFR0A066904.113ON99742950.007
KLTH0C10032g3.109ON86682950.007
TPHA0L003505.525ON859239950.007
Skud_7.627na 12ON47487940.008
KLTH0E16500g8.879ON83373950.008
NCAS0D04860singletonON70159940.008
Suva_16.25singletonON14334890.008
YER184Cna 3ON79441940.009
ZYRO0C00726g7.17ON1035108940.009
NCAS0C003908.845ON116437940.009
KLLA0F19602g8.283ON60342940.009
TBLA0E007007.17ON127449940.009
CAGL0F02519g1.128ON83243940.010
Suva_15.773.109ON1029105940.010
SAKL0D14542gna 13ON946148940.010
SAKL0H00682gna 7ON92257940.010
KLLA0C19228gsingletonON59134930.010
TBLA0C011201.380ON148642940.011
Ecym_42868.283ON627119930.011
TPHA0N002307.17ON123249930.011
TPHA0O006001.380ON137245930.011
CAGL0I07755g3.109ON1053100930.011
KAFR0I020301.380ON123347930.012
NCAS0G011006.279ON935179930.012
ZYRO0E00572g2.654ON83881930.012
KLTH0H11572g1.380ON123745930.014
KLTH0H00968g7.360ON62349920.014
YKR064W (OAF3)1.199ON86373920.014
KAFR0C039002.654ON81839920.014
ZYRO0G00308gsingletonON64927920.014
CAGL0K05841g1.380ON137241930.015
CAGL0M03025g8.845ON125437920.015
Skud_7.638singletonON47361920.015
KAFR0C013203.109ON100640920.015
SAKL0A00704gna 14ON71851920.015
Suva_8.2256.61ON80163920.016
TDEL0D00820na 8ON68583920.016
Skud_11.3001.199ON865109920.018
TPHA0H012405.59ON87742920.018
AGR061C8.283ON61237910.018
KLTH0B00352gsingletonON93471910.020
Suva_11.2991.199ON88932910.020
TBLA0C020601.199ON98456910.021
Smik_12.1578.283ON64440910.022
KNAG0M00120singletonON88139910.022
Smik_26.8singletonON11737840.022
YLR266C (PDR8)6.60ON70140900.023
NCAS0C051002.651ON1019197910.024
TBLA0E034803.109ON104643900.025
CAGL0L09691g2.654ON82433900.025
Kpol_1059.268.642ON42048890.025
Skud_3.181singletonON83160900.027
Smik_1.137.17ON104645900.027
TDEL0H007901.199ON82740900.028
NCAS0E023107.56ON71834900.028
Smik_11.3261.199ON86557900.029
TDEL0B074902.654ON86532900.029
AGL233Cna 14ON87232900.030
Skud_14.399na 15ON60728890.030
Skud_15.643.109ON1032105900.031
TBLA0H006808.423ON880106900.031
KLTH0C10098g6.60ON77152890.032
Ecym_22636.154ON50842890.034
NCAS0A076107.17ON102254890.034
TDEL0A02690singletonON72281890.035
SAKL0G02992gna 16ON106159890.035
NDAI0A010401.199ON99549890.037
NDAI0I007406.279ON1033254890.037
KLLA0A03443g7.17ON97538890.039
KNAG0B051205.235ON88897890.040
KLTH0F03014gsingletonON61238880.040
NDAI0E038507.56ON76843880.041
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR380W
         (546 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...  1082   0.0  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...   935   0.0  
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...   922   0.0  
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...   856   0.0  
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...   613   0.0  
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...   597   0.0  
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    74   5e-13
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    62   2e-09
Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)...    54   6e-09
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    59   2e-08
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    59   3e-08
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    58   4e-08
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    57   5e-08
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    56   2e-07
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    56   2e-07
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    55   2e-07
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    55   3e-07
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    55   4e-07
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    55   5e-07
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    54   6e-07
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    54   6e-07
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    54   9e-07
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    54   1e-06
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    53   1e-06
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    53   1e-06
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    53   2e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    53   2e-06
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    53   2e-06
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    52   2e-06
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    52   2e-06
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    52   2e-06
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    52   2e-06
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    52   2e-06
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    52   2e-06
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    52   3e-06
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    52   3e-06
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    52   3e-06
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    52   4e-06
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    52   4e-06
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    52   4e-06
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    51   5e-06
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    50   6e-06
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    51   7e-06
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    50   9e-06
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    50   1e-05
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    50   1e-05
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    50   1e-05
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    50   1e-05
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    50   2e-05
SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON} cons...    49   2e-05
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    49   2e-05
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    49   2e-05
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    49   2e-05
Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [conti...    49   2e-05
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    49   3e-05
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    49   3e-05
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    49   3e-05
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    49   3e-05
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               49   4e-05
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...    49   4e-05
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    49   4e-05
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    49   4e-05
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    49   4e-05
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    48   5e-05
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    48   5e-05
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    48   5e-05
KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conser...    48   6e-05
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    48   6e-05
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    48   6e-05
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    48   6e-05
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...    48   7e-05
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    47   7e-05
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    47   8e-05
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    47   8e-05
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    47   8e-05
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    47   8e-05
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    47   9e-05
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    47   9e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    47   1e-04
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...    47   1e-04
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    47   1e-04
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    47   2e-04
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    47   2e-04
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    46   2e-04
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    46   2e-04
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    46   2e-04
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    46   2e-04
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    46   2e-04
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    46   2e-04
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    46   2e-04
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    46   2e-04
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    46   2e-04
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...    46   3e-04
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    46   3e-04
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    45   3e-04
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    45   3e-04
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    45   3e-04
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    45   3e-04
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    45   3e-04
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       45   3e-04
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    45   3e-04
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    45   3e-04
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   3e-04
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    45   4e-04
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...    45   4e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    45   4e-04
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...    45   4e-04
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...    45   4e-04
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...    45   4e-04
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    45   4e-04
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    45   4e-04
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    45   5e-04
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    45   5e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    45   5e-04
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    45   6e-04
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    45   6e-04
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    44   7e-04
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    44   7e-04
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    44   8e-04
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    44   9e-04
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    44   9e-04
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    44   0.001
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    44   0.001
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    44   0.001
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    44   0.001
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    44   0.001
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    44   0.001
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    44   0.001
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    44   0.001
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...    44   0.001
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.001
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...    44   0.001
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    44   0.001
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    43   0.002
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    44   0.002
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    43   0.002
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    43   0.002
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    43   0.002
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    41   0.002
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    43   0.002
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    43   0.002
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...    43   0.002
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    43   0.002
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    43   0.002
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    43   0.002
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    43   0.002
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    43   0.003
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    43   0.003
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    43   0.003
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    42   0.003
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    42   0.003
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    42   0.003
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    42   0.003
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    42   0.004
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845     42   0.004
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    42   0.004
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    42   0.004
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    42   0.004
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    42   0.004
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    42   0.004
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    42   0.004
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              42   0.004
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    42   0.004
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    41   0.004
TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON...    42   0.005
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    42   0.005
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    42   0.005
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    42   0.005
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    42   0.005
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    41   0.005
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               42   0.005
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    42   0.006
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    42   0.006
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    42   0.006
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    41   0.006
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    41   0.006
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    41   0.006
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.006
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    41   0.007
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    41   0.007
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}      41   0.007
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    41   0.008
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    41   0.008
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               41   0.008
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    39   0.008
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    41   0.009
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    41   0.009
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845      41   0.009
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    41   0.009
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    41   0.009
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    41   0.010
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    41   0.010
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    41   0.010
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    41   0.010
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    40   0.010
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    41   0.011
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    40   0.011
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    40   0.011
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    40   0.011
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    40   0.011
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    40   0.012
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    40   0.012
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    40   0.012
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    40   0.014
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    40   0.014
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    40   0.014
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    40   0.014
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    40   0.014
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    40   0.015
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    40   0.015
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    40   0.015
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    40   0.015
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    40   0.015
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    40   0.016
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               40   0.016
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    40   0.018
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    40   0.018
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    40   0.018
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    40   0.020
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    40   0.020
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    40   0.021
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    40   0.022
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      40   0.022
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      37   0.022
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    39   0.023
NCAS0C05100 Chr3 complement(1038084..1041143) [3060 bp, 1019 aa]...    40   0.024
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    39   0.025
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    39   0.025
Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa] {O...    39   0.025
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    39   0.027
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    39   0.027
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    39   0.028
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      39   0.028
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    39   0.029
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    39   0.029
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    39   0.030
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    39   0.030
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    39   0.031
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    39   0.031
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    39   0.032
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    39   0.034
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    39   0.034
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               39   0.035
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    39   0.035
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    39   0.037
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    39   0.037
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    39   0.039
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               39   0.040
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    39   0.040
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      39   0.041
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    39   0.041
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    39   0.042
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    39   0.043
KLTH0D10428g Chr4 (861135..862196) [1062 bp, 353 aa] {ON} simila...    38   0.044
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    39   0.045
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    39   0.046
Suva_15.245 Chr15 complement(416757..419414) [2658 bp, 885 aa] {...    39   0.046
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    39   0.047
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    39   0.048
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    39   0.049
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    39   0.050
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    38   0.051
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    39   0.052
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    39   0.053
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    39   0.054
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    38   0.055
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    38   0.055
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    38   0.056
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    38   0.057
ZYRO0G10450g Chr7 (842921..844840) [1920 bp, 639 aa] {ON} conser...    38   0.057
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    38   0.058
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    38   0.058
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    38   0.059
Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON} ...    38   0.062
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    38   0.064
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    38   0.067
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    38   0.069
Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON...    38   0.069
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    38   0.071
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    38   0.073
YHR056C Chr8 complement(215183..217834) [2652 bp, 883 aa] {ON}  ...    38   0.082
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    38   0.082
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    38   0.082
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    37   0.082
Skud_8.113 Chr8 complement(188347..190992) [2646 bp, 881 aa] {ON...    38   0.085
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    38   0.085
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    37   0.087
Skud_2.371 Chr2 complement(667091..668680) [1590 bp, 529 aa] {ON...    37   0.091
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    38   0.092
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    37   0.092
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    37   0.094
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    37   0.095
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    37   0.097
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    37   0.097
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    37   0.10 
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    37   0.10 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    37   0.10 
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    37   0.10 
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    37   0.11 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    37   0.11 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               37   0.11 
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    37   0.11 
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    37   0.12 
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    37   0.12 
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    37   0.12 
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    37   0.12 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    37   0.12 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    37   0.12 
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    37   0.13 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    37   0.13 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    37   0.13 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    37   0.13 
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    37   0.13 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    37   0.14 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    37   0.14 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    37   0.14 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.14 
Kwal_26.8662 s26 (888487..889554) [1068 bp, 355 aa] {ON} YPL133C...    37   0.14 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    37   0.15 
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    37   0.15 
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    37   0.16 
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    37   0.16 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    37   0.17 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    37   0.17 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    37   0.17 
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    37   0.17 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    37   0.17 
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    37   0.17 
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    37   0.18 
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    37   0.18 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                37   0.18 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    37   0.18 
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    37   0.18 
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    37   0.18 
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    37   0.18 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    37   0.18 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    36   0.19 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    37   0.19 
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    37   0.19 
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    37   0.19 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    37   0.20 
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    37   0.20 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    37   0.20 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.20 
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    37   0.20 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    36   0.21 
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    37   0.21 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    36   0.22 
CAGL0A00583g Chr1 (65286..67226) [1941 bp, 646 aa] {ON} weakly s...    36   0.22 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    36   0.22 
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      36   0.22 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    36   0.23 
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    36   0.23 
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    36   0.23 
Kwal_26.8200 s26 (688203..690161) [1959 bp, 652 aa] {ON} YMR019W...    36   0.24 
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    36   0.25 
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    36   0.25 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    36   0.26 
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    36   0.26 
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    36   0.26 
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    36   0.26 
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    36   0.27 
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    36   0.27 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    36   0.27 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    36   0.29 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    36   0.29 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    36   0.30 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    36   0.30 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    35   0.31 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    36   0.31 
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...    36   0.31 
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    36   0.32 
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    35   0.33 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    36   0.33 
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    36   0.34 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    36   0.35 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    36   0.36 
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    36   0.36 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    36   0.36 
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    36   0.36 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    35   0.39 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    35   0.39 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    35   0.39 
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    35   0.39 
Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar t...    35   0.39 
TPHA0F03260 Chr6 (709472..710887) [1416 bp, 471 aa] {ON} Anc_8.6...    35   0.39 
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    35   0.40 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   0.41 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    35   0.42 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    35   0.42 
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    35   0.43 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    35   0.43 
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...    35   0.43 
SAKL0H07370g Chr8 complement(641801..642982) [1182 bp, 393 aa] {...    35   0.43 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    35   0.45 
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    35   0.46 
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    35   0.46 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    35   0.47 
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    35   0.48 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    35   0.50 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    35   0.50 
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    35   0.51 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    35   0.51 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    35   0.52 
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    35   0.54 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    35   0.56 
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    35   0.57 
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    35   0.58 
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    35   0.61 
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    35   0.61 
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    35   0.62 
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    35   0.63 
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    35   0.64 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    35   0.67 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    35   0.68 
TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {O...    35   0.68 
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     35   0.68 
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    35   0.69 
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    35   0.69 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    35   0.71 
Kwal_23.3514 s23 (324012..325751) [1740 bp, 579 aa] {ON} YMR168C...    35   0.73 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    35   0.73 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    35   0.74 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     35   0.74 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    35   0.75 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    35   0.76 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    35   0.77 
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    35   0.78 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    35   0.78 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    35   0.81 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    34   0.81 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    35   0.82 
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    35   0.83 
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    35   0.83 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    35   0.83 
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    35   0.86 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    34   0.86 
KNAG0J01530 Chr10 (281029..282111) [1083 bp, 360 aa] {ON} Anc_8....    34   0.87 
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    34   0.87 
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    34   0.88 
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    34   0.90 
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    34   0.93 
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    34   0.93 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    34   0.93 
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    34   0.94 
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    34   0.95 
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    34   0.95 
TDEL0H01310 Chr8 (224588..226165) [1578 bp, 525 aa] {ON} Anc_1.2...    34   0.96 
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    34   0.97 
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    34   0.98 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    34   0.98 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    34   0.99 
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             34   1.0  
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    34   1.0  
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       34   1.0  
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    34   1.0  
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    34   1.1  
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    34   1.1  
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    34   1.1  
ACR107W Chr3 (544402..545556) [1155 bp, 384 aa] {ON} Syntenic ho...    34   1.1  
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    34   1.1  
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    34   1.1  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     34   1.2  
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    33   1.2  
SAKL0C13200g Chr3 (1167325..1168065) [741 bp, 246 aa] {ON} simil...    33   1.2  
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    34   1.2  
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    34   1.2  
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    34   1.2  
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    34   1.2  
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    34   1.2  
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    34   1.2  
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    34   1.2  
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    34   1.2  
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    34   1.3  
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    34   1.3  
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    34   1.3  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    33   1.3  
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    34   1.3  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    34   1.3  
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    33   1.4  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    33   1.4  
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    34   1.4  
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    34   1.4  
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    34   1.4  
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    34   1.4  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    33   1.4  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    34   1.4  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    34   1.5  
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    33   1.5  
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    33   1.5  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    33   1.5  
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    33   1.5  
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    33   1.6  
Smik_2.382 Chr2 complement(684520..686112) [1593 bp, 530 aa] {ON...    33   1.6  
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    33   1.6  
Ecym_3382 Chr3 (724394..726190) [1797 bp, 598 aa] {ON} similar t...    33   1.6  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    33   1.7  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    33   1.7  
TBLA0J00620 Chr10 complement(140248..142545) [2298 bp, 765 aa] {...    33   1.7  
KLLA0D15356g Chr4 (1301848..1303722) [1875 bp, 624 aa] {ON} some...    33   1.7  
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    33   1.7  
NCAS0D00890 Chr4 (166411..168324) [1914 bp, 637 aa] {ON} Anc_2.3...    33   1.8  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...    33   1.8  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...    33   1.8  
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    33   1.8  
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    33   1.8  
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    33   1.8  
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    33   1.8  
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    33   1.9  
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    33   2.1  
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    33   2.1  
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    33   2.1  
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    33   2.2  
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    33   2.2  
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    33   2.3  
TBLA0F03550 Chr6 complement(875734..876630) [897 bp, 298 aa] {ON...    33   2.3  
SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa] ...    33   2.4  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    33   2.4  
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    33   2.5  
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    33   2.6  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    33   2.6  
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    33   2.6  
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    33   2.6  
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    33   2.6  
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    33   2.7  
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    33   2.8  
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    33   2.8  
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    33   2.8  
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    33   2.9  
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               33   2.9  
ZYRO0F06556g Chr6 (542397..543476) [1080 bp, 359 aa] {ON} simila...    32   2.9  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    33   3.0  
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    33   3.0  
KAFR0B04830 Chr2 (1003592..1005487) [1896 bp, 631 aa] {ON} Anc_2...    33   3.0  
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    33   3.1  
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    33   3.1  
CAGL0K06985g Chr11 (681944..683734) [1791 bp, 596 aa] {ON} simil...    32   3.3  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    32   3.3  
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    31   3.3  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    32   3.5  
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 32   3.6  
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    32   3.6  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    32   3.7  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    32   3.7  
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    32   3.8  
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    32   3.9  
TPHA0N01110 Chr14 (232891..233982) [1092 bp, 363 aa] {ON} Anc_6....    32   4.0  
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    32   4.0  
KAFR0H02600 Chr8 complement(496353..497432) [1080 bp, 359 aa] {O...    32   4.0  
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    32   4.1  
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    32   4.1  
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    32   4.3  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    32   4.4  
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    32   4.6  
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    30   4.6  
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    32   4.7  
SAKL0D05236g Chr4 complement(414228..415826) [1599 bp, 532 aa] {...    32   4.7  
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    32   4.9  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     32   4.9  
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    32   5.3  
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    32   5.5  
Ecym_2265 Chr2 (521409..523064) [1656 bp, 551 aa] {ON} similar t...    32   5.9  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    32   6.0  
Kwal_14.1636 s14 (400872..402242) [1371 bp, 456 aa] {ON} YBR239C...    32   6.3  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...    32   6.3  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    32   6.4  
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               31   7.3  
KLTH0H05764g Chr8 (508783..510153) [1371 bp, 456 aa] {ON} simila...    31   7.4  
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 31   7.5  
Smik_6.15 Chr6 (22860..24260) [1401 bp, 466 aa] {ON} YFL052W (REAL)    31   7.8  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    31   8.0  
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    31   9.7  
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    31   9.8  

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 1082 bits (2798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/546 (97%), Positives = 533/546 (97%)

Query: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV 60
           MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV
Sbjct: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV 60

Query: 61  QQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCL 120
           QQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCL
Sbjct: 61  QQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCL 120

Query: 121 GLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVV 180
           GLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVV
Sbjct: 121 GLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVV 180

Query: 181 NPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDPT 240
           NPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDPT
Sbjct: 181 NPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDPT 240

Query: 241 FSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNV 300
           FSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNV
Sbjct: 241 FSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNV 300

Query: 301 PPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVALA 360
           PPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVALA
Sbjct: 301 PPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVALA 360

Query: 361 HLIPQDSVXXXXXXXXXXXXXVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVVL 420
           HLIPQDSV             VHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVVL
Sbjct: 361 HLIPQDSVNANAAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVVL 420

Query: 421 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNIT 480
           QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNIT
Sbjct: 421 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNIT 480

Query: 481 QILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDPS 540
           QILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDPS
Sbjct: 481 QILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDPS 540

Query: 541 DTLNFM 546
           DTLNFM
Sbjct: 541 DTLNFM 546

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/546 (84%), Positives = 491/546 (89%), Gaps = 4/546 (0%)

Query: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV 60
           M S GS + P+KRQRVRKACVPCRERKRKCNGKSPCEMC+AYGY CHY D    S SP+V
Sbjct: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRV 60

Query: 61  QQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCL 120
               ET   T++RP+ LP I RNE  + ++ QNVT+QNI+DP KSRYTIQHSAVAFPRCL
Sbjct: 61  D---ETPYGTDNRPYSLPNILRNE-ARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCL 116

Query: 121 GLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVV 180
           GLELRSTNPPRLHSFAWHCGIRPEENPNSH+LLS LVTKEEYYRISKVYFSVVHPIFDVV
Sbjct: 117 GLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVV 176

Query: 181 NPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDPT 240
           +PEQLAKNVE+YWDGDVK LEYGAVIAGVIALGSFF+GSLGHPREMD+VQYAKGILDDPT
Sbjct: 177 DPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPT 236

Query: 241 FSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNV 300
           F RIPTVEQVSAWVLRTIYLRATSRPHVAWLASC+TIHLSEAIGLHHEIDRED+ +++NV
Sbjct: 237 FCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNV 296

Query: 301 PPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVALA 360
           P +RTT VSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCK VKET+GN T HLVALA
Sbjct: 297 PLRRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALA 356

Query: 361 HLIPQDSVXXXXXXXXXXXXXVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVVL 420
            LIPQD V             VH+SPNAHPFLSLTK DICLSLYRRLRLLNHILDK+VVL
Sbjct: 357 QLIPQDCVNANATQLLQALAAVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVL 416

Query: 421 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNIT 480
           QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVA AM+TLDNIT
Sbjct: 417 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNIT 476

Query: 481 QILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDPS 540
           Q+LGT IA+EAQKTAKLLLEDSMKKKRQEIQQLE+ATHQRS +ETTHLLDIDWD LLDPS
Sbjct: 477 QVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPS 536

Query: 541 DTLNFM 546
           DTLNFM
Sbjct: 537 DTLNFM 542

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/546 (81%), Positives = 485/546 (88%), Gaps = 1/546 (0%)

Query: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV 60
           MAS GS   P+KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY +   P AS ++
Sbjct: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60

Query: 61  QQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCL 120
            QV E   DT++RP+V   I  N      ++Q+VT+ NI+D TKSRYTIQHSAVAFPR L
Sbjct: 61  NQVEELPHDTKNRPYVPLDIIGNGT-HSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSL 119

Query: 121 GLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVV 180
           GLELRSTNPPRLH FAWHCGIRPEE P+ HV LSD+VTKEEYYRISKVYFSVVHPIFD+V
Sbjct: 120 GLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIV 179

Query: 181 NPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDPT 240
           +PEQL KNVEKYW+GD +T EYGAVIAGVIALGSFF+GSLGHPREMDI+QYAKGILDDPT
Sbjct: 180 DPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPT 239

Query: 241 FSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNV 300
           FSRIP+VEQ+SAWVLRTIYLRAT+RPHVAWLASC+TIHLSEAIGLHHEIDRED+A++NNV
Sbjct: 240 FSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNV 299

Query: 301 PPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVALA 360
           P KRTT VSEHTRRLFW AWSINTILSYDYGRSSVTLNRITCKPVKETDGN+T +LV+LA
Sbjct: 300 PLKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLA 359

Query: 361 HLIPQDSVXXXXXXXXXXXXXVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVVL 420
            L+PQ+SV             VHESP+AHPFLSLTK DICLS YRRLRLLNHILDK+VV 
Sbjct: 360 QLVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVS 419

Query: 421 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNIT 480
           QIIDIGNTAL+AAYALVK+DQAWWNVLSTSFQYVCVLLAIDTPESLSHVA AM+TLDNIT
Sbjct: 420 QIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNIT 479

Query: 481 QILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDPS 540
           Q+LGT IAFEAQKTAKLLLEDS+KKKRQEIQQLEQATHQRS  ETTHLLDIDWDALLDPS
Sbjct: 480 QVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPS 539

Query: 541 DTLNFM 546
           DTL+FM
Sbjct: 540 DTLSFM 545

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/547 (76%), Positives = 468/547 (85%), Gaps = 2/547 (0%)

Query: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID-GRVPSASPQ 59
           MAS       +KRQRVRKACVPCRERKRKCNGKSPCEMC++YGYVCHY+D  R  S+S  
Sbjct: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60

Query: 60  VQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRC 119
           VQ++ E     ES+PF    IH NE    ++TQ VT+Q+I DP KSRYTIQHSAVAFPRC
Sbjct: 61  VQKLDELPHAPESKPFAASNIHGNEVSS-VDTQTVTNQSITDPVKSRYTIQHSAVAFPRC 119

Query: 120 LGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDV 179
           LGLELRS NPPRLHSFAWHCGIRPEENP+SHVLLS+L+TKEEYYR+SKVYFSVVHPIFDV
Sbjct: 120 LGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDV 179

Query: 180 VNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDP 239
           V+P+QLAKNVE+YW G++   EYGAVIAGV+ALGSFF+GS+GHPREMD+VQYAKGILDDP
Sbjct: 180 VDPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDP 239

Query: 240 TFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNN 299
           TFSRIPTVE VSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLH +ID+ + ++++ 
Sbjct: 240 TFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSG 299

Query: 300 VPPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVAL 359
           V  +RT   +EHT+RLFWCAWSINTILSYDYGRSSV LNRITCKPV+ET+G++T HLVAL
Sbjct: 300 VTLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVAL 359

Query: 360 AHLIPQDSVXXXXXXXXXXXXXVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVV 419
           A  IPQ +V             +H+SPNAHPFL LTK DICLSLYRRLRLLNH+LDK+VV
Sbjct: 360 AQTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVV 419

Query: 420 LQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNI 479
           LQIIDIGN ALSAAYALVKL Q+WWNVLSTSFQYVCVLLAIDTPESLSHVA AMKTLDNI
Sbjct: 420 LQIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNI 479

Query: 480 TQILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDP 539
           T++LGT IA EAQKTAKLLLEDSMKKKRQEIQQLEQATH RS  E T+ LDIDWDAL DP
Sbjct: 480 TEVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDP 539

Query: 540 SDTLNFM 546
           S TL FM
Sbjct: 540 SGTLGFM 546

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
           {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
           cluster protein) [contig 358] FULL
          Length = 552

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/554 (54%), Positives = 386/554 (69%), Gaps = 17/554 (3%)

Query: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY--IDGRVPSASP 58
           M + G+    +KR RVRKAC+PCR+RKRKC+   PC MC +YGY C Y  +DG +     
Sbjct: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEK 60

Query: 59  QVQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQ-NIVDPTKSRYTIQHSAVAFP 117
           +      TSP T         I + E  +P      +S+  I DP+KSRY   HSAVAFP
Sbjct: 61  RPSPKQSTSPST---------IQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFP 111

Query: 118 RCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIF 177
           R LGLEL+S NPP LHSFAW+CGIRPEEN  SH  L+++++K++  R + VYF VVHP+F
Sbjct: 112 RYLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMF 171

Query: 178 DVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILD 237
           D+++P Q  ++++ YW G      + AVI GV+ALGSFF  + GH RE+DIVQYAK IL+
Sbjct: 172 DIIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILE 231

Query: 238 DPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAIS 297
           DPTFS  P++EQ+SAWVLR+IYLRAT+RPHVAWLASC+T+HL EA  LHHE+D+ ++A  
Sbjct: 232 DPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATR 291

Query: 298 NNVP-PKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHL 356
           N+ P P R   V E  RRLFWCAW INTI+SY+YGRS VTLN+I+CK +KE+  N+TA +
Sbjct: 292 NDAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEM 351

Query: 357 VALAHLIPQDSV----XXXXXXXXXXXXXVHESPNAHPFLSLTKGDICLSLYRRLRLLNH 412
           V LA +IP  S                  V+++ + HPFLSLTK D+C S YRRLRLLNH
Sbjct: 352 VELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNH 411

Query: 413 ILDKNVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATA 472
           +LD++VVLQII+IG +ALSAA  LV+ +  WWNVLST F Y CVLLAID+P+SLS+VA A
Sbjct: 412 VLDRSVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAA 471

Query: 473 MKTLDNITQILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDID 532
               D+I +IL T IA EAQ TAKLLL DSMKKK++EI  LE A  +     T +  DID
Sbjct: 472 KSIFDSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDID 531

Query: 533 WDALLDPSDTLNFM 546
           WDALLDPS++LN M
Sbjct: 532 WDALLDPSNSLNLM 545

>KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} similar
           to uniprot|P23172 Saccharomyces cerevisiae YOR380W RDR1
           Transcriptional repressor involved in the control of
           multidrug resistance negatively regulates expression of
           the PDR5 gene member of the Gal4p family of zinc cluster
           proteins
          Length = 561

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/558 (52%), Positives = 375/558 (67%), Gaps = 19/558 (3%)

Query: 3   SPGSTALPHK-RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSA--SPQ 59
           S G  ++PHK RQR RKACVPCR+RKR+C+G +PC MCV+Y Y CHY +   P+   +P 
Sbjct: 2   STGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPL 61

Query: 60  VQQVGETSPDTESRPFVLPGIHRNEQPQPI-------NTQNVTSQNIVDPTKSRYTIQHS 112
           + ++    PD+ +R    P      +P  I       +TQ    Q + D  KSRY    S
Sbjct: 62  IPEI----PDS-TRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSS 116

Query: 113 AVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSV 172
           AVAF R LG+EL+S NPP LHSFAW+CG+R EE  N+H  L DL+TKEE +  +++YFS 
Sbjct: 117 AVAFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSA 176

Query: 173 VHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYA 232
           +HP+FDVV+PE   K+VE YW+   K   +GAV+ G+IALGS F G  GHPRE++IVQYA
Sbjct: 177 IHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYA 236

Query: 233 KGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDRE 292
           K +L+DPTFSR+P+ EQVSAWVLRT+YLRAT+RPH AWLASCVTIHL+EA  LHHE++  
Sbjct: 237 KNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENV 296

Query: 293 DIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNF 352
           ++  ++   P RT  ++E  RRLFWCAWSIN+ILSYDYGRSS +L  I+CK   ++DGN+
Sbjct: 297 ELTANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNY 356

Query: 353 TAHLVALAHLIP----QDSVXXXXXXXXXXXXXVHESPNAHPFLSLTKGDICLSLYRRLR 408
           TA LV LA +IP    + S              V+E+P+ H FLSL K D+C S YRRLR
Sbjct: 357 TAQLVDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLR 416

Query: 409 LLNHILDKNVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSH 468
           L N+ LD  VV Q+  + N ALSAAY LV+    WWNVLS  FQY+CVLLAI+T ESL++
Sbjct: 417 LFNYTLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLAN 476

Query: 469 VATAMKTLDNITQILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHL 528
           VA A    D I   L T +A EAQ T KLLL+DS+KKKRQE+  LE A    +  E    
Sbjct: 477 VAKAKNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFT 536

Query: 529 LDIDWDALLDPSDTLNFM 546
            +IDWD LLDPS  L+ M
Sbjct: 537 AEIDWDVLLDPSHALHLM 554

>KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 672

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 134/372 (36%), Gaps = 69/372 (18%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDTES 72
           R RVRKAC  C+ RK KCNG+ PC  C  +G VCHY    V   +    + G   P    
Sbjct: 25  RIRVRKACGTCKRRKVKCNGQQPCAGCAKHGSVCHYKVEPVTRPASAALKAGAPGPAG-- 82

Query: 73  RPFVLPGIHRNEQPQPINTQNVTSQ--NIVDPTKSRYTIQHSAVAFPRCLGLELRSTNP- 129
               LP + +   P    T    +       P K R+  +H  +  P  LG  L S+ P 
Sbjct: 83  ---TLPALSQVPAPSDFATGPAPASPWQRFSPGKYRFHRRHQNLV-PYYLGQALISSLPP 138

Query: 130 ----------PRLHSFAWHC--GIRPEEN-----PNSHVLLSDL---VTKEEYYRISKVY 169
                     PRL  + W+   G   ++      P   V   DL   + ++   + +  +
Sbjct: 139 ALVQKYALRAPRLQFYGWNMSGGHYLKQGSTFGAPQGTVWRWDLAVELQRQILEKCASFF 198

Query: 170 FSVVHPIFDVVNPEQLAKNVEKYW-------DGDVKTLEYGAVIAGVIALGSFFMGSLG- 221
           F  V+    +V+ +   +     +       +G     E    +   IAL   + G+   
Sbjct: 199 FQHVNRFVSIVHEQAFWQQFRGGFLDGSDGKNGSSDLFEAILNLIAAIALRFSYSGAGAS 258

Query: 222 -------------------HPREMD--IVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYL 260
                              H R ++  + + A  +    +F    + E + AW+L  +YL
Sbjct: 259 VCEALTAAEVTWLDLHLTRHGRHLEETLFERAYAVTTRLSFE-WESFELIQAWLLAAVYL 317

Query: 261 RATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAW 320
           R   R    W A    + +   + L+           N  P K T       R  +W  +
Sbjct: 318 RTCHRQVSCWQALSRAVQMCNGMSLY----------LNRFPEKHTAYDECRARNCYWACF 367

Query: 321 SINTILSYDYGR 332
            ++ ++S+  GR
Sbjct: 368 VLDRLISFQMGR 379

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 88/372 (23%), Positives = 142/372 (38%), Gaps = 73/372 (19%)

Query: 16  VRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQVQ-QVGETSPDTESR 73
           V++AC  CR+RK +C+ + P C  C+ + + C Y    V S   +V     E    T  R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTRVHLNYVEKKLATLER 64

Query: 74  PF--VLPGIHRNEQPQPINTQNV------TSQNIVDPTKSRYTIQHSAVAFPRCLGLELR 125
            F  + PGI   +  Q  ++QN+       + N +   K   T   + V       L   
Sbjct: 65  LFHELFPGIDPEKALQGKSSQNLRELIGSATSNSIPGNKDEITTAKTLVKPMHQPQLPQD 124

Query: 126 STNPPRLHSFAW------------HCGIRPEENPN---------SHVLLSDL-------- 156
                 L+ F W             C +    NPN         S VLL  L        
Sbjct: 125 EIPDDPLYGFDWIEEDDSVHKDDGMCALN--INPNHKGYFGLGSSTVLLRSLKVNDIAPK 182

Query: 157 ------VTKEEY-----YRISK---VYFSVVHPIFDVVNPEQLAKNVEKYWDGDVKTLEY 202
                 + KE Y     Y  SK    YFS  H  +  ++ E      +         + +
Sbjct: 183 LQRVPSIVKETYSLSAKYVTSKFIDAYFSQYHTTYPFIHKETFMAQYKDQLRPSSMDI-W 241

Query: 203 GAVIAGVIALGSFFMGSLGHPREMDIVQY--AKGILDDPTFSRIPTVEQVSAWVLRTIYL 260
             ++  V+ALG + +   G   ++DI  Y  AK  L    F    +V  V A  L + Y+
Sbjct: 242 QILLNTVLALGCWCIN--GESSDIDIYYYQNAKSYLSSVVF-ETGSVSLVVALTLLSSYV 298

Query: 261 RATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAW 320
           +  ++P+  W    +   ++ ++GLHHE             PK    + E  RR++W  +
Sbjct: 299 QKRNKPNSGWNYLGLATRMAISLGLHHEF------------PKMEETLLEQRRRVWWGTY 346

Query: 321 SINTILSYDYGR 332
           +++  +S  YGR
Sbjct: 347 TLDCAVSITYGR 358

>Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)
          [168 bp, 56 aa] {OFF} YOR380W (HSP)
          Length = 56

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQ 61
          +RV+  CV  RERK+  N +  CEMC  +GYVC+YID    S+ P VQ
Sbjct: 1  ERVQNICVQIRERKKTYNDRFSCEMCFGHGYVCNYIDS-YESSVPGVQ 47

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 149/362 (41%), Gaps = 63/362 (17%)

Query: 5   GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVG 64
           G+  L   R R  +ACV CR+RK +C+G++PC +C    + C Y   R P  S    +  
Sbjct: 43  GTNELKPTRGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKY--DRPPRNSSVFDR-- 98

Query: 65  ETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCLGLEL 124
           E S D+ S P  +P  H+  + +  +T  +  +NIV+ T     I H  V  P       
Sbjct: 99  EVSDDSSSYPQSIP--HQEGEDKRSSTCTINYKNIVE-TIFPPEILHQIVTSPSFNNQFF 155

Query: 125 RSTNPPRLHSFAWHCG--IR---PEENP---NSHVLL--SDLVTK--EEYYRISKVYFSV 172
             T    L     +    IR   P++ P    + V L   ++  K  ++ +  + V F  
Sbjct: 156 LDTIKTYLLQGQLNVNHVIRQSLPKDAPWHMKTSVPLPPREIALKFIQKTWDCACVLFRF 215

Query: 173 VH-----PIFD-VVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREM 226
            H      I D +   E+L K   KY    VKT     +I  V+A+G+ F          
Sbjct: 216 YHRPTIISILDSIYEAEKLGK---KYTPEQVKT---QPLIYSVLAVGALFSKEDLSKDSR 269

Query: 227 DIVQY-----------AKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCV 275
              ++           AK  LD   FS I  +  + A  + TI+L+ ++     +  S +
Sbjct: 270 ATREFYTDEGYRYFLEAKKSLD---FSNITDIYSIQAIFMMTIFLQCSANLKACY--SFI 324

Query: 276 TIHLSEAI--GLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSI----NTILSYD 329
            I L  A+  GLH +        S+ V P  T +  E  +RLFW  + +    N IL + 
Sbjct: 325 GIALRAALKDGLHRK--------SSIVGP--TPIEDETKKRLFWSVYKLDLYMNCILGFP 374

Query: 330 YG 331
            G
Sbjct: 375 SG 376

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 91/386 (23%), Positives = 146/386 (37%), Gaps = 111/386 (28%)

Query: 5   GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY---------IDGRVPS 55
           G+  L   R R  +ACV CR+RK +C+G++PC +C    + C Y          D  +  
Sbjct: 19  GTNELKPTRGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKYDRPPRNSSAFDKELSD 78

Query: 56  ASPQVQQVGE---------------------------------TSPDTESRPFVLPGIHR 82
            SP   Q                                    TSP  +++ F L  I R
Sbjct: 79  DSPLYSQRASHQDHNDNKGRQSVIDYKKITETIFTPEALNQIFTSPSFDNQLF-LDTIKR 137

Query: 83  NEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCLGLELRSTNPPRLHSFAWHCGIR 142
             Q   ++  NV  Q++  P  + + ++ S    PR + L+             W C   
Sbjct: 138 YLQQGQLDVNNVIRQSL--PKNASWHLKTSVPLPPRGIALKFIQK--------TWDCAC- 186

Query: 143 PEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVVNPEQLAKNVEKYWDGDVKTLEY 202
                         V    Y+R + +  S++  I++    E+L K   +Y    VKT   
Sbjct: 187 --------------VLFRFYHRPTII--SILDSIYEA---EKLGK---EYTAEQVKT--- 221

Query: 203 GAVIAGVIALGSFFMGS-----LGHPREM---DIVQY---AKGILDDPTFSRIPTVEQVS 251
             +I  V+A+G+ F            RE    +  +Y   AK  LD   FS I  +  + 
Sbjct: 222 QPLIYSVLAVGALFSKEDLSKDSNATREFYTDEGYRYFLEAKKSLD---FSNITEIYSIQ 278

Query: 252 AWVLRTIYLRATSRPHVAWLASCVTIHLSEAI--GLHHEIDREDIAISNNVPPKRTTVVS 309
           A  + TI+L+ ++     +  S + I L  A+  GLH +        S+ V P  T +  
Sbjct: 279 AIFMMTIFLQCSANLKACY--SFIGIALRAALKEGLHRK--------SSIVGP--TPIQD 326

Query: 310 EHTRRLFWCAWSI----NTILSYDYG 331
           E  +RLFW  + +    N IL +  G
Sbjct: 327 ETKKRLFWSVYKLDLYMNCILGFPSG 352

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/347 (21%), Positives = 137/347 (39%), Gaps = 85/347 (24%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPD--- 69
           R RV KAC+ CR++KR+C+GKSPC  C     +C Y +   P  S  +    + S D   
Sbjct: 25  RLRVFKACIACRKKKRRCDGKSPCSHCARTSIICEYTNTARPR-SHSIAFANDVSNDIHL 83

Query: 70  ----TESRPFVLPGIHRNEQPQPI------------NTQNVTSQNIVDPTKSRYTIQHSA 113
               T SR    P +     P               + QN++ + ++    S    ++  
Sbjct: 84  IDSTTSSRSHS-PKLSDKVNPYKTLIERLYSGASLESLQNLSREQLIKTLNSEEVNKNDT 142

Query: 114 VAF-PRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSV 172
           ++  PR + L+L       L +++  C                 V    Y+R S V   +
Sbjct: 143 ISLPPRDIALKL------ILKTWSSAC-----------------VLFRFYHRPSLV--KI 177

Query: 173 VHPIFDV-VNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMG--SLGHPREMDIV 229
           +  ++++  NP+             +K  +  ++I  V+A+G  F    +  + R ++  
Sbjct: 178 LDSLYELGTNPKT------------IKQRKAESLIFAVLAVGELFSQEENNSYSRGLNYF 225

Query: 230 QYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEI 289
             AK ++D   F  I  +  + A  + TI+L+ +       L +C   +    I L    
Sbjct: 226 NKAKTLID---FKDINDIHSIQAIFMMTIFLQCSGD-----LKAC---YYYIGIALR--- 271

Query: 290 DREDIAISNNVPPK-----RTTVVSEHTRRLFWCAWSINTILSYDYG 331
               IAI  N+  K      T +  E  +RLFW  + ++  ++   G
Sbjct: 272 ----IAIRENLHRKPSLTGPTAIEDETKKRLFWSIYKVDIYMNCTLG 314

>KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2.565
           YMR019W
          Length = 608

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/344 (20%), Positives = 124/344 (36%), Gaps = 64/344 (18%)

Query: 14  QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQV---------- 63
           +RVR AC  C+ RK KC+GK PC  C     +C Y   +V +  P    V          
Sbjct: 7   RRVRAACAVCQRRKLKCDGKQPCSRCARTDRICRYAKVQVQTQMPARASVVPRANVPVGL 66

Query: 64  GETSP--------------DTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTI 109
           G  SP                +  PF        + P+ +    V ++++  P+   Y  
Sbjct: 67  GRGSPWLGFSFSKFRFHRRYQDVLPFYFCESVLAQLPESV----VAAEDLQLPSVQNYGW 122

Query: 110 QHSAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVY 169
             +  AF     L+  +T PP          +RP                     + + Y
Sbjct: 123 NLAGGAF-LAFALQPSATRPPLRE-------LRP---------------------LVQHY 153

Query: 170 FSVVHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIV 229
           F  V+P+F +VN        +   D +      G ++A  I    +  G      E  + 
Sbjct: 154 FDHVNPLFSIVNERVFWSQWDSAADANSLFNAIGYLMA--ITAERYRCGPPPRVDETALF 211

Query: 230 QYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEI 289
            ++  ++ + +F    +VE + +W+L   YLR   R    + A    + +   + L+ E 
Sbjct: 212 NHSYAVVSEFSFE-WESVELIQSWLLIAAYLRCCYRQTSCYAALARAVAMCRGMSLNLEA 270

Query: 290 DREDI-AISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
             E + A         +T    H    FW  ++++ I S+  G+
Sbjct: 271 KPEQVDAEGEQTGALHSTGKYYHC---FWTVYTVDKIFSHQLGK 311

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 687

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 78/374 (20%), Positives = 139/374 (37%), Gaps = 66/374 (17%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDTE 71
           +R RVRKAC  C++RK KC+G  PC  C      C Y      +ASP  +     S D E
Sbjct: 20  QRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY--KFTDTASPISKPKPGRSLDKE 77

Query: 72  SRPFVLPGIH---------RNEQPQPINTQNVT--SQNIVDP------TKSRYTIQHSAV 114
           S    L  +          +          N+   S ++  P       K R+  ++  +
Sbjct: 78  SIANALLQLESSLLAKIDSKPTPTPTPTPPNLVHFSSSLPSPWQTFSLDKYRFHRRYQNL 137

Query: 115 AFPRCLGLELRSTNP-----------PRLHSFAWH-CGIRPEENPNSHVL----LSDLVT 158
             P  LG  L  + P           PR+ ++ W+  G    +N +   L      D V 
Sbjct: 138 -LPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKNGSDSSLDIINFDDPVQ 196

Query: 159 KEEYYRISKVYFSVVHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGS---F 215
            +   ++ + YF  ++P+F +V+ +   +     +    +      +    + L +   F
Sbjct: 197 LDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRF 256

Query: 216 FMG-SLGHP-----REMDIVQYAKGILDDPTF-------SRIP----TVEQVSAWVLRTI 258
           + G S   P      ++D +      L++  F       SR+     + E + +W+L   
Sbjct: 257 YEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAF 316

Query: 259 YLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWC 318
           YLR   R    W A    I + + + L+           N  P + T       +  FW 
Sbjct: 317 YLRTCHRQTSCWNALGSAIRMCKGMALY----------LNRFPQRHTLYEETKVKNCFWS 366

Query: 319 AWSINTILSYDYGR 332
            + ++ ++S+  GR
Sbjct: 367 CFIMDKVISFQMGR 380

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
          {ON} 
          Length = 968

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID--GRVPSASPQVQQVGETSP 68
          H+R++   AC  CR RK KC GK PC  C AY  VC Y+D   +V  A      VG  + 
Sbjct: 19 HRRRKTVLACTNCRRRKIKCTGKWPCSNCEAYSCVCEYVDKAAQVKFAGGSGNSVGTVAV 78

Query: 69 DTES 72
           +ES
Sbjct: 79 SSES 82

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 26/42 (61%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRV 53
           R RVRKAC  C+ RK KC+G  PC  CV +G  C YI G V
Sbjct: 9  NRLRVRKACEICKRRKVKCDGSQPCANCVKHGQECKYISGTV 50

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 43/109 (39%), Gaps = 11/109 (10%)

Query: 224 REMDIVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAI 283
           RE  + +YA  ++   TF    + E + +W+L T Y R   R    W A    I++   +
Sbjct: 342 REEAMFKYAYSVITQLTF-EWESFELIQSWLLITFYFRTCYRQTACWNALGQAINMCNGM 400

Query: 284 GLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
            L+           N  P   +          FW  + ++ ++S+  GR
Sbjct: 401 SLY----------LNRFPRTHSKYDESRAWHCFWACFIMDKLISFQMGR 439

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 27/40 (67%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          L +KR+RV +AC  CR++K KC+GK PC  C  Y Y C Y
Sbjct: 3  LQNKRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTY 42

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1192

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 42/87 (48%), Gaps = 17/87 (19%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDTE 71
          +R +V KAC  CR RK KCNG +PC  C  Y   C Y    +P ++ Q  ++G  +    
Sbjct: 20 QRNKVSKACQSCRRRKIKCNGINPCSNCTTYECECIY---SIPDSNSQTDKLGRANT--- 73

Query: 72 SRPFVLPGIHRNEQPQPINTQNVTSQN 98
                  I +N+  +P   QN TS N
Sbjct: 74 --------IKKNKVKKP---QNTTSPN 89

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 26/45 (57%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSAS 57
          R +V +AC  CR RK KC GK PC  C AY   C Y  G VP+ S
Sbjct: 10 RNKVNRACYNCRRRKIKCTGKYPCSSCEAYQCECLYFPGYVPTKS 54

>Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W
           (REAL)
          Length = 1010

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQV-GETSPDTE 71
           R +V  ACV CR+RK KC GK PC  C++Y   C ++   +P      Q     T+P + 
Sbjct: 49  RSKVSTACVNCRKRKIKCTGKHPCTNCISYDCTCVFLKRYLPQGKDAPQPFPAATAPSSS 108

Query: 72  SRP 74
           S P
Sbjct: 109 SHP 111

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 5  GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          GS+  P KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 22 GSSQQP-KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYNCTY 64

>YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}
          PDR3Transcriptional activator of the pleiotropic drug
          resistance network, regulates expression of ATP-binding
          cassette (ABC) transporters through binding to
          cis-acting sites known as PDREs (PDR responsive
          elements); post-translationally up-regulated in cells
          lacking a functional mitochondrial genome
          Length = 976

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDTES 72
          R +V  ACV CR+RK KC GK PC  C++Y   C ++   +    PQ +   ++ P T  
Sbjct: 8  RSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVFLKKHL----PQKEDSSQSLPTTAV 63

Query: 73 RPFVLPGIHRN 83
           P   P  H N
Sbjct: 64 AP---PSSHAN 71

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%)

Query: 1  MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          M       L +KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 1  MGDQQQQILQNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 48

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar
          to uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor
          Length = 1107

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSP 68
          +R +V KAC  CR RK KCNG  PC  C  YG  C Y D +  + + +    G++ P
Sbjct: 23 RRTKVGKACDSCRRRKIKCNGLKPCPSCTIYGCECTYTDAK-STKNLKSNDAGKSKP 78

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          L +KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 4  LQNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 43

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          L +KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 4  LQNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 43

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa]
          {ON} Anc_2.231 YIL130W
          Length = 1000

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 58 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 94

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
           KR+RV +AC  CR++K KC+G++PC  C  Y Y C Y
Sbjct: 64  KRRRVTRACDECRKKKVKCDGQNPCIHCTVYSYKCSY 100

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 878

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVC---HYIDGRVPSAS 57
          H R+RV KAC  CR +K KCNG+  C  C+ YG  C   H I  R P+++
Sbjct: 7  HSRRRVSKACDSCRSKKIKCNGEQTCSNCLKYGCPCTYTHTIKKRKPAST 56

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 10 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 46

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 31 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 67

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 5/48 (10%)

Query: 1  MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          M+ P S     KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 1  MSEPQS-----KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 43

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
          Anc_1.128 YJL206C
          Length = 663

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 24/40 (60%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          L  K QRVR AC  CR +KRKC+G+ PC  C    Y C Y
Sbjct: 24 LQLKEQRVRTACSMCRRKKRKCDGRVPCSFCTKNHYQCIY 63

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETS 67
          R++V KAC  CR RK KC G  PC  C AY   C + D +  S++P    VG T+
Sbjct: 30 RKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIFDDLKEDSSNPST--VGGTT 82

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 817

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 68/163 (41%), Gaps = 23/163 (14%)

Query: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV 60
           MA+P  T   +  ++  +AC+ CR RK KCNG  PC  C   G  C Y        +P +
Sbjct: 32  MATPRVTKRAYTIRKTPQACISCRRRKVKCNGCRPCSSCKTNGLECAY-------DTPSL 84

Query: 61  QQV---GETSPDTESRPFVLPGIH---RNEQPQPINTQNVTSQNIVDPT------KSRYT 108
           +QV   G+   DT     ++  +H   RN      +     S  + D +      +SR  
Sbjct: 85  EQVNIKGKPHIDTSEALRLISNLHSTLRNLSSLAQDDPGSMSSTVTDISMRVHDLESRLH 144

Query: 109 IQHSAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHV 151
           +Q +      C G     +   +L SF     +  EENPNS V
Sbjct: 145 MQLNPYKAANCRG---EKSLEYKLASFG-PAKVGYEENPNSPV 183

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%)

Query: 2  ASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQ 61
           S  S  LP  ++RV KAC  CR+ K KC+G+ PC  C+    +C Y +  +  A  + +
Sbjct: 4  GSRSSAELPTIKRRVSKACDACRKSKTKCDGERPCSRCLKENKLCTYSNSNIGYAESKCK 63

Query: 62 QV 63
          ++
Sbjct: 64 KL 65

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR RV +AC  CR+RK +C+G+ PC  C  Y Y C Y
Sbjct: 24 KRLRVSRACDVCRQRKVRCDGRQPCIHCTVYSYNCTY 60

>Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 bp,
           594 aa] {ON} complement(32885..34586,34699..34781) [1785
           nt, 595 aa]
          Length = 594

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 77/383 (20%), Positives = 142/383 (37%), Gaps = 77/383 (20%)

Query: 5   GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYG--------------YVCHYI- 49
           GS +   KR   + AC  CR+R+RKCN + PC  C+ +G              Y C Y+ 
Sbjct: 17  GSDSSGLKR---KLACQGCRKRRRKCNFEVPCSNCIKFGSECVSVNLDLRKSRYSCTYVK 73

Query: 50  --DGRVPSASPQVQQVGETSPDTESRPFVLPGIHRN-EQPQPINTQNVTSQNIVDPTKSR 106
             + R+      ++ + E   + E    +   +  +   P+  +  NV S  +     S 
Sbjct: 74  TLENRIAHLESSLKHIAEVDNEEEKNKIIESLVIDDIATPEQADNLNVNSFPVTSVGSSS 133

Query: 107 YTIQHSAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRIS 166
              Q+S           L  TN  RL+           E     V+L +L T     +  
Sbjct: 134 IYPQNS-----------LSITNKRRLY-----------EQNQLKVILKNLSTNPMILKSL 171

Query: 167 KVYFSVVHPI-FDVVNPEQLAKNVEKYWDGDVKTLEY---GAVIAGVIALGSFFMGSLGH 222
            ++F  ++P  +  ++ E         + GD  T  Y     ++  + ALGS    +   
Sbjct: 172 SLFFKWLYPAHYLFIHRETFLSA----FFGDAHTKSYYCSEELVYAISALGSKLSDTNDE 227

Query: 223 --PREMDIVQYAKGILDDPTFS-------------RIPTVEQVSAWVLRTIYLRATSRPH 267
              +  +  Q AK I+    F              ++  ++ +       I    +    
Sbjct: 228 LFTKSKEYYQTAKSIVLKKIFQLEDSSFADSTSSSKLAIIQTLLCLAFFDI---GSGENP 284

Query: 268 VAWLASCVTIHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTR-RLFWCAWSINTIL 326
           +AW  S +   ++  IGLH   +       N V      ++    R R++W  +  + ++
Sbjct: 285 MAWYLSGLAFRIAHEIGLHLNPEA-----WNTVYEDELLILDFEVRSRIYWGCYLADHLI 339

Query: 327 SYDYGRSSVTLNRITCKPVKETD 349
           S  +GRS++   +++   V ETD
Sbjct: 340 SVLFGRSTIL--KLSSSTVPETD 360

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 4/45 (8%)

Query: 8  ALPH----KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
           +PH    KR++V +AC  CR++K KC+G  PC  C  Y Y C Y
Sbjct: 4  TVPHRQEGKRRKVTRACDDCRKKKVKCDGNQPCIHCTVYSYECTY 48

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 16/86 (18%)

Query: 9   LPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVC-HYIDGRV------PSAS--- 57
           + HKRQR   +CVPC +RK KC+   P C  C+   + C ++++ R+      P AS   
Sbjct: 24  IQHKRQRKILSCVPCHQRKIKCSRDQPACSNCLKNNWDCVYFLNDRISKGRGTPIASTIV 83

Query: 58  PQVQQVGETSPDTES-----RPFVLP 78
           P     G+T  DT++     RPF +P
Sbjct: 84  PPTDDAGDTHTDTDAQIKTDRPFEVP 109

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa]
          {ON} similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206C and some similarities with YIL130W
          uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
          Proposed transcriptional activator member of the Gal4p
          family of zinc cluster proteins
          Length = 650

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 4  PGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVP 54
          P +  L   R +V+ AC  C+ERK +C+G+SPC  C+     C Y+    P
Sbjct: 20 PSTNQLEPVRHKVKHACSSCKERKVRCDGQSPCASCINARVKCEYVMNMKP 70

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 83/381 (21%), Positives = 138/381 (36%), Gaps = 102/381 (26%)

Query: 5   GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYI--------------- 49
           G+  L   + R  +AC+ CR+RK +C+G  PC +C    Y C Y                
Sbjct: 32  GTNELKPTKGRAHRACIACRKRKVRCSGNIPCRLCQTNSYECKYDRPPRNSSVFDREVSD 91

Query: 50  --------------DGRVPSASPQVQQVGETSPDTESRPFVLPGIHRNEQ---------- 85
                         D + P +S   ++V ET    E+   +L     N Q          
Sbjct: 92  DSSLYAQRASHEREDSKGPISSIDYKKVVETIFPPETLRQILASSSFNSQNFLDTIKTCL 151

Query: 86  -PQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPE 144
               +N   V  Q++  P  + + +Q S    PR + L+             W C     
Sbjct: 152 LQGQLNVNQVIRQSL--PKDTPWHMQTSVPLPPREIALKFIQK--------TWDCAC--- 198

Query: 145 ENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGA 204
                       V    Y+R + +  S++  I++        K+ ++Y    VKT     
Sbjct: 199 ------------VLFRFYHRPTII--SILDSIYEA------EKHGKQYTPEQVKT---QP 235

Query: 205 VIAGVIALGSFFMGS-----LGHPREMDIVQYAKGILDDPT---FSRIPTVEQVSAWVLR 256
           +I  V+A+G+ F            RE    +  +  L+      FS I  +  + A  + 
Sbjct: 236 LIYSVLAVGALFSKEDLSKDSKATREFYTDEGYRYFLEAKNSLDFSNITDIYSIQAIFMM 295

Query: 257 TIYLRATSRPHVAWLASCVTIHLSEAI--GLHHEIDREDIAISNNVPPKRTTVVSEHTRR 314
           TI+L+ ++     +  S + I L  A+  GLH          S+ V P  T +  E  +R
Sbjct: 296 TIFLQCSANLKACY--SFIGIALRAALKEGLHRR--------SSIVGP--TPIQDETKKR 343

Query: 315 LFWCAWSI----NTILSYDYG 331
           LFW  + +    N IL +  G
Sbjct: 344 LFWSVYKLDLYMNCILGFPSG 364

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 23/36 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R +VR+AC  CR+RK KC GK PC  C AY   C Y
Sbjct: 16 RIKVRQACDNCRKRKLKCTGKQPCSTCEAYSCDCIY 51

>SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON}
           conserved hypothetical protein
          Length = 640

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/289 (21%), Positives = 115/289 (39%), Gaps = 35/289 (12%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDTE 71
           KR+RV K C  C   K KC+   PC  C     V   I G   S   + +   E   D +
Sbjct: 8   KRRRVIKTCKYCYLHKLKCDKNMPCSTCSRLQVVDQCIYGFQESDENEWRGNNEKGIDGK 67

Query: 72  SRPFVLPG---IHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCLGLELRSTN 128
           ++   L     + ++    P  T  +   N +  +K  +T Q  +  F R      + TN
Sbjct: 68  TQRIDLSSEATVFKSRSFFPFFTNTI--NNRLLTSKDGHTAQLDSTVFKRN-----QLTN 120

Query: 129 PPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVVNPEQLAKN 188
             +         + P +  N   LL D  TK     +  VYF+ VHP+  ++N  +++ +
Sbjct: 121 FDKF-------TVEPLQLENIFKLLPD--TKTSMLLLLDVYFNQVHPVIPLLNQSKISSS 171

Query: 189 VEKYWDG-------DVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIV-QYAKG---ILD 237
           + + +D        D+  L    +I  ++   S+   S G    + +  +Y      ++D
Sbjct: 172 IVRIYDDLEEFRPLDISKL---LLIFAILFSVSYSNMSAGKSSSLTLCKKYYSAFSVLMD 228

Query: 238 DPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLH 286
              F  +P++E +  + +    +        A   S + + +++ +GLH
Sbjct: 229 KFRFPTVPSLESLQGFTIVNFVMDPNMVDATA--HSVMLLKIAQQLGLH 275

>Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYI 49
          R +V  AC+ CR+RK KC GK PC  C++Y   C ++
Sbjct: 8  RSKVSTACINCRKRKIKCTGKHPCTNCISYNCTCVFL 44

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          S  L  KR+RV +AC  CR++K KC+ + PC  C  Y Y C Y
Sbjct: 4  SAGLGLKRRRVTRACDECRKKKVKCDSRHPCIHCTVYSYECTY 46

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID--GRVPSASPQVQQVGETSPD 69
          ++QR   AC+ CR+R  KC G +PC+ CVA   +C Y++   ++  ++  +QQ+ +   D
Sbjct: 26 RQQRSSIACLSCRKRHIKCPGGNPCQKCVASNAICEYLEPSKKIVVSTKYLQQLQKELND 85

Query: 70 TESRPFVLPGI 80
                 L G+
Sbjct: 86 KTQENNRLRGL 96

>Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [contig
           206] FULL
          Length = 628

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 49/111 (44%), Gaps = 4/111 (3%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV-QQVGE--TSP 68
           KR R  K C  C E K KCN +SPC+ C   G   H + G   S    V   VG+  T P
Sbjct: 5   KRHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSHCVYGFKRSGESSVPTNVGKRTTKP 64

Query: 69  DTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRC 119
           + +++    P + +   P     +     N+ D T + +  +++   F +C
Sbjct: 65  EQKTKTLTTP-LPKPYYPYLAEAETGNLLNVQDATSNTWMKRNAIANFKKC 114

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 7/58 (12%)

Query: 2  ASPGSTALPHKRQRVRK-------ACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGR 52
          A+  S  +P K +++RK       AC  CR RK KC GK+PC  C AY  +C Y   R
Sbjct: 38 ATSTSLHVPTKEKKIRKPSNKVTKACDNCRRRKIKCTGKTPCATCEAYQCLCIYSTQR 95

>ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1
          Length = 595

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 84/373 (22%), Positives = 144/373 (38%), Gaps = 42/373 (11%)

Query: 1   MASPGSTALPHKRQRVRK-ACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQ 59
           M   GS+  P +    RK AC  CR+R+RKCN + PC  CV YG  C  +D  +      
Sbjct: 1   MKRSGSS--PDEPSNSRKLACQNCRKRRRKCNSEIPCSNCVKYGIECVPVDQDLRRTRYT 58

Query: 60  VQQVGETSPDTESRPFVLPGIH----RNEQPQPINTQNVTSQNIVDPTKSRYTIQ---HS 112
              V E     E     L        +NE+ + +++  + +  +  P +    IQ    S
Sbjct: 59  ASYVKELEDHVEHLEKTLKKAREVDDKNEKEKILDSVPIVNA-VPSPGQDSPDIQLPETS 117

Query: 113 AVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSV 172
           A + P      +  TN     S +     R  E     V +  L       R   ++F  
Sbjct: 118 ATSVPPVGTNSIYPTN-----SLSISKKKRTPEQLKILVNMRMLSRSPFILRSLSLFFKW 172

Query: 173 VHPI-FDVVNPEQLAKNVEKYWDGDVKTLEY---GAVIAGVIALGSFFMGSLGH--PREM 226
           ++P  F  ++ E         + GD     Y     ++  + ALGS    S G    +  
Sbjct: 173 LYPGHFMFIHRETFLSA----FFGDESAKSYYCSEELLYAIAALGSKLSSSDGELFGKSE 228

Query: 227 DIVQYAKGI-------LDDPTFSRIPTVEQ---VSAWVLRTIYLRATSRPHVAWLASCVT 276
           +  Q AK         LD  +F+ + +  +   +   +    Y  A     +AW  S + 
Sbjct: 229 EYYQTAKNKALKLVFQLDGNSFAELTSSNKLAFIQTLLCLAFYDVAAGENAMAWYLSGLA 288

Query: 277 IHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVT 336
             ++  IGLH   +    A ++    + + +  E   R++W  +  + ++S  +GRS+  
Sbjct: 289 FRIAHEIGLHLNPN----AWNDVYEDELSDLDFEVRSRIYWGCYIADHLISVLFGRSTTL 344

Query: 337 LNRITCKPVKETD 349
             R++   V ETD
Sbjct: 345 --RLSNSTVPETD 355

>NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON}
           Anc_2.565
          Length = 759

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 81/414 (19%), Positives = 157/414 (37%), Gaps = 101/414 (24%)

Query: 6   STALPHKRQRVR--KACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDG-----RVPSASP 58
           +T+   K+QR+R  +AC  C+ RK KC+G  PC  C+     C Y +      + P+  P
Sbjct: 18  NTSPERKKQRIRVQRACNICKRRKVKCDGNKPCLNCIKKEIDCEYNNSSNTTKKEPNDPP 77

Query: 59  QVQQVGETSPDTESRPFVL-PGIHRNEQPQPI------------------NTQNVTSQNI 99
                 E+S  T S P +L P +++ +    +                  +T ++ + + 
Sbjct: 78  ADIDAAESS--TMSPPNLLHPQLNKEQSEDNMAVLLLDLAKKLKQKKNIKDTTSLGNDDT 135

Query: 100 VDP---------------TKSRYTIQHSAVAFPRCLGLELRSTNP-----------PRLH 133
           + P                K R+  ++  V  P   G  L S  P           PR+ 
Sbjct: 136 IPPRVTKDTNSPWQSFSYDKYRFHRRYQNV-LPNKFGKSLLSALPPQLIQENNLETPRIQ 194

Query: 134 SFAWHCG----IRPEE--NPNSHVLLSDLVTKEEYYRISKV---YFSVVHPIFDVVNPE- 183
           ++AW+      ++ E+    NS +L  +         ++K+   YF  ++  + +++ E 
Sbjct: 195 NYAWNMSGGHYLKFEQMHENNSSLLFFNFDNPLHLSTVTKLLTFYFKQINKPYGIIHEEM 254

Query: 184 ---QLAKNVEKYWDGDVKTLE-YGAVIAGVIALG-SFFMG-------SLGHPREMDIVQ- 230
              Q      +    + K+ + + +++  V+ +   F+ G        L  P+E ++V  
Sbjct: 255 FWNQFNNGFLQQGKQNNKSAKLFTSMLYLVLTISIRFYEGLPASSLDQLFTPQEQELVHR 314

Query: 231 ------------YAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIH 278
                       +A  I+   TF    + E + +W+L   YLR   R    W A    I+
Sbjct: 315 QRILRNEEYMFGHAYSIVSKLTF-EWESFELIQSWLLIAFYLRTCYRQISCWNALSRAIN 373

Query: 279 LSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
           +   + L+           N  P   +T         FW  + ++ ++S+  GR
Sbjct: 374 MCNGMSLY----------LNRFPEVHSTYDEVKAWHCFWSCFIMDKLISFQLGR 417

>TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.283
           YLR098C
          Length = 591

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 72/361 (19%), Positives = 139/361 (38%), Gaps = 49/361 (13%)

Query: 19  ACVPCRERKRKCNGKSPCEMCVAYGYVC----------HYIDGRVPSASPQVQQVGETSP 68
           AC  CR+R+RKCN   PC  C+ +   C           Y    V S   ++  +     
Sbjct: 16  ACQNCRKRRRKCNFLIPCSNCIKFQTDCVAVNEDLRKTRYTASYVKSLEEKIAYLESNLT 75

Query: 69  DTESRPFVLPGIHRNEQPQPINTQNVTS-QNIVDPTKSRYTIQHSAVAFPRCLGLELRST 127
           +++++   +  I        + T +  S  N+    K     +++ V  P      LRS+
Sbjct: 76  ESDTKEKTIDDIKLLNSSISLATASSASLLNVPKRDKKEVKNEYNLVENP------LRSS 129

Query: 128 NPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPI-FDVVNPEQLA 186
           +   +HS +        E   +   L +L       R    +F  ++P  +  ++ E   
Sbjct: 130 SIYPMHSLSISKPFTSIEFKQTQTNLKNLTRSTAIMRSLSFFFKWLYPAHYFFIHRETFL 189

Query: 187 KNVEKYWDGDVKTLEY---GAVIAGVIALGSFFMGSLG--HPREMDIVQYAKGI------ 235
            +    + GD  T  Y     ++  + ALG+  + S    + R  +  Q +K I      
Sbjct: 190 SS----FFGDTNTKSYYCSEELVFAMSALGAKLVKSDDELYGRSTEFYQTSKSIVLKKVF 245

Query: 236 -LDDPTF------SRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHE 288
            L+D +F      S++  ++ +       I         +AW  S +   ++  IGL  +
Sbjct: 246 QLEDSSFADSTPSSKLAIIQTLLCLAFYDI---GNGENPMAWYLSGLAFRIAHEIGLQLD 302

Query: 289 IDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKET 348
            D    A SN      + +  E   R++W  +  + ++S  +GR++    +++   V ET
Sbjct: 303 PD----AWSNVYENDLSKIDFEVRSRIYWGCYIADHMISILFGRTTTL--KLSNSTVPET 356

Query: 349 D 349
           D
Sbjct: 357 D 357

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDG 51
          RV +AC  CR+RK KCNG  PC  C+     CHY DG
Sbjct: 19 RVSRACNSCRKRKVKCNGVQPCSKCITSNLRCHY-DG 54

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
           (CAT8) - Zinc-cluster protein involved in activating
           gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 3   SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           SP ++A P    RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 57  SPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 10 PHKRQ-RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID--GRVPSASPQVQQVGET 66
          P KRQ R   AC+ CR+R  KC G +PC+ CV    +C Y++   ++  ++  +QQ+ + 
Sbjct: 23 PQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKD 82

Query: 67 SPD 69
            D
Sbjct: 83 LND 85

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
          to Ashbya gossypii AFR117C
          Length = 1198

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 1  MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV--CHYID 50
          M+SPG TA   KR R+  +C  CR+RK +C+   P C  CV  G V  CHY++
Sbjct: 1  MSSPGGTA-KRKRNRIPLSCTICRKRKVRCDKTKPHCTQCVKTGVVHLCHYME 52

>Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYI 49
          R +V  ACV CR+RK KC GK PC  C++Y   C ++
Sbjct: 8  RSKVPTACVNCRKRKIKCTGKYPCTNCISYDCTCVFL 44

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 28/44 (63%)

Query: 5  GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          G++    K++++ +AC+ CRER  KC G  PC+ C+   ++C +
Sbjct: 44 GNSQQLGKKRKITRACIRCRERHIKCPGNDPCQKCLEANHICKF 87

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 16/84 (19%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQV--------G 64
           R +V KAC  CR+RK KCNGK PC  C  Y   C +   +  +    +Q+         G
Sbjct: 36  RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTTRQGGNRIKNLQKANLEGTIVQG 95

Query: 65  ETSPDTESRPFVLPGIHRNEQPQP 88
           +   D+ S P  LP      +PQP
Sbjct: 96  KEETDSSSTP--LP------KPQP 111

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 11/88 (12%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDG----RVPSASPQVQQVGETSP 68
          + +V++AC  CR RK +C+G  PC  CV+    C+Y D     + P  S ++Q   E   
Sbjct: 6  KAKVKRACQICRRRKIRCDGYLPCSSCVSLKKECNYHDSAGIKKPPLNSKKIQMYRELDS 65

Query: 69 DTESRPFVLPGIHRNEQPQPINTQNVTS 96
                 +L    + +   P+NT+ ++S
Sbjct: 66 -------ILDAFSKLKSSHPLNTEIMSS 86

>KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conserved
           hypothetical protein
          Length = 632

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 82/195 (42%), Gaps = 41/195 (21%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCV--------AYGYVCHYIDGRVPSAS----PQ 59
           KR+R  K+C  C E K KCN +SPC  C          YG+    +D +  S++    P+
Sbjct: 5   KRRRSIKSCKYCYEHKLKCNKQSPCNNCARLGITNFCVYGFKKDEVDAKPLSSTETFKPK 64

Query: 60  VQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRC 119
            Q +  +S   +++P+  P +      + ++ ++   +N  D    R  + +      +C
Sbjct: 65  DQVLKTSSTHPKTKPY-YPYLSGANAEEVLSNRHQAHKNPTDACMKRNEVTNFNKFDVKC 123

Query: 120 LGL-ELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFD 178
           + + E+ S  PP                           ++   + +  VYF  +HPI  
Sbjct: 124 MSVEEVASLIPP---------------------------SQASTFLVVDVYFHKIHPIIP 156

Query: 179 VVNPEQLAKNVEKYW 193
           V++ E++ + +E+ +
Sbjct: 157 VLDREEVFRQIEEVY 171

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
           R R+  ACV CR R  KC G +PC  C+A    C YI+
Sbjct: 69  RSRLPVACVACRRRHSKCPGGNPCSKCIAANLTCEYIE 106

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 4  PGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVC 46
          PG   L   ++R  +AC  CR +K KC+G  PC  C   GY C
Sbjct: 13 PGELVLTRTKKRHSQACDRCRSKKIKCDGLQPCSNCAKIGYNC 55

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+R+ +AC  CR++K KC+ + PC  C  Y Y C Y
Sbjct: 14 KRRRITRACDECRKKKVKCDNRHPCIHCTVYSYECTY 50

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar
           to uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8
           Zinc cluster transcriptional activator
          Length = 1206

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 3   SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           SP ++  P    RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 57  SPTASVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 33/51 (64%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQV 63
          ++RV KAC  CR+ K KC+G+ PC+ C++   +C Y +  +  +  +++++
Sbjct: 4  KKRVSKACDTCRKSKTKCDGERPCQRCLSENKICTYSNSSIGYSEGKLKKL 54

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON}
          Anc_2.565 YMR019W
          Length = 707

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          S +   +R RV+KAC  C+ RK KC+G SPC  C+ +   C Y
Sbjct: 2  SKSTTKQRLRVQKACDICKRRKVKCDGLSPCSNCIRHNVDCTY 44

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 19/116 (16%)

Query: 222 HPREMDIVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSE 281
           H +E  +  Y+  I+   TF    + E + +W+L T YLR   R    W A    + + +
Sbjct: 311 HDKEGKLFNYSYSIVSKLTF-EWESFELLQSWLLITFYLRTCHRQIACWSALGKAVTMCK 369

Query: 282 AIGLHHEIDREDIAISNNVPPKRTTVVSEHTR----RLFWCAWSINTILSYDYGRS 333
            + LH           N +P     + SE+ R      FW  + ++ ++S+  GR+
Sbjct: 370 GMSLHL----------NQLPE----IHSENDRIKAWNCFWAVFIMDKLISFQIGRA 411

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 9  LPHKR-----QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYI----DGRVPSASP 58
          +P KR      +V +AC  CR RK KC GK PC  C AY   C Y     +G +P+ +P
Sbjct: 12 MPPKRVTKSSSKVSRACDNCRRRKIKCTGKQPCSNCQAYQCHCEYSIRRGNGIIPATTP 70

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1030

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 23/36 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R +VR+AC  CR+RK KC G  PC  C AYG  C +
Sbjct: 28 RNKVRRACNNCRKRKIKCTGLHPCASCEAYGCPCIF 63

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R +V KAC  CR+RK KCNGK PC  C  Y   C +
Sbjct: 39 RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTF 74

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R +V KAC  CR+RK KCNGK PC  C  Y   C +
Sbjct: 36 RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTF 71

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQ 62
          +R  +AC+ CR RK KC+G+SPC  C  Y   C Y    V  A PQ + 
Sbjct: 12 ERAARACLNCRRRKVKCSGQSPCANCRNYNCACTYA---VSEAQPQQEH 57

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 5  GSTALPHK-----RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          G   +P K     R+RV KAC  CR +K KCNG+ PC  C  +   C Y
Sbjct: 7  GQYMMPEKSMQLPRKRVSKACDTCRAKKIKCNGEEPCSNCGKHDLECAY 55

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
           similar to Ashbya gossypii ABL121C
          Length = 1577

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 2   ASPGSTALPHK---RQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           A+PGST L        RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 108 ATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
          L  +++R   ACV CR R  KC G +PC  C+A    C YI+
Sbjct: 37 LRKRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIACEYIE 78

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R++V KAC+ CR RK KC G  PC  C AY   C +
Sbjct: 10 RKKVVKACLNCRRRKIKCTGTFPCSNCAAYQCECVF 45

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
          uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 7/56 (12%)

Query: 1  MASPGSTALPH---KRQRVRKACVPCRERKRKCN-GKSPCEMCV--AYGYVCHYID 50
          + SPG T  P    KR RV  +C  CR+RK KC+ G+  C+ CV    G++CHY++
Sbjct: 4  ITSPG-TGTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYME 58

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
          some similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 24/28 (85%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCV 40
          R+++ KAC+ C++RK+KC+G+ PC+ CV
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 24/28 (85%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCV 40
          R+++ KAC+ C++RK+KC+G+ PC+ CV
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {ON}
           Anc_4.121
          Length = 708

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 8/103 (7%)

Query: 6   STALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGE 65
           +TA   KR+R+ K+C  C   K KCN + PC  C+A G +   I G       ++Q    
Sbjct: 7   TTARVIKRKRLIKSCKYCYTHKLKCNKEKPCSKCIAVGLIDECIYG---FDKGELQNHDS 63

Query: 66  TSPDTESRPF-VLPGIHRNEQPQPINTQNVTSQNIVDPTKSRY 107
           TS    + P   LP    + + + I T N TS     P KS+Y
Sbjct: 64  TSHSESTTPSPKLPLSSNSGKVRKIKTTNKTSS----PLKSKY 102

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
          Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDG 51
          ++++AC  CR RK KC G  PC  CVAY   C Y  G
Sbjct: 11 KIKRACDNCRRRKIKCTGTQPCACCVAYQCGCVYSSG 47

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa]
          {ON} Anc_8.283 YLR098C
          Length = 664

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCVAYGYVC 46
          R AC+ CR+R+RKC+ + PC +C+ +G  C
Sbjct: 16 RLACITCRQRRRKCDMQEPCSICIKFGTRC 45

>KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 834

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 13 RQRVRK---ACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
          ++R+++   ACV CR R  KC+G+ PC  CVA    C Y++
Sbjct: 43 KRRIKRSGLACVRCRRRHAKCSGEKPCSTCVAANIACEYME 83

>Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W
          (PUT3) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
          FULL
          Length = 822

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%)

Query: 1  MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
          M   GS  +    +R   ACV CR R  KC+G +PC  C A    C Y++
Sbjct: 30 MEEIGSKGVKRSIKRSGLACVRCRRRHAKCSGDNPCTTCRAANIACEYLE 79

>TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1086

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPS 55
          R +V +AC  CR RK KC G  PC  CV Y   C +  G + S
Sbjct: 13 RSKVSRACENCRRRKIKCTGNQPCNNCVTYQCECIFSKGTLSS 55

>KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 938

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 31/70 (44%), Gaps = 5/70 (7%)

Query: 5  GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVG 64
           S  +  KR +V +AC  CR RK KC G +PC  C  Y   C Y        SP     G
Sbjct: 8  ASGVIKKKRSKVSRACNNCRRRKIKCTGANPCLNCQTYKCECTY-----NLQSPPTIGTG 62

Query: 65 ETSPDTESRP 74
          + S +T   P
Sbjct: 63 DFSLNTRGVP 72

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
           {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
           ABL121Cp and similar to YMR280C uniprot|P39113
           Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
           transcriptional activator
          Length = 1250

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 5   GSTALPHKRQ--RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           GS A P   Q  RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 87  GSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 135

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa]
          {ON} YGL013C (REAL)
          Length = 1000

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R +V KAC  CR+RK KCNGK PC  C  Y   C +
Sbjct: 36 RSKVSKACDNCRKRKIKCNGKFPCASCEIYLCECTF 71

>KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa]
          {ON} Anc_1.199 YKR064W
          Length = 835

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHYIDGRVPSASPQV 60
           KR+R    C  CR RK +C+ + PC  C  +G    C Y+D    S  PQ+
Sbjct: 13 RKRKRPTVVCTNCRRRKSRCDRERPCNTCTRFGNADSCVYLDSSPSSNEPQI 64

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 5  GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          G+  +  KR +V +AC  CR RK KC G  PC  C  Y   C Y
Sbjct: 4  GNRVVKKKRSKVSRACNNCRRRKIKCTGAQPCLNCQTYRCECTY 47

>ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {ON}
           similar to uniprot|P36023 Saccharomyces cerevisiae
           YKR064W Hypothetical ORF
          Length = 842

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 17/97 (17%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGY--VCHYIDGRVPSASPQVQQVGETSPD 69
           +R R    C  C+ RK KC+ ++PC  CV +G    CHY+     + S    Q GE   D
Sbjct: 14  RRNRPTVVCTNCKRRKSKCDRQNPCSNCVRFGNKDTCHYVQNPKNTES----QHGE---D 66

Query: 70  TESRPFVLPGIHRNEQPQPI-NTQNVTSQNIVDPTKS 105
           T+++        + +QPQ I   +N TS +IV    S
Sbjct: 67  TDNKV-------KKQQPQMIKGKRNGTSSSIVGSKAS 96

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 9   LPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV-CHYIDGR 52
           L   + RV +AC  CR +K+KC+G+ PC++C   G V C Y++ +
Sbjct: 119 LTTSKGRVSRACEFCRSKKKKCDGQQPCDLCKLVGKVPCVYLNRK 163

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
          {ON} weakly similar to uniprot|P12383 Saccharomyces
          cerevisiae YGL013C PDR1 Zinc cluster protein that is a
          master regulator involved in recruiting other zinc
          cluster proteins to pleiotropic drug response elements
          (PDREs) to fine tune the regulation of multidrug
          resistance genes
          Length = 1082

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R++V +AC  CR++K KC+G  PC+ C  YG  C Y
Sbjct: 48 RRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVY 83

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHYIDGRVPSASPQVQQ 62
          K +RV KAC  C+ RK++C G+ PC+ C   G    C Y   +VPS + +V +
Sbjct: 2  KEKRVSKACDVCKHRKKRCTGELPCDYCTRIGRTQECVY-HSKVPSKTVKVTE 53

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 3  SPGSTALPHKRQRVRK----ACVPCRERKRKCNGKSPCEMCVAYGYVCHYID--GRVPSA 56
          S  S  +  +RQR +     AC+ CR+R  KC G SPC+ C+    +C Y++   ++  +
Sbjct: 13 SKQSACVNKQRQRRQPRSAVACLSCRKRHIKCPGGSPCQKCITSNAICEYLEPSKKIVVS 72

Query: 57 SPQVQQV 63
          +  +QQ+
Sbjct: 73 TKYLQQL 79

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59
           R+ +AC  CR +K +C+GK P C  C A G+ C   D  +  A P+
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPK 109

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 18/77 (23%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQV--------- 63
          R +V KAC  CR RK KC+G+ PC  C  Y   C +    V + +P+  +V         
Sbjct: 10 RSKVSKACDNCRRRKIKCSGERPCAGCKTYNCECIF---SVSAPTPRASKVKKNKIAGIV 66

Query: 64 ------GETSPDTESRP 74
                G  SP T + P
Sbjct: 67 NHSPKNGSISPTTGNNP 83

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 8/59 (13%)

Query: 13 RQRVRK------ACVPCRERKRKCNGKSPCEMCVAYGYVCHYID--GRVPSASPQVQQV 63
          +QR RK      AC+ CR+R  KC G +PC+ C+    +C Y++   ++  ++  +QQ+
Sbjct: 21 KQRQRKQPRSAVACLSCRKRHIKCPGGNPCQKCITSNAICEYLEPSKKIVVSTKYLQQL 79

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa]
          {ON} Anc_8.845 YMR280C
          Length = 1246

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15 RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59
          RV +AC  CR +K +C+G+ P C  C A G+ C   D  +  A P+
Sbjct: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPR 72

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGR 52
          KR RV  AC  CR +K+KC+G+ PC++C      C Y D R
Sbjct: 20 KRLRVSHACDNCRLKKKKCDGQQPCKLCKNSENECIYSDRR 60

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59
           R+ +AC  CR +K +C+GK P C  C A G+ C   D  +  A P+
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPK 110

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59
           R+ +AC  CR +K +C+GK P C  C A G+ C   D  +  A P+
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPK 109

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59
           R+ +AC  CR +K +C+GK P C  C A G+ C   D  +  A P+
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPK 110

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa]
          {ON} Anc_4.113
          Length = 1043

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 21/34 (61%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +V KAC  CR+RK KC GK PC  C AY   C Y
Sbjct: 43 KVSKACDNCRKRKIKCTGKQPCATCEAYQCPCIY 76

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDG-RVPSA--SPQVQQVGET-S 67
          +R RV++AC  C++RK KC+G  PC  C+     C Y    ++P+   SP +    +T S
Sbjct: 17 QRLRVQRACAICKKRKVKCDGMKPCSNCIKRSKDCTYTTAYKIPNMKYSPSLSPSSKTHS 76

Query: 68 PDTESRP 74
             E+ P
Sbjct: 77 VSIENSP 83

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 42/108 (38%), Gaps = 11/108 (10%)

Query: 225 EMDIVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIG 284
           E  +  Y+  I+   TF    + E + +W+L T YLR   R   +W A    I+L   + 
Sbjct: 380 EDSMFNYSYSIISKLTF-EWESFELIQSWLLITFYLRTCYRQTSSWHALGQAINLCNGMS 438

Query: 285 LHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
           LH           N  P   +          FW  + I+  +S+  GR
Sbjct: 439 LH----------LNEFPHIHSKYEESKLFHCFWACFIIDKFISFQLGR 476

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa]
          {ON} 
          Length = 978

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY--IDGRVP 54
          K+ R  +AC  CR RK KC+G  PC  C  YG +C +  ++G  P
Sbjct: 10 KKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGCLCVFEPVNGMTP 54

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 7/71 (9%)

Query: 2  ASPGSTALPHK----RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSAS 57
          A P +TA  ++    R RV+KAC  C++RK KC+G  PC  C  +   C Y D +V +  
Sbjct: 10 ALPTNTAASNENSKTRLRVQKACELCKKRKVKCDGNKPCLNCSKHQKECRY-DFKVTNRR 68

Query: 58 PQVQQVGETSP 68
           + +Q   TSP
Sbjct: 69 RRRRQA--TSP 77

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 47/114 (41%), Gaps = 14/114 (12%)

Query: 221 GHP--REMDIVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIH 278
           G P   EM + +YA  I++  TF    + E + +W+L   Y R   R    W A    ++
Sbjct: 430 GKPFIEEM-MFEYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVN 487

Query: 279 LSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
           +   + L+           N  P   +T         FWC + ++ ++S+  GR
Sbjct: 488 MCNGMTLY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQTGR 531

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 50/120 (41%), Gaps = 13/120 (10%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVG-ETSPDTE 71
           R+RV KAC  CR +K KC+G  PC  C      C Y         P  +    +   D  
Sbjct: 7   RKRVSKACDACRAKKIKCDGCDPCSNCKKVSQECGYTYVVKKRQKPPTRVSNRKILADLS 66

Query: 72  SRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCLGLELRSTNPPR 131
            R   L GI    +  P+N  + +    +  + S++   H+A A       ELRS NP R
Sbjct: 67  QRLVRLEGILTQIRDGPLNLDDAS----IAESDSKF---HAAPALA-----ELRSANPLR 114

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 23/42 (54%)

Query: 7  TALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          T +     +V KAC  CR+RK KC GK PC  C AY   C Y
Sbjct: 31 TKIKKPAAKVSKACDNCRKRKIKCTGKMPCPTCEAYQCPCIY 72

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
          similarities with uniprot|P35995 Saccharomyces
          cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQVQQVGETS 67
          +P  R +  ++C+ C+ RK+KC+ K+P C  C+  GY C Y      + + Q Q V  T 
Sbjct: 1  MPKSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIY------NVNLQSQLVDGTK 54

Query: 68 PDTESRPFVLPGI 80
            ++S+     GI
Sbjct: 55 QLSKSQLIAKIGI 67

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 5   GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASP 58
           G+  L   R R  +AC+ CR+RK +C+G+ PC  C      C Y   R P   P
Sbjct: 52  GTNELKPTRGRAHRACMACRKRKVRCSGQIPCRFCHTNKLECTY--DRPPRKPP 103

>TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.61
          YOR172W
          Length = 878

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 32/66 (48%), Gaps = 11/66 (16%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGY-VCHYIDGRVPSASPQVQQVGET 66
          L  KR+ + K C  CR+RK KC+ + P C  CV      C YIDG            G T
Sbjct: 15 LKKKRRTIIKTCTFCRKRKLKCDKRKPRCSSCVTRNLPECVYIDG---------TGSGAT 65

Query: 67 SPDTES 72
          SPDT S
Sbjct: 66 SPDTPS 71

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPD 69
           R RV+KAC  C++RK KC+G +PC  C  +   C Y D +  +   + +QV     D
Sbjct: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY-DFKATNRKRRRRQVASAVRD 135

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 11/108 (10%)

Query: 225 EMDIVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIG 284
           E ++ +YA  I++  TF    + E + +W+L T Y R   R    W A    +++   + 
Sbjct: 492 EENLFKYAYLIINTLTF-EWESFELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMS 550

Query: 285 LHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
           L+           N  P   +T         FWC + ++ ++S+  GR
Sbjct: 551 LY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGR 588

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
          Anc_1.380
          Length = 1478

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 2  ASPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          A+  ST +  KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 25 ANGTSTKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYME 76

>SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 833

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 11 HKRQ--RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASP 58
           K+Q  +V +AC  CR+RK KC+G  PC  C  Y  VC Y   R  +  P
Sbjct: 15 QKKQPDKVFRACKSCRKRKIKCSGFQPCSNCEVYKCVCEYKAKRPAAKLP 64

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 9  LPHKRQRVRK---ACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
          L  K+++V++   AC  CR R  KC G +PC  C+  G  C Y++
Sbjct: 32 LNDKKKKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVACEYVE 76

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920
          aa] {ON} YMR019W (REAL)
          Length = 920

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R RV+KAC  C++RK KC+G  PC  C  +   C Y
Sbjct: 50 RLRVQKACELCKKRKVKCDGNKPCLNCFKHQKECRY 85

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 43/108 (39%), Gaps = 11/108 (10%)

Query: 225 EMDIVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIG 284
           E  + +YA  I+   TF    + E + +W+L   Y R   R    W A    +++   + 
Sbjct: 460 EERMFKYAYSIISTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMCNGMS 518

Query: 285 LHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
           L+           N  P   +T         FWC + ++ ++S+  GR
Sbjct: 519 LY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGR 556

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
           R+RV KAC  CR +K +CNG+ PC  C  +   C Y
Sbjct: 74  RKRVSKACDICRAKKIRCNGEEPCVNCEKFNLGCTY 109

>KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp,
          566 aa] {ON} highly similar to uniprot|Q04176
          Saccharomyces cerevisiae YDR397C NCB2 Beta subunit of
          the NC2 dimeric histone-fold complex represses RNA
          polymerase II transcription through binding to TBP and
          inhibition of TFIIA and TFIIB homologous to the Dr1
          subunit of the mammalian NC2 (negative
          cofactor2)[INTRON]
          Length = 566

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 19 ACVPCRERKRKCNGKSPCEMCVAYGYVC 46
          AC  CR+R+RKCN +SPC  C  YG  C
Sbjct: 17 ACQSCRKRRRKCNLESPCSNCQKYGVEC 44

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
           KR R+  +C  CR+RK KC+ K P C  C   G  ++CHY++
Sbjct: 110 KRNRIPLSCTICRKRKVKCDKKRPHCNQCTKTGVSHLCHYME 151

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 1  MASP-GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          MA P    A    + RV +AC  CR+RK KC+G  PC  C+    VC Y
Sbjct: 1  MAPPLAKKAKLAGKDRVIRACDVCRKRKVKCDGDQPCSSCMTASTVCIY 49

>Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]
          {ON} complement(116430..119819) [3390 nt, 1130 aa]
          Length = 1129

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R +V +AC  CR RK KC+G  PC  C+ Y   C +
Sbjct: 33 RSKVSRACEGCRRRKIKCSGNWPCSSCITYDCECIF 68

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
          conserved hypothetical protein
          Length = 955

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVC-HYIDGRV 53
          + HKRQR   +CV C +RK KC+   P CE C   G+ C ++++ RV
Sbjct: 35 IQHKRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWECLYFLNARV 81

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
           YMR280C
          Length = 1301

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59
           RV +AC  CR +K +C+GK P C  C A G+ C   D     A P+
Sbjct: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 9/63 (14%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYI--------DGRVPSASPQVQQ 62
          KR+++ KACV CR+RK KC+   P C+ C +    C Y         D  + +  P +Q 
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNCIYTNQYNFDLSDAELFANQPNIQL 65

Query: 63 VGE 65
          + E
Sbjct: 66 LNE 68

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1270

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
          KR+    AC+ CR+R  KC+G +PC  C+ +   C YI+
Sbjct: 21 KRRPKSLACILCRKRHIKCSGGNPCARCIKHDLKCEYIE 59

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
          homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVC-HYIDGRV 53
          HKRQR    C+PC +RK KCN   P C+ C    Y C ++++ RV
Sbjct: 29 HKRQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYFVNDRV 73

>Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON}
          (69833..73657) [3825 nt, 1275 aa]
          Length = 1274

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 1  MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          M +  +  +  KR R+  +C  CR+RK KC+   P C  C+  G  ++CHY++
Sbjct: 1  MNTEAAGKVKRKRNRIPLSCTICRKRKVKCDKTHPHCNQCIKTGVHHLCHYME 53

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
           KR RV   C  CR RK +C+  +PC  CVA    C Y
Sbjct: 67  KRNRVSYVCYACRRRKTRCDRGNPCSKCVALSTECVY 103

>CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON}
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064w
          Length = 891

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 6/88 (6%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYG--YVCHYIDGRVPSASPQVQQVGETSPDT 70
          R+R    CV CR+RK KC+ + PC  C+ +G    C Y++  VP          + +P++
Sbjct: 11 RRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDTCTYLND-VPIGKKNNVPNTQVTPNS 69

Query: 71 ESRPFVLPGIHRNEQPQPINTQNVTSQN 98
           S P ++  +H+N       T+N+  Q+
Sbjct: 70 SS-PSIVINLHQN--GNDYKTKNLNGQD 94

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 80/368 (21%), Positives = 134/368 (36%), Gaps = 46/368 (12%)

Query: 17  RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQV------------- 63
           R AC+ CR +++KCN KSPC  C   G  C +    + S    V  +             
Sbjct: 18  RLACLHCRHKRKKCNMKSPCSNCQRAGMKCIFTHEDLRSKRKSVSYLTTLEEHIATLESS 77

Query: 64  ---GETSPDTESRPFVLPGIHRNEQPQPINTQN---VTSQNIVDPTKSRYTIQHSAVAFP 117
                 +P    R   L  I   E  +  +      ++ +   D T S   +  + VA P
Sbjct: 78  IVKAREAPTEAERVDALRLISLFEDSKENSATGMSPLSYETSRDVTPSNLILSQNHVAAP 137

Query: 118 RCLGLELRSTNPPRLHSF-AWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPI 176
           +   LE  S  P    S  A       E    +   + +L       R   ++F  ++P 
Sbjct: 138 KVHTLETNSIYPTNSLSIKAQRNHATNEARIQAQATIRNLARSPPILRSLSIFFKWLYPG 197

Query: 177 -FDVVNPEQLAKNVEKYWDGDVKTLEY---GAVIAGVIALGSFFMGSLGHPREMDIVQY- 231
            +  ++ E         + GD  T +Y     ++  + ALG+          E   V Y 
Sbjct: 198 HYMFIHRETFLSA----FFGDESTKDYYCSEELVFAISALGAKAAMVTDELHEKSEVYYH 253

Query: 232 -AKGILDDPTFSRI--PTVEQVSAWVLRTI--------YLRATSRPHVAWLASCVTIHLS 280
            AK I+    F  +     E  S+  L  I        Y  A++   +AW  S +   ++
Sbjct: 254 RAKQIVLTKVFQLVDRSLAESTSSSKLAIIQTLLCLAFYDVASAENSMAWYLSGLAFRIA 313

Query: 281 EAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRI 340
             IGLH   +  +    + +      V S    R++W  +  + ++S  +GRS  T  R+
Sbjct: 314 HEIGLHLSPEAWNHVYEDELSKMDFAVRS----RIYWGCYLADHLISVLFGRS--TSLRM 367

Query: 341 TCKPVKET 348
           +   V ET
Sbjct: 368 SNSTVPET 375

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
          YER184C (REAL)
          Length = 170

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 12 KRQ--RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +RQ  RV KAC  CR +K KC+ K PC  C+     C Y
Sbjct: 8  RRQGSRVSKACERCRRKKVKCDSKKPCFGCIGSQSKCRY 46

>ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]
          {ON} conserved hypothetical protein
          Length = 707

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKS--PCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSP 68
          ++ +R  K C  C++R+ KC  +   PCE CV +G  C Y D  + S + +   V  ++ 
Sbjct: 4  YESRRRTKPCASCKQRRLKCQYQETLPCERCVKHGIACFYPDENLRSKAQEPSGVTSSAS 63

Query: 69 D 69
          D
Sbjct: 64 D 64

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 91/396 (22%), Positives = 158/396 (39%), Gaps = 80/396 (20%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQVQQVGETSP--- 68
           R  V +AC  CR RK KC+   P C  C     VC Y        SP++++   T     
Sbjct: 2   RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLY--------SPKIRRSPLTRAHLT 53

Query: 69  DTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCLGLE----- 123
           + E+R   +  + RN         ++ +  ++   K R+  Q   + F R + +      
Sbjct: 54  EVETRLGQMEQLLRNA------FVDLDADTLL---KHRHDPQLREILFGRTVDIGALSRT 104

Query: 124 ---LRSTNPP-RLHSFAWH--------CGIRPEENPNSHVLLSD-----LVTKEEYY--- 163
              + S  PP R   F W+         G   +++P  H L+++     L+ +   Y   
Sbjct: 105 DEYMASPLPPLRQAEFQWYERRDLLTGTGFNMKQSP-LHSLVAEAQQEGLMARPSKYERM 163

Query: 164 ---------RISKVYFSVVHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGS 214
                    R  + YF   H ++ VV+  +     E         L  G ++  V+ALG+
Sbjct: 164 QLEEQSTTLRYMQAYFEHFHWLYPVVDEHEFYLLYEDPSTAPDACLWTG-LVNVVLALGA 222

Query: 215 FFMGSLGHPREMDIVQYAKGILDDPTFSR-IPTVEQVSAWVLRTI--YLRATSRPHVAWL 271
           +  G+   P    +  Y K   +     R + T ++V A  L  +  Y   T   + AW+
Sbjct: 223 WCAGA---PPAAHVFYYDKA--ESHVLGRMLRTGDRVLAIALLLMAHYNYMTHHRNTAWM 277

Query: 272 ASCVTIHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYG 331
              +   L+ ++GLH ++          +PPK+ T+     + L+W  +S  T ++ + G
Sbjct: 278 LLGLASQLATSLGLHRDL--------QGLPPKQRTLA----QILWWGIYSTTTQVALELG 325

Query: 332 RSSVTLNRI--TCKPVKETDGNFTAHLVALAHLIPQ 365
           R S  L RI  T  PV +      +HL    +L+ Q
Sbjct: 326 RPS-PLPRIGHTDVPVPDMTNPLYSHLANEVNLVIQ 360

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR280C
           (CAT8)
          Length = 1285

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1429

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          KR R+  +C  CR+RK KC+   P C  CV  G  ++CHY++
Sbjct: 37 KRNRIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQHLCHYME 78

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYIDGRVPSASPQVQQVGETSPD 69
           KR+ + K C+ CRE+K KC+ + P C  C+A  +  C Y+D    + +P VQ    +S +
Sbjct: 74  KRKTIIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVDA---NGNPLVQDFHPSSDN 130

Query: 70  TES 72
             S
Sbjct: 131 LTS 133

>Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [contig
          219] FULL
          Length = 669

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 13 RQRVRKACVPCRERKRKCNGKS--PCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDT 70
          R+R  K C  C++ K KC   S  PC+ C  +   C+Y+DGR P  + +     ET+P+T
Sbjct: 7  RKRT-KPCSNCKKNKVKCEYLSSLPCQRCARHSLKCYYLDGR-PPRNAEASSSLETNPNT 64

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
          finger transcription factor involved in the complex
          regulation of gene expression in response to levels of
          heme and oxygen; the S288C sequence differs from other
          strain backgrounds due to a Ty1 insertion in the
          carboxy terminus
          Length = 1502

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 3  SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          S  S+ +  KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 47 SSDSSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYME 97

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1581

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          S  +  KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 52 SNKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYME 99

>Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON}
          YLR256W (REAL)
          Length = 1479

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 3  SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          S  S+ +  KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 48 SSDSSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYME 98

>Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON}
          YLR256W (REAL)
          Length = 1503

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 3  SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          S  S+ +  KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 46 SSDSSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYME 96

>Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [contig
          211] FULL
          Length = 948

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY-IDGRVPSASPQVQQVGETSP 68
          H+RQR   +CVPC +RK KC  ++P C  C+   + C Y ++ R+        +V   + 
Sbjct: 26 HRRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYFLNDRISRGGHSGMEVKVENS 85

Query: 69 DTE 71
          D E
Sbjct: 86 DPE 88

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR256W
          (HAP1)
          Length = 1152

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 1  MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          M+SP +++   KR RV  +C  CR+RK KC+   P C  C   G  ++CHY++
Sbjct: 1  MSSPTASS-KRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYME 52

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911
          aa] {ON} YMR019W (REAL)
          Length = 911

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R RV+KAC  C+ RK KC+G  PC  C  +   C Y
Sbjct: 39 RLRVQKACEICKRRKVKCDGNRPCLNCSKHKKECRY 74

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 44/108 (40%), Gaps = 11/108 (10%)

Query: 225 EMDIVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIG 284
           E  + +YA  I++  TF    + E + +W+L   Y R   R    W A    +++   + 
Sbjct: 453 EEKMFKYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMCNGMS 511

Query: 285 LHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
           L+           N  P   ++         FWC + ++ ++S+  GR
Sbjct: 512 LY----------LNKFPEIHSSYDESKAWHCFWCCFIMDKLISFQMGR 549

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1445

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISD 214

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 10/101 (9%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCVAYG--YVCHYIDGRVPSASPQVQQVGETSPDT-- 70
           + ++AC  C+ RK++C+G  PCE CV  G    C Y   R+   + +V +    S  +  
Sbjct: 13  KSKRACETCKRRKKRCSGGLPCEYCVKIGNPQGCEY-KTRLTKKNVKVSERYIASLKSKI 71

Query: 71  ---ESRPFVLPGIHRNEQP--QPINTQNVTSQNIVDPTKSR 106
              E+R   L G   + +P  + I  +N   + I  P++ +
Sbjct: 72  RILENRLATLDGTKDSSKPVEEFIGEENPLIETITSPSEEK 112

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 14  QRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           +R+ +AC  CR +K +C+GK P C  C   G+ C   D
Sbjct: 102 KRISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSD 139

>TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1247

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          +  KR R+  +C  CR+RK KC+   P C+ CV  G  ++CHY++
Sbjct: 21 MKRKRNRIPLSCTICRKRKVKCDKTRPHCDQCVKTGVAHLCHYME 65

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 12/88 (13%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYIDGR--------VPSASPQVQ 61
           KR++V K+C  CR+RK KC+ K P C  C   G   C Y DG         V + SP +Q
Sbjct: 82  KRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTDGYNFDISHDDVYNKSPNLQ 141

Query: 62  QVGETSPDTESRPFVLPGIHRNEQPQPI 89
            + E   ++  +   + G  ++ +P+ +
Sbjct: 142 LLNEI--ESLKQQLKVEGTEKHLEPETL 167

>AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON}
           NOHBY711; No homolog in Saccharomyces cerevisiae
          Length = 735

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 3/67 (4%)

Query: 6   STALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYI--DGRVPSASPQVQQ 62
           S  L    +R R  C+ CR R++KC+   P C  C     +CH+   DG     SP  ++
Sbjct: 36  SRVLKKTEKRSRNGCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYDGHSPNKEE 95

Query: 63  VGETSPD 69
           VG  S D
Sbjct: 96  VGIKSND 102

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
          [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 5  GSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
           S  +  KR R+  +C  CR+RK KC+   P C  C   G  ++CHY++
Sbjct: 12 ASNKVKRKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYME 60

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa]
          {ON} 
          Length = 980

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          K+ R  +AC  CR RK KC+G  PC  C  Y   C +
Sbjct: 10 KKTRSSRACENCRARKIKCSGNQPCSNCEIYNCPCAF 46

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
          similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVC-HYIDGRV 53
          HKRQR    C+PC +RK KC+ + P C+ C+   + C ++++ RV
Sbjct: 29 HKRQRRVLNCMPCHKRKVKCSRERPSCDNCLRNSFECVYFVNDRV 73

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 5  GSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          G   +  KR R+  +C  CR+RK KC+   P C  C   G  ++CHY++
Sbjct: 37 GDGKVKRKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYME 85

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723
          bp, 1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          ++ L  KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 2  TSQLKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYME 49

>Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W
          (REAL)
          Length = 324

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 3  SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          S  S+ +  KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 48 SSESSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYME 98

>TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON}
          Anc_8.642 YPL133C
          Length = 471

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 27/42 (64%)

Query: 2  ASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYG 43
          +S  +T + HK+++  K+C+ CR     C+G++PC+ C+  G
Sbjct: 5  SSITNTGISHKKRKTGKSCIFCRRSHLVCSGQTPCQRCIRRG 46

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
          Ashbya gossypii ACL096W
          Length = 847

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
           +++R   AC+ CR+R  +C G +PC  CV+    C Y++
Sbjct: 48 ERKKRAPLACLRCRKRHVRCPGGNPCSKCVSANIACEYLE 87

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          S+ +  KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 2  SSQVKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYME 49

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
          MAL33MAL-activator protein, part of complex locus MAL3;
          nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          V+ AC  CR R+ KC+GK PC  C+ + + C Y
Sbjct: 4  VKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTY 36

>KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa]
          {ON} Anc_1.199 YKR064W
          Length = 862

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 9/69 (13%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYG--YVCHYIDGRVPSAS------ 57
          +T L  +R+R    C  CR+RK +C+ + PC  C+  G    C Y +   P+ S      
Sbjct: 4  ATGLARRRKRGTVVCTNCRKRKSRCDRQLPCNTCMRLGNSETCEYENKLNPNTSSIRVSF 63

Query: 58 -PQVQQVGE 65
           P++++V +
Sbjct: 64 APKIERVKK 72

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
          (REAL)
          Length = 469

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          V+ AC  CR R+ KC+GK PC  C+ + + C Y
Sbjct: 4  VKYACDFCRVRRVKCDGKKPCSRCIQHDFECTY 36

>NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 9/70 (12%)

Query: 7   TALPHKRQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVCHYIDGRVPSASPQVQQ 62
           T +   ++RV KAC  CR+RK KC+   P    C  C+ Y   C +  GR       V  
Sbjct: 93  TKITSGKKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLKYNANCTFKRGR-----DNVLN 147

Query: 63  VGETSPDTES 72
              TS DT S
Sbjct: 148 NRRTSDDTTS 157

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1355

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 4  PGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          PG+ A   KR R+  +C  CR+RK KC+   P C  C   G  ++CHY++
Sbjct: 8  PGA-APKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYME 56

>KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON}
          conserved hypothetical protein
          Length = 946

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYI 49
          H+RQR   +CVPC +RK KC  + P C  C+   + C Y 
Sbjct: 26 HRRQRKILSCVPCHKRKIKCTREQPSCSKCLKRNWDCSYF 65

>ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON}
          similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          +  +  KR R+  +C  CR+RK KC+   P CE C   G  ++CHY++
Sbjct: 21 ANKMKRKRNRIPLSCTICRKRKVKCDKTRPNCEQCSKTGVAHLCHYME 68

>SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 912

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
          HKR R    C  CR+RK KC+   P C  C+  G  C Y
Sbjct: 9  HKRNRFSFVCTACRKRKSKCDKTKPICNKCLEQGTKCVY 47

>TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.56
           YOR337W
          Length = 840

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 3   SPGSTALPHKRQRVRK-ACVPCRERKRKCNGKSPCEMCVAYGYVCH 47
           +P +T LP      R+ AC  CR R++KC+ + PC  CV Y   C+
Sbjct: 76  NPTTTILPSTTGVKRRLACSSCRRRRKKCDMQYPCGNCVHYKDSCN 121

>Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF}
          YLR256W (HAP1) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          78] PARTIAL
          Length = 629

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          ++ L  KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 2  TSQLKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYME 49

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 12 KRQRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHYIDGRVPSASPQVQ 61
          KR R    C+ CR RK KC+ GK  C  C+  G  C Y +    +AS +V+
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDENASKKVR 63

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 7  TALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          T +  +R++V +AC  CR+RK KC+  +PC  C  Y   C +
Sbjct: 10 TEISKRRRKVNRACDNCRKRKIKCSETTPCTNCQIYQCKCVF 51

>KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa]
          {ON} weakly similar to uniprot|Q12180 Saccharomyces
          cerevisiae YOL089C HAL9 Putative transcription factor
          containing a zinc finger overexpression increases salt
          tolerance through increased expression of the ENA1 (Na
          /Li extrusion pump) gene while gene disruption
          decreases both salt tolerance and ENA1 expression
          Length = 866

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 17/82 (20%)

Query: 3  SPGSTALPHKRQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVC----HYIDGR-- 52
          SP   +    R+RV KAC  CR+RK KC   +P    C+ C  +  VC    H   GR  
Sbjct: 5  SPSELSAFKFRKRVPKACDHCRKRKIKCGAVNPITGTCDNCTKFNTVCTFKHHDEIGRHR 64

Query: 53 -------VPSASPQVQQVGETS 67
                 + S  P+V++V E+S
Sbjct: 65 KYAELKKLQSHEPKVRKVSESS 86

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 93/239 (38%), Gaps = 53/239 (22%)

Query: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCN-------GKSPCEMCVAYGYVCHYID--G 51
           M S  +     K +R  +AC  CRERK KCN        K PCE C      C +++   
Sbjct: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60

Query: 52  RVPSASPQVQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIV---DPTKSRYT 108
           +  S SP+    G+   D + + F+      N+       QN+  ++     D +  +  
Sbjct: 61  KSRSLSPKDINYGDDGDDNKLK-FIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNA 119

Query: 109 IQHSAVAFPRCLGLELR---STNPPRLHSFAWHCGIRPE-----------ENPNSHVL-- 152
           +++ A A       E     S     ++S++     +             +NP S ++  
Sbjct: 120 LEYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASSLIAQ 179

Query: 153 -----------LSDLV--------TKEEYYRISKVYFSVVHPIFDVV-----NPEQLAK 187
                      LSD+V        T+EE  R+ +V+F  +HP F  +     NPEQL +
Sbjct: 180 LSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVR 238

>Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297W
          (REAL)
          Length = 474

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID---GRVPSA--SPQVQQVGE 65
          +K+   ++AC  CR R+ KC+GK PC  C+ +   C Y+     R P +  S  ++++ E
Sbjct: 4  NKQTCAKQACDCCRVRRVKCDGKGPCSSCLQHNLDCTYLQPFRKRGPKSIRSRSLRRIAE 63

Query: 66 TSPDTESRPFVLPGIHRNEQPQPINTQ 92
               E++  +   +   + P+ +  Q
Sbjct: 64 VQMTCENKSVMAGPVTSKKVPKKLIDQ 90

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 2  ASPGSTALPHKRQRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHYIDGRVPSASP-Q 59
          +S G  A   +R +    C  CR RK KC+ GK  C+ C   G  C   D ++  + P +
Sbjct: 5  SSAGGKAKEVRRVKTFTGCWTCRSRKVKCDLGKPTCQRCDKSGLECGGYDIKLRWSQPIR 64

Query: 60 VQQVGETSPDTES 72
              G+  P+T S
Sbjct: 65 FDNFGQVDPNTSS 77

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYIDGRVPSASPQVQQVGETSP 68
          KR RV K+C  CR RK KC+   P C  CV +G   C Y D  +      V ++    P
Sbjct: 18 KRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDRTISDKRVPVSELANAVP 76

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
          YGR288W (REAL)
          Length = 143

 Score = 38.9 bits (89), Expect = 0.008,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYI 49
          V++AC  CR R+ KC+GK PC  C+     C Y+
Sbjct: 37 VKQACDCCRVRRVKCDGKGPCGRCLQRDLNCTYL 70

>YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON}
          Putative zinc cluster protein; deletion confers
          sensitivity to Calcufluor white, and prevents growth on
          glycerol or lactate as sole carbon source
          Length = 794

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 8  ALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
           L  ++ RV KAC  C  +K KCN K PC  C+     C Y
Sbjct: 6  GLAKQKSRVTKACDRCHRKKIKCNSKKPCFGCIGSQSKCTY 46

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 4/108 (3%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY-IDGRVPSASP-QVQQVGETSP 68
           KR R+   C  CR  K KC+ + P C  CV +G  C Y ++ +    +P +   +     
Sbjct: 52  KRNRISFVCKACRRSKTKCDREKPKCGRCVQHGIACVYDVEKQAAPRNPSKDATIARLER 111

Query: 69  DTES-RPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVA 115
           D E  R   +  +   E+    + +N+  ++   P   + T+ HS V+
Sbjct: 112 DVEYWRQKAVKLMQDEEEMTKRSERNIDGRDDASPRTLKRTVSHSGVS 159

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
           R+ +AC  CR +K +C+GK P C  C   G+ C   D
Sbjct: 76  RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISD 112

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 6  STALPHKRQR-VRKACVPCRERKRKCNGKSPCEMCVAYGYVC 46
          ST    KR+R    AC  CR ++RKC+ + PC  C+ YG  C
Sbjct: 2  STITDGKRKRKAHLACQNCRIKRRKCDMERPCSNCLKYGIEC 43

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 3/49 (6%)

Query: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
           + SPG   +  KR R+   C  CR+ K KCN   P C  C   G  C Y
Sbjct: 57  ITSPGH--ITKKRNRISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFCVY 103

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
          similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206c
          Length = 832

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +  L  + QR+ +AC  C++RK KC G +PC+ C      C Y
Sbjct: 22 TNQLVARTQRLSRACDLCKKRKTKCQGGNPCQSCRKANIQCIY 64

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 12/105 (11%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVC---HYIDGRVPSASPQVQQVGE 65
           ++RV KAC  CR+RK +C+   P    C  CV +   C   H  +        + +Q  +
Sbjct: 126 KKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILRKKRKLETKQNSD 185

Query: 66  TSPDTESRP-----FVLPGIHRNEQPQPINTQNVTSQNIVDPTKS 105
            SP  +S         +P    NE  +P N+ +    +IV+   S
Sbjct: 186 KSPQAQSNGSNHVISSMPNNTANETFEPFNSNSSLESDIVNKISS 230

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 60/148 (40%), Gaps = 10/148 (6%)

Query: 4   PGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYI-----DGRVPSAS 57
           P   A+  KR ++   C  CR+ K KC+ + P C  C+  G+ C Y        + PS  
Sbjct: 13  PIGAAIGKKRNKLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQCIYDLELQPTPKNPSKD 72

Query: 58  PQVQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFP 117
             + ++ +     +S+     G +R     P++ +    Q    P      I  S + +P
Sbjct: 73  ATITRLQKELEYWKSQVMAEIGSNRETTGSPVSKRQKLDQYFTAPDPHNVIINFSNM-YP 131

Query: 118 RCLGLELRSTNPPRLHSFAWHCGIRPEE 145
           R   L +RST    L   A    IR ++
Sbjct: 132 R---LVIRSTKVRDLKPLAKVSQIRQDQ 156

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSPCEM-CVAYGYVCHYIDGRVPSASPQVQQVGET 66
           KR R+   C+ CR RK KC+ + PC + C   G  C Y   R P A  +  +V ET
Sbjct: 16 QKRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTCVYDIERQP-APRKSSKVSET 71

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON}
          similar to uniprot|P53749 Saccharomyces cerevisiae
          YNR063W Hypothetical ORF
          Length = 591

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 19 ACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGR 52
          AC+ C++RK+KC+G+ PC  C      C Y   R
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNVKCIYGTDR 35

>TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1486

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          KR R+  +C  CR+RK KC+   P C  C   G  ++CHY++
Sbjct: 11 KRNRIPLSCTICRKRKVKCDKTHPYCVQCTKTGMSHLCHYME 52

>Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii AGR061C
          Length = 627

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 53/119 (44%), Gaps = 21/119 (17%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCVAYGYVC----------HYIDGRVPSASPQV---- 60
           +++ AC  CR+R+RKC+ + PC  C  +G  C           Y  G V S    +    
Sbjct: 9   KLKLACQSCRKRRRKCDLQMPCLNCQKFGVECLPIDQDLRKKRYTTGYVQSLHSHISLLE 68

Query: 61  ---QQVGETSPDTESRPFVLPGIH---RNEQPQPINTQNVTSQNIVDPTKSRYTIQHSA 113
              +++ E + D E R  +L  I     NE+   I      S  +++ +++   ++H++
Sbjct: 69  SYMRRLKEANDDNE-RNKILASISIDDINEENATITASMADSAYLMNTSRTVGAVEHNS 126

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
          YOR363C
          Length = 1232

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY-IDGRVPSASP 58
          KR R+   C  CR+ K KC+ K P C  C+ +G  C Y I+ +V   +P
Sbjct: 44 KRNRISFVCQHCRKSKTKCDKKQPHCARCIKHGIQCVYDIEFQVKPKTP 92

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 9   LPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
           +  KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 71  MKRKRNRIPLSCTICRKRKVKCDKTRPHCDPCSKTGVAHLCHYME 115

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 39/100 (39%), Gaps = 22/100 (22%)

Query: 4   PGSTALPHKRQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVCHYIDGRVPSASPQ 59
           PG   L  +++R  KAC  CR+RK KC+  SP    C  C   G  C +I          
Sbjct: 164 PGQ--LHKEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDCIFI---------- 211

Query: 60  VQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNI 99
                 T P  + R     G   N+ P+P    N T   +
Sbjct: 212 ------TEPTKKKRKSSSEGTKVNKSPKPAAKTNSTKHKV 245

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1233

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 7  TALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          T    KR R+  +C  CR+RK KC+   P C  C   G  ++CHY++
Sbjct: 25 TKQKRKRNRIPLSCTICRKRKVKCDKIRPHCNQCTKTGVAHLCHYME 71

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 75/179 (41%), Gaps = 15/179 (8%)

Query: 156 LVTKEEYYRISKVYFSVVHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSF 215
           L ++    R    YF   HP F +++ E L        +   K  ++  +   V+A+G++
Sbjct: 260 LSSRATTSRFIDSYFQNFHPFFPLLHSETLLMLYNNQINSVAKD-QWQILFNTVLAIGAW 318

Query: 216 FMGSLGHPREMDIVQY--AKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLAS 273
            +   G   ++D+  Y  AK  L         +V  V A  L + Y +   +P+ ++   
Sbjct: 319 CLE--GDSTDIDLFYYQNAKSHLTGAKIFETGSVTLVIALHLLSQYTQWRQKPNTSFNFH 376

Query: 274 CVTIHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
             +I ++ ++GLH E+              +   V E  RR++W  +S    L+  YGR
Sbjct: 377 GHSIRMAISLGLHKELPLN----------FKDNSVKEQRRRIWWYIYSQEFHLALSYGR 425

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar to
           uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
           Positive regulator of PUT (proline utilization) genes
           zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type
          Length = 838

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 2   ASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID--GRVPSASPQ 59
            S G    P +R  +  ACV CR +  KC G  PC  C A    C Y++   ++  +   
Sbjct: 26  GSAGYVRKPPRRSTL--ACVRCRRKHVKCPGGDPCSKCSAARIACEYLEPNKKLTVSMKY 83

Query: 60  VQQVGETSPDTESRPFVLPGI 80
           +QQ+ E   D +     L  I
Sbjct: 84  LQQLQENLADLKRENVKLQSI 104

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1237

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
          +  KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY++
Sbjct: 5  MKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYME 49

>KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} similar
          to uniprot|P26370 Saccharomyces cerevisiae YDL170W UGA3
          Transcriptional activator necessary for gamma-
          aminobutyrate (GABA)-dependent induction of GABA genes
          (such as UGA1 UGA2 UGA4) zinc- finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type localized to the nucleus
          Length = 623

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59
          KR   +  CVPC+ RK++C+   P C  C   G+ C Y+  + P    Q
Sbjct: 19 KRTHRKTGCVPCKIRKKRCSEHKPVCTDCQRLGFYCVYLPEKCPKEKVQ 67

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 4/73 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHYI--DGRVPSASPQVQQVGETS 67
          KR R+   C  C++RK KC+   PC  CV  G V  C Y+      P +SP +       
Sbjct: 11 KRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCVYLTDSSGQPESSPSLNDADPLR 70

Query: 68 PDTESRPFVLPGI 80
            +     + PG 
Sbjct: 71 KQSTPAERISPGF 83

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
          K++R + AC+ CR+R  KC   +PC  C+     C YI+
Sbjct: 26 KQKRQQIACLECRKRHIKCPNGNPCFKCLKNNLKCEYIE 64

>ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar
          to gnl|GLV|KLLA0C18953g Kluyveromyces lactis
          KLLA0C18953g and some similarites with YKL015W
          uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc- finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 649

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCV 40
          ++ +KAC  C+ RK++C+G  PCE CV
Sbjct: 4  KKSKKACEICKRRKKRCSGGLPCEYCV 30

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYID 50
           R RV  +C  CR RK KC+   P C  CV  G  ++CHY++
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYME 104

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
          {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
          YMR280c CAT8 transcription factor involved in
          gluconeogenesis
          Length = 1254

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 15 RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50
          RV +AC  CR +K KC+GK P C  C   G+ C   D
Sbjct: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID---GRVPS--ASPQVQQVGETSPDTE 71
          ++AC  CR R+ KC+GK PC  C+ +   C Y+     R P    S  ++++ ET   +E
Sbjct: 10 KQACDCCRVRRVKCDGKKPCNRCLQHDLKCTYLQPLRKRGPKNIRSRSLKKIAETQMFSE 69

Query: 72 S 72
          +
Sbjct: 70 N 70

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 13  RQRVRKACVPCRERKRKCN----GKSPCEMCVAYGYVCHY 48
           ++RV KAC  CR+RK KC      K+ C+ C+ Y   C +
Sbjct: 96  KRRVSKACDHCRKRKIKCGPINPAKNKCDNCIKYSSACTF 135

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
          similar to uniprot|P35995 Saccharomyces cerevisiae
          YKL222C Hypothetical ORF and similar to uniprot|Q12340
          Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGY-VCHYIDGRVPSASPQV 60
          KR++V K+C+ CR+RK KC+ K P C  C A     C Y++       P V
Sbjct: 11 KRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDPDV 61

>Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W
          (REAL)
          Length = 801

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGY-VCHYIDGRVPSASPQVQQVGETSP 68
           KR++  K+C  CR+RK +C+ + P C  CV+ G   C Y DG   S  P   ++  ++P
Sbjct: 22 RKRRKPIKSCAFCRKRKLRCDQQKPMCLTCVSRGRPDCFYTDGFTHSIEP--NELFGSTP 79

Query: 69 DTE 71
          + E
Sbjct: 80 NIE 82

>TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 15/83 (18%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKS--PCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSP 68
          ++ ++  + CV C+ +K KC  K   PCE C+ +G  C++   +  SA+ + Q + ET  
Sbjct: 4  YESKKRTRPCVSCKRQKLKCQYKESLPCERCIKHGMACYFPTTQKQSATAK-QSLHET-- 60

Query: 69 DTESRPFVLPGIHRNEQPQPINT 91
                 VLP   R + P P+ +
Sbjct: 61 -------VLP---RYQSPPPLQS 73

>Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064W
           (REAL)
          Length = 865

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 42/109 (38%), Gaps = 28/109 (25%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHYIDGR------------VPSAS 57
           KR R+   C  C++RK KC+   PC  CV  G +  C Y+  R            +    
Sbjct: 11  KRHRITVVCTNCKKRKSKCDRIKPCGTCVRLGDMDSCVYLSDRLGQRETGPTLTGIDHLE 70

Query: 58  PQVQQVGETSPD-TESRPFVLP--------GIHRNEQPQ-----PINTQ 92
            Q+++  ET P     R F  P        G    E+P      P+N +
Sbjct: 71  KQIRRAEETGPGFIRKRRFAQPRQDKDLWQGTQEKEKPTSGYYVPVNEE 119

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 19  ACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59
           +C  CR  K+KC  + P C  CVA  Y C YI GR+P  S +
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYI-GRLPRRSKK 137

>AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR098C
          (CHA4)
          Length = 612

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
          ++++ AC  CR+R+RKC+ + PC  C  +G  C  +D
Sbjct: 8  KKLKLACQTCRKRRRKCDLQVPCVNCQKFGVECLPVD 44

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
          weakly similar to uniprot|P25611 Saccharomyces
          cerevisiae YCR106W RDS1 Regulator of drug sensitivity
          transcriptional regulator
          Length = 934

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 31/71 (43%), Gaps = 8/71 (11%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYI-DGRVPSASPQVQQ------ 62
           KR R    C  CR RK KC+ K P C  CV  G  C Y+  G   +A   +        
Sbjct: 10 QKRNRPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSAADWHISGDETSIW 69

Query: 63 VGETSPDTESR 73
           GE+   TESR
Sbjct: 70 TGESVTTTESR 80

>Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064W
          (REAL)
          Length = 889

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYG 43
          KR R+   C  C++RK KCN   PC  C+  G
Sbjct: 36 KRHRITLVCTNCKKRKSKCNRTKPCGTCIRLG 67

>TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON}
          Anc_1.199 YKR064W
          Length = 984

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 1  MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHYIDGRVP 54
          M +P S     +R R+   C  C++RK KC+   PC  C+  G    C Y++   P
Sbjct: 1  MDTPISFPPIKRRARLTVVCTNCKKRKSKCDRAKPCSHCIRLGIANECTYLNAVTP 56

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 9  LPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +P KR   + AC  CR R+RKC+ + PC  C+ +   C +
Sbjct: 36 VPRKR---KLACQSCRRRRRKCDMEKPCSNCIKFQTDCVF 72

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 11 HKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
           K +R    C+PC+ +K +CN   P C  C   G  CHY
Sbjct: 26 QKSKRTVSVCIPCKSQKLRCNKARPICSRCQRLGKHCHY 64

>Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)
          Length = 117

 Score = 37.0 bits (84), Expect = 0.022,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          K  RV +AC  C++RK KC+   PC  CV     C Y
Sbjct: 9  KSSRVSRACERCKKRKIKCDTLKPCFNCVGSQSKCTY 45

>YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON}
          PDR8Transcription factor; targets include ATP-binding
          cassette (ABC) transporters, major facilitator
          superfamily transporters, and other genes involved in
          the pleiotropic drug resistance (PDR) phenomenon
          Length = 701

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 2  ASPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCV 40
            P S+    KR++V K+C  CR+RK KC+   P C+ CV
Sbjct: 13 GEPVSSGKKGKRRKVIKSCAFCRKRKLKCSQARPMCQQCV 52

>NCAS0C05100 Chr3 complement(1038084..1041143) [3060 bp, 1019 aa]
           {ON} Anc_2.651
          Length = 1019

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 86/197 (43%), Gaps = 23/197 (11%)

Query: 167 KVYFSVVHPIFDVVNPEQLAKNVEKYWDG--DVKTLEYGAVIAGVIALGSFFMGSLGHPR 224
           +++FS+VHP F +++       +EKY     ++      A+ +  +    F    +G P+
Sbjct: 362 EIFFSLVHPYFPILHERVF---LEKYARSYRELTAPLLAAIYSLALQWWDFHPKLIGFPK 418

Query: 225 EMDIVQYAKGILDDPTFSRI--PTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEA 282
             D+V     I     F+RI  P +  V   +L    L+  S     W+ S V + L+E 
Sbjct: 419 P-DVVNKLNDIAFKSFFNRIERPKLSMVQTGLL---ILQCRSENRNNWVLSSVVVSLAEE 474

Query: 283 IGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR-SSVTLNRI- 340
           +GL   +D +D  +     PK      +  RRL W  W  +  +S +  R S + L R  
Sbjct: 475 LGLG--VDCQDWRL-----PKWE---KDLRRRLAWAVWMEDKWMSLNEARHSHLILGRNW 524

Query: 341 TCKPVKETDGNFTAHLV 357
             KP++  D   T+ ++
Sbjct: 525 MVKPLQSDDFPPTSSMI 541

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 5/43 (11%)

Query: 10  PHKRQRVRKACVPCRERKRKCNG----KSPCEMCVAYGYVCHY 48
           P+KR RV KAC  CR RK KC+     K+ C  C+    +C +
Sbjct: 154 PYKR-RVVKACYNCRRRKIKCDAIDPSKNKCSNCLKLNKICSF 195

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
          {ON} some similarities with uniprot|P25502
          Saccharomyces cerevisiae YKL015w PUT3 positive
          activator of the proline utilisation pathway
          Length = 824

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYI 49
          R AC+ CR++  KC G +PC  CV     C Y+
Sbjct: 25 RVACLRCRQKHIKCPGGNPCAKCVISSATCEYL 57

>Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa]
          {ON} complement(57391..58653) [1263 nt, 421 aa]
          Length = 420

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVA--YGYVCHYIDGRVPSAS 57
          +R++  KACV CR     CNG+ PCE C+     ++C+Y + R  SAS
Sbjct: 7  ERRKSYKACVFCRRSHLVCNGQRPCERCIKRDISHLCNY-EERGNSAS 53

>Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W
          (REAL)
          Length = 831

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDT 70
          +R R+R  C+ C+  KRKC+   P C  C  +   C Y D      S +V   G +SP T
Sbjct: 7  RRSRLRLVCLQCKRIKRKCDKLRPVCSRCQQHSLECKYEDS--ADLSSKVIASGFSSPKT 64

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPS 55
           KR R+   C  CR+ K KC+ + P C  C+ +G  C Y   + P+
Sbjct: 58  KRNRISFVCQACRKSKTKCDREKPECSRCIKHGLKCVYDVSKQPA 102

>TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa]
          {ON} Anc_1.199 YKR064W
          Length = 827

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYG--YVCHYI 49
          KR R+   C  CR RK KC+ ++PC  CV  G    C YI
Sbjct: 14 KRNRLTVVCSNCRRRKSKCDRQTPCGNCVRLGDKDTCVYI 53

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCH 47
          +R R AC  CR R++KC+   PC  C+  G  C+
Sbjct: 31 KRKRLACSNCRRRRKKCDLNFPCANCIRLGLNCN 64

>Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHYID---GRVPSAS 57
          S A   KR R+   C  C++RK KC+   PC  C   G    C Y++   G++ S S
Sbjct: 5  SQARTKKRHRITVVCTNCKKRKSKCDRTKPCGTCTRLGDADSCIYLNDNAGKLESGS 61

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 19  ACVPCRERKRKCNGKSPCEMCVAYGYVCHYID 50
           ACV CR R  KC G  PC  C +    C Y++
Sbjct: 75  ACVRCRRRHVKCPGGQPCAKCASANIACEYLE 106

>AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YKL222C and YOR172W (YRM1)
          Length = 872

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP-CEMCVAYG 43
          R++V K+CV CR+R+ KCN   P C  C+  G
Sbjct: 12 RRKVSKSCVFCRKRRVKCNKARPKCSTCIGKG 43

>Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063W
          (REAL)
          Length = 607

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCV 40
          ++ V  AC  CR RK KC+G  PCE C+
Sbjct: 9  KKTVSLACTVCRTRKLKCDGNKPCERCI 36

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 14/105 (13%)

Query: 11  HKRQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVC---HYIDGRVPSASPQVQQ- 62
           + ++RV KAC  CR+RK +C+   P    C  CV +  VC   H  +        +++Q 
Sbjct: 127 NSKKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVCTFKHRDEILQKKRKLEIKQH 186

Query: 63  -VGETSPDTESR-----PFVLPGIHRNEQPQPINTQNVTSQNIVD 101
              E SP +++         LPG + N + +  N+      NI++
Sbjct: 187 LASEKSPQSQNNVSSYASSSLPGNNDNGRFESFNSGASLESNIIN 231

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 13/106 (12%)

Query: 14  QRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDTES 72
            + +  C  C+ R+ KC+ GK  C+ C+     C Y+        P++ QV ET P+   
Sbjct: 100 NKSKNGCANCKRRRVKCDEGKPTCQKCLNMKLQCVYLP-VTARNKPKISQV-ETLPN--- 154

Query: 73  RPFVLPG---IHRNEQPQP---INTQNVTSQNIVDPTKSRYTIQHS 112
            P ++     I+ NE+ +    I  ++ +SQN + P K+  T Q S
Sbjct: 155 -PSIMTSNSTINSNEKIKSESDIKVKDNSSQNTIFPNKTSSTPQLS 199

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {ON}
           weakly similar to uniprot|Q6B2M3 Saccharomyces
           cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
           transcription factor that activates genes involved in
           multidrug resistance paralog of Yrr1p acting on an
           overlapping set of target genes
          Length = 771

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 5   GSTALPHKRQRVRK---ACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYIDG 51
           G+++ P  R+R RK   +C  CR+RK KC+ + P C  CV      C Y DG
Sbjct: 50  GASSKPSTRRRRRKVIKSCTFCRQRKMKCDQQKPMCGSCVERKLSECIYTDG 101

>Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar to
          Ashbya gossypii AFL033W
          Length = 508

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 8  ALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
          ALP  + R    C  CR +KR+C+ + P C +C  +G  C Y
Sbjct: 30 ALPKSKARSFTGCWACRFKKRRCDERRPFCSLCTKHGDSCSY 71

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
          {ON} Anc_7.17
          Length = 1022

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 2  ASPGSTALPHKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVP 54
          A+ GS     KR R+   C  CR+ K KC+ + P C  CV     C Y   + P
Sbjct: 28 AAGGSNRQIKKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLACVYDVAKQP 81

>TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON} 
          Length = 722

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 8/81 (9%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYIDGRVPSASPQVQQV------ 63
          KR++  K+C  CR RK +C+ K P C  CVA     C Y  G   +AS + +++      
Sbjct: 5  KRRKAIKSCAFCRRRKLRCDQKKPRCSTCVARNLAECVYSQGLQHNASTETRELVPLPGF 64

Query: 64 GETSPDTESRPFVLPGIHRNE 84
          GE++         L G  RN+
Sbjct: 65 GESTTTYNVTIEPLAGASRNQ 85

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 1  MASPGSTALPHKRQRVRKACVPCRERKRKCNGK----------SPCEMCVAYGYVCHYI 49
          MA    T+ P KR+  R+AC+ CRE+K KC+G+            C  C A G  C ++
Sbjct: 1  MAVADRTSDP-KRKVARRACLTCREKKIKCDGEVRASLGGSDPGICSNCAASGSKCVFV 58

>NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {ON}
           Anc_1.199
          Length = 995

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 3/49 (6%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMC--VAYGYVCHYIDGRVPSASP 58
           KR R    C  C++RK KC+   PC  C  +  G  C YI   VP   P
Sbjct: 64  KRHRSTVVCTNCKKRKSKCDRSRPCGTCKRLGDGNSCFYI-PEVPKVKP 111

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 102/254 (40%), Gaps = 20/254 (7%)

Query: 100 VDPTKSRYTIQHSAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENP--NSHVLLSDLV 157
            D     Y    S ++  R +G + +   P R      +     EE P   SH   S  +
Sbjct: 177 TDLNNKGYFGSKSQISHLRSIGFDSQQFQPTRRKITTINYNNVKEELPLNGSH---SHYI 233

Query: 158 TKEEYYRISKVYFSVVHPIFDVVNPEQLAKNVEKYWDGDV---------KTLEYGAVIAG 208
           + E      + YF   H  + ++N E   K +  +              +      +   
Sbjct: 234 SLEMESSFIESYFRNFHVYYPILNKESFMKRIRSHQSNTNNNHTTNDDDEFFFQNILYNM 293

Query: 209 VIALGSFFMGSLGHPREMDIVQYAKGI--LDDPTFSRIPTVEQVSAWVLRTIYLRATSRP 266
           V+A+GS+ +      +++D + Y K I  +D   F    ++  + A+ L + Y + T  P
Sbjct: 294 VLAIGSWCLEEYSK-KKIDSIFYTKAINSIDGQIFEN-GSIILIIAFYLLSKYCQWTENP 351

Query: 267 HVAWLASCVTIHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTIL 326
           + +++    +I ++ +IGL  E+  + I  S++       V  E  RR++WC  + +  L
Sbjct: 352 NSSYIYIGHSIKMAISIGLFKELPEKSIPSSSSSSSSSNIV--EQRRRIWWCLSNHDFQL 409

Query: 327 SYDYGRSSVTLNRI 340
           S  + R S   N I
Sbjct: 410 SILFDRPSQISNHI 423

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
          to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
          weakly similar to YAL051W uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 975

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
          KRQR+   C  CR+ K KC+ + P C  CV Y   C Y
Sbjct: 27 KRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKCVY 64

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 14/97 (14%)

Query: 238 DPTFSRIPTVEQVSAWVLRTIYLRATSRPHV--AWLASCVTIHLSEAIGLHHEIDREDIA 295
           D  F+    +E +S  +L  IY  +  RP+V   W      + L+  +GLH E       
Sbjct: 418 DSLFATTDRLEGLSGTLLLAIY--SLMRPNVPGVWYIMGSVLRLTVDLGLHTE------K 469

Query: 296 ISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332
           ++ N  P       E  RRLFWC +S++  +   +GR
Sbjct: 470 LNRNYDP----FTRELRRRLFWCVYSLDRQICSYFGR 502

>KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} similar
          to uniprot|P53749 Saccharomyces cerevisiae YNR063W
          Hypothetical ORF
          Length = 612

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 6  STALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYG 43
          + A   KR+  R+AC+ C+ +K KC+G  PC  C   G
Sbjct: 2  TAARSGKRKVGRRACMLCKLKKLKCDGNYPCGRCAKSG 39

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 5  GSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCH 47
          G   LP   +R R AC  CR+R++KC+   PC  CV     C+
Sbjct: 47 GQLGLP---KRKRLACTNCRKRRKKCDLSYPCASCVRLRIDCN 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,402,820
Number of extensions: 2336646
Number of successful extensions: 7600
Number of sequences better than 10.0: 598
Number of HSP's gapped: 7783
Number of HSP's successfully gapped: 615
Length of query: 546
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 431
Effective length of database: 40,294,809
Effective search space: 17367062679
Effective search space used: 17367062679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)