Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR378Wna 1ON51551526330.0
Smik_15.560na 1ON51651624600.0
Skud_15.545na 1ON51651624200.0
Suva_8.435na 1ON51551323210.0
KLTH0C10560gna 1ON51551019180.0
Kwal_23.6547na 1ON51150318820.0
KLLA0B00352gna 1ON49850517660.0
TDEL0B005508.843ON5375259441e-121
Kpol_541.168.843ON5285309081e-116
SAKL0D01386g8.843ON5215228921e-114
Skud_13.4518.843ON5395358811e-112
YML116W (ATR1)8.843ON5425268781e-111
KNAG0J002608.843ON5504968711e-110
TPHA0C047908.843ON5564928651e-109
NDAI0E002808.843ON5495208641e-109
NDAI0K004008.843ON5534578611e-109
TBLA0D03280singletonON5805198631e-108
NCAS0A02540singletonON5395258601e-108
Skud_13.258.843ON5375178561e-108
Suva_13.4678.843ON5434808511e-107
Suva_13.278.843ON5534798501e-107
TBLA0D032708.843ON5505238461e-106
KAFR0B03930singletonON5555198421e-106
NCAS0B002908.843ON5425228401e-105
Kwal_27.102458.843ON5155198371e-105
KNAG0G034308.843ON5424768371e-105
Smik_13.188.843ON5455008371e-105
KNAG0D00130na 1ON5655238341e-104
NCAS0C004008.843ON5174868231e-103
Smik_13.4928.843ON5434788251e-103
YMR279C8.843ON5404788251e-103
CAGL0B02343g8.843ON5375148171e-102
KLTH0C03806g8.843ON5255228111e-101
KAFR0B039408.843ON5475348111e-101
KAFR0C04860na 1ON5345227763e-96
CAGL0L02519gna 1ON5294787371e-90
KAFR0A028408.843ON5204817362e-90
CAGL0M03003g8.843ON5585177261e-88
TBLA0C01160singletonON6004916839e-82
NDAI0K02730singletonON6045716271e-73
NCAS0A05720na 1ON5635316241e-73
TDEL0G04950singletonON5124964532e-49
SAKL0C06116gsingletonON1851262152e-19
Skud_6.16na 2ON5495191938e-15
Smik_6.24na 2ON5444511821e-13
SAKL0F00440gsingletonON5444871776e-13
Suva_10.11singletonON5404521722e-12
KLLA0C18931gna 3ON5532601482e-09
KLTH0H16214gsingletonON5514791482e-09
Kwal_34.15746na 3ON5184521359e-08
SAKL0C02178gsingletonON5651961223e-06
TDEL0D06610singletonON4974161196e-06
Skud_13.2442.473ON5621941171e-05
KLTH0G13464g8.272ON5933031171e-05
ZYRO0A00330gsingletonON5763241152e-05
Smik_13.2722.473ON5611811143e-05
YMR088C (VBA1)2.473ON5621911143e-05
Suva_13.2652.473ON5611941143e-05
Kwal_26.6697singletonON5773211125e-05
Kwal_56.237548.272ON5892341101e-04
KNAG0E025602.473ON5782221081e-04
SAKL0H16808g8.272ON6574001072e-04
NDAI0H022002.473ON5711941063e-04
SAKL0E04246gna 4ON5652011044e-04
ZYRO0G21868gna 5ON6203201037e-04
TDEL0C00120singletonON5693871028e-04
KLLA0F17776gna 4ON5532221028e-04
KLTH0E16720gsingletonON574494990.002
NCAS0G029902.242ON581235990.002
KLTH0C10120gsingletonON651157970.003
AGR076C8.272ON686228960.005
YPR198W (SGE1)singletonON543246960.005
YNL065W (AQR1)2.242ON586238940.007
TPHA0G031502.473ON600189940.007
NCAS0A078102.473ON568202940.008
Skud_16.503singletonON543246930.010
TPHA0F012902.242ON562132920.013
Skud_14.2672.242ON562144910.018
KLLA0D19941gsingletonON611166910.019
Suva_14.2762.242ON562133910.019
YKR105C (VBA5)singletonON582240900.021
SAKL0C05588gsingletonON677157900.021
SAKL0E08756g2.242ON565129890.027
KLLA0A04631g8.272ON579392890.028
KLTH0C10142gsingletonON573238880.035
ZYRO0C01430g8.272ON59050880.038
Smik_14.2622.242ON561144870.046
Suva_4.553na 6ON562231870.047
KLTH0B00132gsingletonON568416870.059
Kpol_543.448.272ON64350860.066
Ecym_73992.473ON563185850.080
TBLA0G025502.242ON613134840.13
NDAI0D010202.242ON592143830.14
SAKL0A00726gsingletonON598263830.15
TDEL0F039908.272ON631228830.16
NCAS0C03460na 7ON630128830.17
NDAI0D048404.30ON639146830.18
KLLA0E09879gsingletonON630128830.18
Kwal_23.48242.242ON553236820.20
KLTH0G09372g2.242ON551133820.21
TDEL0A024902.473ON554188810.30
KAFR0J009302.242ON566153800.33
Kpol_1039.192.242ON573133800.35
TDEL0G03260singletonON612127800.36
Kwal_33.137131.155ON500114800.38
Kwal_55.19582singletonON567112800.39
KLTH0E04400gna 8ON490238790.45
Skud_2.423na 6ON560337790.53
KLLA0F03311g2.242ON542229780.59
SAKL0A08228gsingletonON569254780.60
Suva_12.245na 9ON591116780.65
Kwal_26.6686singletonON56977780.66
YBR293W (VBA2)na 6ON474256770.73
Kpol_478.34.30ON580147770.90
TBLA0F030408.272ON906196770.92
Smik_16.81na 7ON625131760.98
CAGL0J09944g2.242ON592132761.0
NCAS0A022904.212ON60196761.1
KLTH0B10142gsingletonON568400761.2
Ecym_42988.272ON67847761.2
ABL040W2.473ON567260751.2
NDAI0D042204.212ON61699751.3
Kpol_467.242.473ON370206751.3
KNAG0G035308.858ON584196751.5
KLLA0F10043gna 10ON528100751.5
SAKL0F16632gsingletonON615149751.5
CAGL0J01375g2.473ON564190751.6
KLLA0D11330gsingletonON521113751.6
TPHA0A017508.272ON63641751.6
SAKL0C04708g1.155ON517113742.1
SAKL0E02992g2.473ON570198732.2
ZYRO0G21890gsingletonON576231732.3
SAKL0B12716gsingletonON632172732.3
Kwal_56.22285singletonON567112732.5
Smik_17.11singletonON544131732.6
Kwal_27.12832singletonON508238732.6
ZYRO0F02178gsingletonON59544723.0
TBLA0A08510singletonON633149723.1
SAKL0F16478gsingletonON495185723.1
TBLA0A10540singletonON493185723.1
TBLA0A08520singletonON632124723.7
TPHA0C048308.858ON598211713.9
KLLA0F13684g2.473ON571220714.0
Smik_2.434na 6ON474372714.2
KAFR0G003001.155ON481123714.2
SAKL0D02508gsingletonON57990714.6
Smik_6.1484.212ON602114714.7
KLTH0C00330gna 11ON549241704.9
KNAG0D041704.212ON59999705.0
Suva_7.3464.212ON593114706.1
TBLA0A014201.451ON572127706.2
YGR065C (VHT1)4.212ON593114706.5
ZYRO0G15422gsingletonON54244696.8
TBLA0F01600singletonON567140696.9
KNAG0I019102.242ON598154697.0
Skud_18.3singletonON590207697.2
TBLA0I026904.212ON687114697.4
Kwal_33.140541.220ON41784697.4
Skud_7.3624.212ON592114697.9
KLTH0B10054gsingletonON503273698.1
KLTH0E00462gsingletonON503273698.1
Smik_1.1singletonON594116698.1
NDAI0F038802.7ON42893688.6
Kwal_14.722singletonON61160698.6
Skud_7.560na 7ON642141688.9
Smik_11.368singletonON580240689.1
KLTH0D13442g4.212ON592111689.4
CAGL0B02079gna 7ON624131689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR378W
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...  1018   0.0  
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   952   0.0  
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   936   0.0  
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   898   0.0  
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   743   0.0  
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   729   0.0  
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   684   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   368   e-121
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   354   e-116
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   348   e-114
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   343   e-112
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   342   e-111
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   340   e-110
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   337   e-109
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      337   e-109
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               336   e-109
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   337   e-108
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   335   e-108
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   334   e-108
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   332   e-107
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   332   e-107
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   330   e-106
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   328   e-106
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      328   e-105
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   327   e-105
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   327   e-105
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   327   e-105
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   325   e-104
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      321   e-103
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   322   e-103
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   322   e-103
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   319   e-102
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   317   e-101
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   317   e-101
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     303   3e-96
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   288   1e-90
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   288   2e-90
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   284   1e-88
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   267   9e-82
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   246   1e-73
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            244   1e-73
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   179   2e-49
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...    87   2e-19
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    79   8e-15
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    75   1e-13
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    73   6e-13
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    71   2e-12
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    62   2e-09
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    62   2e-09
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    57   9e-08
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    52   3e-06
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    50   6e-06
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    50   1e-05
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    50   1e-05
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    49   2e-05
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    49   3e-05
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    49   3e-05
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    49   3e-05
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    48   5e-05
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    47   1e-04
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    46   1e-04
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    46   2e-04
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    45   3e-04
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    45   4e-04
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    44   7e-04
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         44   8e-04
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    44   8e-04
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    43   0.002
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    43   0.002
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    42   0.003
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    42   0.005
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    42   0.005
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    41   0.007
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    41   0.007
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    41   0.008
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    40   0.010
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    40   0.013
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    40   0.018
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    40   0.019
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    40   0.019
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    39   0.021
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    39   0.021
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    39   0.027
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.028
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    39   0.035
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    39   0.038
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    38   0.046
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    38   0.047
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    38   0.059
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    38   0.066
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    37   0.080
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    37   0.13 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    37   0.14 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    37   0.15 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    37   0.16 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    37   0.17 
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    37   0.18 
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    37   0.18 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    36   0.20 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    36   0.21 
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    36   0.30 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    35   0.33 
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    35   0.35 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               35   0.36 
Kwal_33.13713 s33 (361891..363393) [1503 bp, 500 aa] {ON} YCR028...    35   0.38 
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    35   0.39 
KLTH0E04400g Chr5 (397784..399256) [1473 bp, 490 aa] {ON} weakly...    35   0.45 
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    35   0.53 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    35   0.59 
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    35   0.60 
Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067...    35   0.65 
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    35   0.66 
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    34   0.73 
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    34   0.90 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    34   0.92 
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    34   0.98 
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    34   1.0  
NCAS0A02290 Chr1 complement(429274..431079) [1806 bp, 601 aa] {O...    34   1.1  
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    34   1.2  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    34   1.2  
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    33   1.2  
NDAI0D04220 Chr4 complement(987497..989347) [1851 bp, 616 aa] {O...    33   1.3  
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    33   1.3  
KNAG0G03530 Chr7 (750723..752477) [1755 bp, 584 aa] {ON} Anc_8.8...    33   1.5  
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    33   1.5  
SAKL0F16632g Chr6 complement(1375911..1377758) [1848 bp, 615 aa]...    33   1.5  
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    33   1.6  
KLLA0D11330g Chr4 (970243..971808) [1566 bp, 521 aa] {ON} simila...    33   1.6  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    33   1.6  
SAKL0C04708g Chr3 (455246..456799) [1554 bp, 517 aa] {ON} simila...    33   2.1  
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    33   2.2  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    33   2.3  
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    33   2.3  
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    33   2.5  
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    33   2.6  
Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR2...    33   2.6  
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    32   3.0  
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             32   3.1  
SAKL0F16478g Chr6 (1357813..1359300) [1488 bp, 495 aa] {ON} weak...    32   3.1  
TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON}             32   3.1  
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             32   3.7  
TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON} Anc_8...    32   3.9  
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    32   4.0  
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    32   4.2  
KAFR0G00300 Chr7 (96299..97744) [1446 bp, 481 aa] {ON} Anc_1.155...    32   4.2  
SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} simila...    32   4.6  
Smik_6.148 Chr6 complement(243915..245723) [1809 bp, 602 aa] {ON...    32   4.7  
KLTH0C00330g Chr3 (25162..26811) [1650 bp, 549 aa] {ON} similar ...    32   4.9  
KNAG0D04170 Chr4 complement(750800..752599) [1800 bp, 599 aa] {O...    32   5.0  
Suva_7.346 Chr7 complement(593271..595052) [1782 bp, 593 aa] {ON...    32   6.1  
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    32   6.2  
YGR065C Chr7 complement(618077..619858) [1782 bp, 593 aa] {ON}  ...    32   6.5  
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    31   6.8  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    31   6.9  
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    31   7.0  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    31   7.2  
TBLA0I02690 Chr9 complement(626113..628176) [2064 bp, 687 aa] {O...    31   7.4  
Kwal_33.14054 s33 complement(501910..503163) [1254 bp, 417 aa] {...    31   7.4  
Skud_7.362 Chr7 complement(605192..606970) [1779 bp, 592 aa] {ON...    31   7.9  
KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {...    31   8.1  
KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly s...    31   8.1  
Smik_1.1 Chr1 complement(4254..6038) [1785 bp, 594 aa] {ON} YAL0...    31   8.1  
NDAI0F03880 Chr6 complement(919772..921058) [1287 bp, 428 aa] {O...    31   8.6  
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    31   8.6  
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    31   8.9  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    31   9.1  
KLTH0D13442g Chr4 complement(1094195..1095973) [1779 bp, 592 aa]...    31   9.4  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    31   9.9  

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/515 (97%), Positives = 504/515 (97%)

Query: 1   MSTSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGL 60
           MSTSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGL
Sbjct: 1   MSTSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGL 60

Query: 61  GQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 120
           GQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY
Sbjct: 61  GQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 120

Query: 121 ALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGAS 180
           ALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGAS
Sbjct: 121 ALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGAS 180

Query: 181 APGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLE 240
           APGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLE
Sbjct: 181 APGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLE 240

Query: 241 RIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXX 300
           RIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR      
Sbjct: 241 RIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRAAFPLL 300

Query: 301 XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAA 360
                SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAA
Sbjct: 301 PFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAA 360

Query: 361 VTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPA 420
           VTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPA
Sbjct: 361 VTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPA 420

Query: 421 ATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYM 480
           ATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYM
Sbjct: 421 ATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYM 480

Query: 481 GIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE 515
           GIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE
Sbjct: 481 GIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE 515

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/516 (90%), Positives = 487/516 (94%), Gaps = 1/516 (0%)

Query: 1   MSTSSSVTQKNLDTNAEALKKEDKVLS-EFDIQDERPKSLLWESAFVGVLCSAQLMTQAG 59
           M+ SS VT++NLD N E LKK+D+VLS EFD+Q+E+P+SLLWESAFVGVLCSAQLMTQAG
Sbjct: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAG 60

Query: 60  LGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 119
           LGQSLAPLHIIG+SFGT N GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW
Sbjct: 61  LGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120

Query: 120 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 179
           YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA
Sbjct: 121 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 180

Query: 180 SAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLL 239
           SAPGGF LGAVFSSMLGQLAWWPWAYW+MGIACF+LAVAGY++IPHTPMP+RD +SFKLL
Sbjct: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240

Query: 240 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXX 299
           ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGT FL+IFA+IESR     
Sbjct: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRAAFPL 300

Query: 300 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 359
                 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA
Sbjct: 301 LPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360

Query: 360 AVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419
           A+ TGFLLSHTPPSTVM FAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWY 479
           AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES VNDGGA  LKGYRCSWY
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480

Query: 480 MGIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE 515
           +GIGLSG GIFVAATYA STFMKSKKR+SEKQHFIE
Sbjct: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/516 (89%), Positives = 477/516 (92%), Gaps = 1/516 (0%)

Query: 1   MSTSSSVTQKNLDTNAEALKKEDKV-LSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAG 59
           MS SS V QK+ DTN   LKK+D+V L EFDIQDE P SLLWE+AFVGVLCSAQLMTQAG
Sbjct: 1   MSISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAG 60

Query: 60  LGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 119
           LGQSLAPLHIIG SFGTTN GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW
Sbjct: 61  LGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120

Query: 120 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 179
           YALWSLLAGFSVYSN+IFFDCCRAFQGMGPAFLLPNAIAILGRTYK G+RKNMVFSLFGA
Sbjct: 121 YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA 180

Query: 180 SAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLL 239
            APGGF LGAVFSS+LGQLAWWPWAYWIMGIACF LA+AGYF+IPHT MPSR ASSFKLL
Sbjct: 181 CAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL 240

Query: 240 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXX 299
           ER+DFAGSVTGV+GLILFNFAWNQGPVVGWQTPYTY LLIVGT FL IFA+IESR     
Sbjct: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRAAFPL 300

Query: 300 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 359
                 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVA+SGFCA
Sbjct: 301 LPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA 360

Query: 360 AVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419
           A+TTG+LLS TPPSTVMLFAMTAFT GTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 361 ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWY 479
           AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES VNDGGAKPLKGYRCSWY
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480

Query: 480 MGIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE 515
           MGIGLSGLGIFVAA YAWSTF KSKKR SEKQHFIE
Sbjct: 481 MGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE 516

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/513 (85%), Positives = 472/513 (92%), Gaps = 1/513 (0%)

Query: 1   MSTSSSVTQKNLDTNAEALKKEDKVL-SEFDIQDERPKSLLWESAFVGVLCSAQLMTQAG 59
           M    SVTQKNL+T+AE  K +D+VL ++F++QDE P SL+WE+AFVGVLCSAQLMTQAG
Sbjct: 1   MPRRPSVTQKNLETSAETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCSAQLMTQAG 60

Query: 60  LGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 119
           LGQS+APLHIIG+SFGTTN GQLSWFAS+YSLTVGTFILIAGRLGDIFGH+KFF+LGFFW
Sbjct: 61  LGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFW 120

Query: 120 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 179
           YALWSLLAGFSVYSN+IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG+RKNMVFSLFGA
Sbjct: 121 YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGKRKNMVFSLFGA 180

Query: 180 SAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLL 239
           SAPGGF LGAVFSSMLGQLAWWPWAYWIMGIACF+LAVAGYFVIPH  MPSRD+ SF +L
Sbjct: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNML 240

Query: 240 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXX 299
           ER+DFAGSVTGV+GLILFNFAWNQGPVVGW+TPYTY LLIVGT FL +F +IESR     
Sbjct: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESRAAYPL 300

Query: 300 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 359
                 SSD AFVL CIAAGW+SFGIWIFYTWQFME+SR Q+PLLSSAQF+PVAISGFCA
Sbjct: 301 LPFAALSSDAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCA 360

Query: 360 AVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419
           AVTTGFLLSHTP STVMLFAMTAFTVG ILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 361 AVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWY 479
           AATIMLS+SMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES+VNDGGA  LKGYRCSWY
Sbjct: 421 AATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWY 480

Query: 480 MGIGLSGLGIFVAATYAWSTFMKSKKRISEKQH 512
           MGIGLSGLGIFVAA YA STF+KSKK+ SEKQ+
Sbjct: 481 MGIGLSGLGIFVAAVYASSTFLKSKKKASEKQY 513

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/510 (71%), Positives = 412/510 (80%), Gaps = 14/510 (2%)

Query: 14  TNAEALKKEDKVLSEFDIQDE-------------RPKSLLWESAFVGVLCSAQLMTQAGL 60
           T+ E  +K+D  L+     D+             +P+SLL E+AFVGV+C AQLMTQAGL
Sbjct: 4   TDKEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQAGL 63

Query: 61  GQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 120
           GQS+APLHIIG+SFGT N GQLSWFA+AYSLTVGTFILIAGRLGD++GHKKFF++GFFWY
Sbjct: 64  GQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWY 123

Query: 121 ALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGAS 180
           ALWSLLAGFSVYSNQIFFDCCRAFQG+GPA LLPNAIAILGRTY PGRRK M+ SLFGA+
Sbjct: 124 ALWSLLAGFSVYSNQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGRRKAMILSLFGAT 183

Query: 181 APGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLE 240
           AP GF LGAVFSS+ GQL WWPWAYW MGI CF LAVAG  VIP  P+P  D +S    +
Sbjct: 184 APAGFVLGAVFSSIFGQLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELD-TSVSTYQ 242

Query: 241 RIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXX 300
           R+D  GSVTGV+GL+L NFAWNQGPVVGWQTPYTY+LLIV   FL +FA+IESR      
Sbjct: 243 RLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESRAPHPLL 302

Query: 301 XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAA 360
                SSD AFVL C+ AGW+SFGIWI+Y W F+E+ RG +PLL+SAQF+PVAISG CAA
Sbjct: 303 PLSALSSDAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAA 362

Query: 361 VTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPA 420
           +TTGF+++    S VMLFAMTAFTVG ILIATAPV Q YWAQ FVSIIVMPWGMDMSFPA
Sbjct: 363 LTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPA 422

Query: 421 ATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYM 480
           ATIMLSDSMPHEHQGLAASLVN VVNYSISIGLG+AGT+E RVN+GGA  LKGYR +WYM
Sbjct: 423 ATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAWYM 482

Query: 481 GIGLSGLGIFVAATYAWSTFMKSKKRISEK 510
           GIGLSG GI +A  Y + TF KSKK  SEK
Sbjct: 483 GIGLSGFGILIAFMYEYHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/503 (70%), Positives = 414/503 (82%), Gaps = 3/503 (0%)

Query: 10  KNLDTNAEALKKED-KVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQSLAPLH 68
           ++L+     LK E+ + L       E+P+SL+ E+ FVG+L  AQLMTQAGL QS+AP+ 
Sbjct: 6   ESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVR 65

Query: 69  IIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 128
           IIGNSFG +N GQLSWF++AYSLTVGTFILIAGRLGD+FGHKK FV+GF WY+LWSLLAG
Sbjct: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125

Query: 129 FSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLG 188
           FSVYSNQIFFDCCRA QG+GPAFLLPN+IAILGRTY PG+RK MVFS+FGA+APGGF LG
Sbjct: 126 FSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLG 185

Query: 189 AVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSV 248
           +VFSS+  QLAWWPWAYW MG AC VL VAG  VIP  P P  D S+  +LERID AG+ 
Sbjct: 186 SVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISA-GILERIDAAGAT 244

Query: 249 TGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXXXXXXSSD 308
           TG++GL L NFAWNQGPVVGWQTPYTYALLIVG  FL++F+ IESR           S+D
Sbjct: 245 TGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESRARFPLLPFAALSTD 304

Query: 309 TAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLS 368
            A+VL CIAAGW+SFGIWIFY WQF+EDSR Q+PLL+SAQF PVAISG CAA+TTG++LS
Sbjct: 305 LAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILS 364

Query: 369 HTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDS 428
           H P   VML AM AFTVG +L+ATAP++QTYWAQTFVS+I+MPWGMDMSFPAATIM+S++
Sbjct: 365 HVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNA 424

Query: 429 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLG 488
           MPHEHQGLAASLVNTVVNYSIS+ LG AGTIE+RVN+ GA  L+GYR +WYMGIGLSGLG
Sbjct: 425 MPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLG 484

Query: 489 IFVAATYAWSTFMKSK-KRISEK 510
           + VA  YAWST  K K +++SEK
Sbjct: 485 VLVAIVYAWSTLKKFKEEQLSEK 507

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/505 (69%), Positives = 406/505 (80%), Gaps = 10/505 (1%)

Query: 7   VTQKNLDTNAEALKKEDKVLSEFDIQDERP-KSLLWESAFVGVLCSAQLMTQAGLGQSLA 65
           ++ K L+++ E    +D +L    +Q+ R   SLL E   + VLCSAQLMTQAGL QS+ 
Sbjct: 1   MSSKKLNSHEE----QDSLL----LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIV 52

Query: 66  PLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 125
           PL IIG+SFG  N GQLSWFASA+SLTVGTFILIAGRLGD FGHKKFFV+GF WYALWS+
Sbjct: 53  PLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSI 112

Query: 126 LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGF 185
           LAGFSVYSNQIFFDCCRAFQG+GPAF LPNAIAI+ RTY+PGR++NM+FSLFGA AP GF
Sbjct: 113 LAGFSVYSNQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGF 172

Query: 186 FLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245
            +GAVFSS+L + AWWPWAYWIMGI CF+L VAGY VIPH P P        L+ERID A
Sbjct: 173 VVGAVFSSLLSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP-PIHPDEKCSLVERIDVA 231

Query: 246 GSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXXXXXX 305
           GSVTGVVGLILFNFAWNQGPVVGW+T YTYALLIVG+ FL  F +IESR           
Sbjct: 232 GSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKL 291

Query: 306 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGF 365
           SSDT FV+ CIAAGW+SFGIW++YTWQ M + R Q PLLSSAQF PVAISG CAA++T F
Sbjct: 292 SSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEF 351

Query: 366 LLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIML 425
           LL+ T PSTVM+ AM AFTVG+IL+AT PV QTYWAQTFVSIIVMPWGMDMSFPAATI+L
Sbjct: 352 LLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIIL 411

Query: 426 SDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLS 485
           S +MP  HQGLAASLVNT++NYSISIGLG AGTIES+++DG    LKGYR ++YMGIGL+
Sbjct: 412 STAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLA 471

Query: 486 GLGIFVAATYAWSTFMKSKKRISEK 510
           GLG+ VA +YA   + + K+ +SEK
Sbjct: 472 GLGLGVAISYAIFHYSRLKRSLSEK 496

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  368 bits (944), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 206/525 (39%), Positives = 313/525 (59%), Gaps = 30/525 (5%)

Query: 9   QKNLDTNAEALKKEDKVLS---EFDIQDERPKSL---------LWESAFVGVLCS-AQLM 55
           +  ++ N   L +EDK+L+   E  +  E P+S           W+     + C   QL+
Sbjct: 20  ENEIERN---LSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLL 76

Query: 56  TQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 115
            QAG   +L+ + ++     +++A + SW  +++ L  G+FILI+GRLGDI+G KK  +L
Sbjct: 77  NQAGSTMTLSTMKVLERELDSSSA-KSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLL 135

Query: 116 GFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMV 173
           G+ W  +WSL+ G S +S N  FF   RAFQG+G +F+LPN + I+G  YKPG RRKN+V
Sbjct: 136 GYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIV 195

Query: 174 FSLFGASAPGGFFLGAVFSSM--LGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSR 231
            SL G  AP G   G +F+ +  + + + WPWA++   IA F+  +  YFVIP++ +P  
Sbjct: 196 ISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS-IPV- 253

Query: 232 DASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYI 291
           + + F +    D+ GS  GV GL+LFNF WNQ  VVGW T Y  ALLIV  F + +F   
Sbjct: 254 NVNKFAM----DWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIF 309

Query: 292 ESRXXXXXX--XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 349
           E +             S     +L+ + AGW SFGIWIFY +QF+   R  +P+ +   F
Sbjct: 310 EIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTF 369

Query: 350 SPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIV 409
             V+I G  AA+T GF +    P+ ++ F+M AFT G+I+++  PVH+TY+     ++++
Sbjct: 370 FMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVI 429

Query: 410 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAK 469
           + +GMD+SFPAA+I+LSD +  ++QG+A SLVNTVVNYS+S+ LGI GTIE ++N  G +
Sbjct: 430 LSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDR 489

Query: 470 PLKGYRCSWYMGIGLSGLGIFVAATYAW-STFMKSKKRISEKQHF 513
            L+G+R + Y  IG+  LGI ++  +      M+SK R   +  +
Sbjct: 490 LLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSRKENELEY 534

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  354 bits (908), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/530 (36%), Positives = 301/530 (56%), Gaps = 31/530 (5%)

Query: 4   SSSVTQKNLDTNAEALKKEDKVLSEF-DIQDERP---------------KSLLWESAFVG 47
            + + +KN++ ++     E+ + S+  D  DE P                S   E AF+ 
Sbjct: 2   DTDLKKKNIEVSSYI--AEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIF 59

Query: 48  VLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIF 107
               +QL+  AG  Q+L+ ++++     ++++ ++ W  +++ L  G+FIL++GRLGDI+
Sbjct: 60  SCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIY 118

Query: 108 GHKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKP 166
           G KK  +LG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++G  YKP
Sbjct: 119 GLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKP 178

Query: 167 GR-RKNMVFSLFGASAPGGFFLGAVFSSMLGQLAW--WPWAYWIMGIACFVLAVAGYFVI 223
           G  +KNMV S+ GA +P G  LG +FS ++   +   WPWA++   +A F+     Y+ I
Sbjct: 179 GTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSI 238

Query: 224 PHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTF 283
           P+    + +  S      +D+ GS TGV+GLILFNF WNQ P  GW + Y   LL++   
Sbjct: 239 PNNIPTNVNRLS------MDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVI 292

Query: 284 FLVIFAYIESRXXXXXX--XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQT 341
            L+ F   E R             +     +L+ +  GW SFGIW FY + F+ + R  +
Sbjct: 293 ALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYS 352

Query: 342 PLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWA 401
           PL +   +    ISG   A++ GFL+    P+ ++ F+M  F +G I+ +  PVHQTY+ 
Sbjct: 353 PLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFR 412

Query: 402 QTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES 461
               ++I++P GMD+SFPA++I+LSD++P++HQG+A SLVNTV+NYS S+ LGIAGT+E 
Sbjct: 413 NILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQ 472

Query: 462 RVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQ 511
             N  G   L+GYR + Y GI  SG+ + +A  Y   T   S K   EK 
Sbjct: 473 HCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  348 bits (892), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/522 (37%), Positives = 309/522 (59%), Gaps = 20/522 (3%)

Query: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFD-----IQDERPKSLLW-ESAFVGVLCSAQLM 55
           + S S   K L T +     E   +   D     IQD    S  W E  F+     +QL+
Sbjct: 7   NESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLL 66

Query: 56  TQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 115
            QAG  Q+L+ ++I+  +F ++ + Q +W  +++ L  G+FIL++G++GDI+G KK  ++
Sbjct: 67  NQAGTTQTLSLINILSKNFDSSTSQQ-TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125

Query: 116 GFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMV 173
           G+    +WSL+ G + Y++ + FF   RAFQG+G AF+LPN + I+G  Y  G  RKNMV
Sbjct: 126 GYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMV 185

Query: 174 FSLFGASAPGGFFLGAVFSSMLGQLA-WWPWAYWIMGIACFVLAVAGYFVIPHT-PMPSR 231
            SL GA AP G  +G +FS ++G L+  W W ++   I   +      +VIP+T P   R
Sbjct: 186 ISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVR 245

Query: 232 DASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYI 291
            +S       +D+ GS  G++G+ILFNF WNQGP+VGW T Y   LLIV    +V F   
Sbjct: 246 GSS-------MDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLY 298

Query: 292 ESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 349
           E++             +   +++ +A   GW SFGIW FY + F+ + R  TPL +   +
Sbjct: 299 ETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSY 358

Query: 350 SPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIV 409
               I G  AA++ G+ +   PPS ++  +M AF  G I+++  PV QTY+      +I+
Sbjct: 359 FMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMII 418

Query: 410 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAK 469
           + +GMD+SFPA++I+LSD +P E+QG+A SLV+T++NYS+S+ LGIAGT+E ++N  G  
Sbjct: 419 LSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDD 478

Query: 470 PLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQ 511
            LKGYR + Y+GIGL+ LG+F++A +    +++ ++R  +++
Sbjct: 479 LLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  343 bits (881), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/535 (37%), Positives = 296/535 (55%), Gaps = 40/535 (7%)

Query: 3   TSSSVTQKNLDTNAEALKKEDKVLSEFD--------------IQDERP-------KSLLW 41
           TSS V  K       ++K+EDKV+   D              I ++ P        S   
Sbjct: 14  TSSPVNDK------ISMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGK 67

Query: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101
           E  F+G    AQL+ QAG   +L  ++++  SFG+ +  Q +W  +++ L  G+FILI+G
Sbjct: 68  ELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFILISG 126

Query: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAIL 160
           RLGDI+G KK  ++G+    +WS+++G S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 127 RLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLV 186

Query: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217
           G  YK G  RKN+V S+ GA  P G   G VF  ++       WPW ++  GIA F+  +
Sbjct: 187 GHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISML 246

Query: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277
             ++ IP+    +    S      +D+ GSV  V+GLILFNF WN+ P+ GW   Y   L
Sbjct: 247 MAWYSIPNNVPTNVHGLS------MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVL 300

Query: 278 LIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFME 335
           L+V  FFLV F   E +           + +   ++  +A   GW SFGIW FY   F  
Sbjct: 301 LVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL 360

Query: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395
           + R  +P+ +   +   AI G  AA    F +    P+ ++ FA+ AF  G+I+ +  PV
Sbjct: 361 NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV 420

Query: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455
            Q+YW   F    V+ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480

Query: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEK 510
             T+E ++N  G   L+GYR + Y+GIGL+ LG+ ++ TY   T    +K+   K
Sbjct: 481 GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRK 535

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  342 bits (878), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/526 (38%), Positives = 302/526 (57%), Gaps = 22/526 (4%)

Query: 2   STSSSVTQKNLDTN-AEALKKEDKVLSEFDIQDERPK-------SLLW-ESAFVGVLCSA 52
            T   V + + D N  E+L       SE ++ D   K          W E  F+     +
Sbjct: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMIS 78

Query: 53  QLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 112
           QL+ QAG  Q+L+ ++I+ +SFG+    + SW  +++ L  G+FILI+GRLGDI+G KK 
Sbjct: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKM 137

Query: 113 FVLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RK 170
            ++G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RK
Sbjct: 138 LLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRK 197

Query: 171 NMVFSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPM 228
           N+V S  GA AP G  LG +F+ ++G      WPWA++   IA F+  V   + IP T +
Sbjct: 198 NIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST-I 256

Query: 229 PSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIF 288
           P+ +   F +    D+ GSV GV+GLIL NF WNQ P+ GW   Y   +LI+   FLV+F
Sbjct: 257 PT-NIHHFSM----DWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVF 311

Query: 289 AYIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSS 346
              E R             D   +   +A   GW SFGI+ FY +QF  + R  T L + 
Sbjct: 312 IIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAG 371

Query: 347 AQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVS 406
             +    I G  AA+  GF + +  PS  + F+M AF VG+I+ +  PVH+TY+     +
Sbjct: 372 GTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGT 431

Query: 407 IIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDG 466
           +I++ +GMD+SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E++VN  
Sbjct: 432 MIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSD 491

Query: 467 GAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQH 512
           G   LKGYR + Y+GIGL+ L   ++  Y   +F+K ++  +  ++
Sbjct: 492 GKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEY 537

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  340 bits (871), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/496 (39%), Positives = 282/496 (56%), Gaps = 16/496 (3%)

Query: 9   QKNLDTNAEALKKEDKVLSEFDIQDERPKSL--LW-ESAFVGVLCSAQLMTQAGLGQSLA 65
           +KN  T +EA    +   ++ D   + P      W E AF+     AQL+ QAG  Q+ A
Sbjct: 38  KKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATA 97

Query: 66  PLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 125
           P++I+ ++F ++ A + +W  +++ L  G+FIL++GR+GDI+G KK  + G+    +WSL
Sbjct: 98  PMNILADAFNSS-AKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSL 156

Query: 126 LAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPG 183
           + GF+ Y+ N  FF  CRAFQG+G AF+LPN + ++G  YK    RKN V S  G  AP 
Sbjct: 157 ICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPI 216

Query: 184 GFFLGAVFSSMLGQL--AWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLER 241
           G  LG V+S ++       WPW ++   I   +  V   + IP T +P+ +   F +   
Sbjct: 217 GAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPST-VPT-NIHGFGM--- 271

Query: 242 IDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXX 301
            D+ GS  GVVG+ILFNF WNQGP+ GW   Y  ALLIV  F L+ F   E +       
Sbjct: 272 -DWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLL 330

Query: 302 --XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 359
                 +     +L  +  GW SFGIW FY + F  + R  + + +   F    I G  A
Sbjct: 331 PPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIA 390

Query: 360 AVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419
           A      +    PS ++ F+MT FTVG I+++  PVHQ+YW       I++ +GMD+SFP
Sbjct: 391 AFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFP 450

Query: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWY 479
           A++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+  T E++VN  G   LKGYR + Y
Sbjct: 451 ASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALY 510

Query: 480 MGIGLSGLGIFVAATY 495
           +GIGL   G+ VA  Y
Sbjct: 511 VGIGLGACGMLVAFCY 526

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  337 bits (865), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/492 (36%), Positives = 286/492 (58%), Gaps = 18/492 (3%)

Query: 34  ERPK---SLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYS 90
           ++P+   S L E AF+      QL+ QAG  QS++ ++II   FG+  + Q +W  +++ 
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFP 124

Query: 91  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGP 149
           L  G+FIL+ GR GDI+G KK  +LG+    +WS++ G + Y++   FF   +AFQG+G 
Sbjct: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184

Query: 150 AFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYW 206
           +F+LPN I ++G  Y+PG  +KN+  S  GA AP G   G +FS ++       WPW ++
Sbjct: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244

Query: 207 IMGIACFVLAVAGYFVIP-HTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGP 265
              I  F++ V  YF +P + P  + +        ++D+ GS  GVVGL+LF+F WNQ P
Sbjct: 245 AFAIVSFLVGVTCYFFVPDNVPTNTNNL-------KMDWIGSAVGVVGLLLFSFVWNQAP 297

Query: 266 VVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIA--AGWASF 323
           + GW   Y   LL++    ++ F   E             + +   ++  +A   GW +F
Sbjct: 298 MDGWDKAYIIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTF 357

Query: 324 GIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAF 383
           GIW FY + F  + R  +P+ +   +    +SGF  A   GFL+    PS +++ ++T F
Sbjct: 358 GIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGF 417

Query: 384 TVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNT 443
           T+G ++ A  P  QTYW  TF  ++++P GMD+SFPA++I+LSD +P E+QG+A SLVNT
Sbjct: 418 TMGNLIFAVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNT 477

Query: 444 VVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKS 503
           +VNYS S  LG+A T+E ++N  G   LKGYR ++Y G+G+  LGI +A+ Y + TF   
Sbjct: 478 MVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTD 537

Query: 504 KKRISEKQHFIE 515
            K  ++  + IE
Sbjct: 538 YKEKTKLANDIE 549

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  337 bits (864), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/520 (38%), Positives = 312/520 (60%), Gaps = 19/520 (3%)

Query: 4   SSSVTQKNLDTNAEAL---KKEDKVLSEFDI-QDERPKSLLW-ESAFVGVLCSAQLMTQA 58
           SS   ++N + + + L   ++ED  + +    Q+       W E  F+     +QL+ QA
Sbjct: 32  SSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQA 91

Query: 59  GLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 118
              Q+L+ ++II +SF  +  G+ +W  +++ L  G+FILI+GR+GDI+G KK  + G+ 
Sbjct: 92  ATPQTLSIMNIITDSF-KSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYL 150

Query: 119 WYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMVFSL 176
           ++ +WSL++GF+ YS N IFF   RAFQG+G AF+LPN + I+G  YKP  +RKN+V S+
Sbjct: 151 FFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISM 210

Query: 177 FGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDAS 234
            GASAP G F+G++F+ ++G      WPWA++   IA  +      + IP+  +P+ +  
Sbjct: 211 IGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNN-IPT-NIH 268

Query: 235 SFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR 294
            F +    D+ GS+  V+GLIL NF WNQGP+VGWQ  Y   LLI+    LV+F   E +
Sbjct: 269 GFAM----DWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIK 324

Query: 295 XXXXXXXXXXXSSDTA--FVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 352
                      + +     +L+ +  GW SFGI+ FY + F+ + R  + L +   +   
Sbjct: 325 YAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMF 384

Query: 353 AISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPW 412
           AI G  AAV  G  +     S ++ F+M AF +G I+++  PV QTY+     ++I++ +
Sbjct: 385 AIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSF 444

Query: 413 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLK 472
           GMDMSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+  T+E ++N  G + LK
Sbjct: 445 GMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILK 504

Query: 473 GYRCSWYMGIGLSGLGIFVAATY-AWSTFMKSKKRISEKQ 511
           GYR + Y+G+GL+GLGI ++  Y A   + K K+R+S  +
Sbjct: 505 GYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNR 544

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  336 bits (861), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/457 (40%), Positives = 275/457 (60%), Gaps = 13/457 (2%)

Query: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101
           E  FV     A L+ QAG  Q L+ +++I +SF ++  GQ +W  +++ L  G+FILI+G
Sbjct: 75  EYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ-TWLMASFPLVSGSFILISG 133

Query: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160
           RLGDI+G K+  + GF +  +WSL+ GF+ Y++   FF   RAFQG+G +F+LPN + ++
Sbjct: 134 RLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLV 193

Query: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217
           G  YK G  RKN+V SL G  AP G   GA++  ++       WPW ++   +A  V  V
Sbjct: 194 GNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLV 253

Query: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277
            GY+ +P   +P+ + + F +    D+ GSV GV+GLILFNF WNQGP+VGW+  Y   L
Sbjct: 254 MGYYTVPDN-IPT-NVNGFTM----DWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVL 307

Query: 278 LIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFME 335
           LIV   FL+ F   E +           + +     +L+ +  GW SFGIW FY + F  
Sbjct: 308 LIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQL 367

Query: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395
           + R  +P+ S   F    I G  AA T    +    P+ ++ F+   FT G+I+++  PV
Sbjct: 368 NLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPV 427

Query: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455
           HQTYW  TF   I++ +GMD+ FPA++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+
Sbjct: 428 HQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGM 487

Query: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVA 492
             T+E ++N  G   LKGYR + Y G+G++GLG  +A
Sbjct: 488 GTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIA 524

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  337 bits (863), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/519 (36%), Positives = 300/519 (57%), Gaps = 21/519 (4%)

Query: 4   SSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQS 63
           S S    + D N+E L+ E+KVLS    ++   + L   S  V     +Q M+QAGL Q+
Sbjct: 65  SISSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFIISCMV-----SQFMSQAGLTQA 119

Query: 64  LAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 123
           L+ ++I+        + Q +W  ++++L++G+FIL++GRLGDI+G KK  + G+    +W
Sbjct: 120 LSIMNILAEELNAEKSRQ-AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIW 178

Query: 124 SLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASA 181
           SL+ GFS YS N  FF   RAFQG+G AF+LPN++ ++G  Y+PG  +KNM+    GA +
Sbjct: 179 SLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMS 238

Query: 182 PGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLL 239
           P G  LG +F+ ++G      WPW+++  GI  F   +  ++ IP+  +P+   + + L 
Sbjct: 239 PIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNN-IPT---NIYNL- 293

Query: 240 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXX 299
             +D+ G++ G+ GL++ NF +NQ P+VGWQ+ Y   LL++    LVIF   E +     
Sbjct: 294 -SMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTP 352

Query: 300 XXXXXXSSDTAFVLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGF 357
                 SS+   ++   A   GW +FG W FY + F+ + RG T   +   +    +SG 
Sbjct: 353 LIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGC 412

Query: 358 CAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMS 417
             A   GF++   PPS ++  +M  F  G +++   P+HQ+Y+      + V+P G+D+S
Sbjct: 413 AIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLS 472

Query: 418 FPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCS 477
           FPAA+I+LSD++P ++QG+A SLV T+ NYS SI LG+AG++E+  ND G   LKGYR +
Sbjct: 473 FPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNA 532

Query: 478 WYMGIGLSGLGIFVAATY---AWSTFMKSKKRISEKQHF 513
                 L+GLGI V+  Y      T  ++ K  ++ +H 
Sbjct: 533 MIFADALAGLGIIVSGIYMVINLITIRENSKSTNKPKHL 571

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  335 bits (860), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/525 (36%), Positives = 303/525 (57%), Gaps = 24/525 (4%)

Query: 3   TSSSVTQKNLDTNAEALKKE------DKVLSEFDIQDERPK---SLLWESAFVGVLCSAQ 53
           +SS+V+  N D N    +KE      D VL + D   + P    S   E  F+     A 
Sbjct: 15  SSSTVSFPNEDKNISHNEKEVYSNSTDSVLDD-DSPWQNPNYFSSKYKEYFFIFTCMVAN 73

Query: 54  LMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFF 113
           L+ QAG  Q L+ +++I  SF  +++G+ +W  +++ L  G+FILI+GR+GDI+G KK  
Sbjct: 74  LLNQAGQTQVLSTMNVISESF-HSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTM 132

Query: 114 VLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKN 171
           + G+ +  +WSLL GF+ ++ N  FF  CRAFQG+G +F+LPN + ++G  YK G  RKN
Sbjct: 133 IGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKN 192

Query: 172 MVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMP 229
           +V S+ G +AP G  +GA++  ++       WPW ++   +   V  +   + +P+  +P
Sbjct: 193 IVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNC-IP 251

Query: 230 SRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFA 289
           + +  +F +    D+ GS+ GVVGLILFNF WNQGPV GW   Y   LLI+   FLV F 
Sbjct: 252 T-NVHNFAM----DWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFV 306

Query: 290 YIESRXXXXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 347
             E +           + +     +LS +  GW +FGIW FY + F  + R  +P+    
Sbjct: 307 VYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGG 366

Query: 348 QFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSI 407
            +    I G  AA+   F +    P+ ++ F+   FT+G+++++  P+HQ YW       
Sbjct: 367 TYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQ 426

Query: 408 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGG 467
           I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NY+ S+ LG+  T+E ++N  G
Sbjct: 427 IILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSG 486

Query: 468 AKPLKGYRCSWYMGIGLSGLGIFVA-ATYAWSTFMKSKKRISEKQ 511
              LKGYR + Y+ +GL GLG  +A     ++ +MK + R+++ +
Sbjct: 487 EDLLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDRLADLK 531

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  334 bits (856), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 287/517 (55%), Gaps = 21/517 (4%)

Query: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDER---P---KSLLWESAFVGVLCSAQLM 55
           S S+       D N E +        E  +  +R   P   K+   E  F+     +QL+
Sbjct: 23  SVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLL 82

Query: 56  TQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 115
            QAG  Q+L+ ++II NSFG+ N    +W  +++ L  G+FILI+GRLGDI+G KK   +
Sbjct: 83  NQAGTTQTLSIMNIIANSFGS-NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTI 141

Query: 116 GFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMV 173
           G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V
Sbjct: 142 GYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIV 201

Query: 174 FSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFV-LAVAGYFVIPHTPMPS 230
            SL GA AP G  LG +F+ ++G      WPWA++   I   + LA++ Y +  + P   
Sbjct: 202 ISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNI 261

Query: 231 RDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAY 290
           +  S       +D+ GS  GV+GL+L NF WNQ P+ GW   Y   LL++   FLV+F  
Sbjct: 262 QHFS-------MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFII 314

Query: 291 IESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQ 348
            E+R             D   +   +A   GW SFGI+ FY +QF  + R  + + +   
Sbjct: 315 YENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGT 374

Query: 349 FSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSII 408
           +    I G  AA+  G  +    PS  +  +M AF +G+I+ +  PVH+TY+     ++I
Sbjct: 375 YFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMI 434

Query: 409 VMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGA 468
           ++ +GMD SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+ V+  G 
Sbjct: 435 ILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGK 494

Query: 469 KPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKK 505
             LKGYR + Y+GIGL+ L   ++  Y     +K  K
Sbjct: 495 HVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHK 531

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  332 bits (851), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/480 (38%), Positives = 277/480 (57%), Gaps = 13/480 (2%)

Query: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101
           E  F+     AQL+ QAG   +L  ++++  SF + +  Q +W  +++ L  G+FILI+G
Sbjct: 69  ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFPLVAGSFILISG 127

Query: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAIL 160
           RLGDI+G KK  ++G+    +WSL+ G S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 128 RLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLV 187

Query: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217
           G  YK G  RKN+V S  GA AP G   G +F  ++       WPW ++   IA F+  +
Sbjct: 188 GHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMI 247

Query: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277
             ++ IP+  +P+ +   F +    D+ GSV  V+GLILFNF WNQ P  GW T Y  AL
Sbjct: 248 LAWYSIPNN-IPT-NVHGFSM----DWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIAL 301

Query: 278 LIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFME 335
           LI+  FFLV F   E +           + +   ++  +A   GW SFGIW FY   F  
Sbjct: 302 LIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQL 361

Query: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395
           + R  +P+ +   +    I G  AA      +    P+ ++ FA+ AF VG+I+ +  PV
Sbjct: 362 NLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPV 421

Query: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455
            Q++W   F    ++ +GMD+SFPA++I+LSD +P E+QG+A SLVNTV+NYS S+ LG+
Sbjct: 422 KQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGM 481

Query: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE 515
             T+E ++N  G   LKGYR + Y+G+GL+ LG+ ++ TY   TF  +++   +     E
Sbjct: 482 GATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVITE 541

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  332 bits (850), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 183/479 (38%), Positives = 278/479 (58%), Gaps = 15/479 (3%)

Query: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101
           E  F+     +QL+ Q+G  Q+L+ ++I+ +SFG+ +A   SW  +++ L  G+FILI+G
Sbjct: 79  EYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGS-DANSRSWLMASFPLVSGSFILISG 137

Query: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAIL 160
           R+GDIFG K   ++G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+
Sbjct: 138 RMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGII 197

Query: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLGQLA--WWPWAYWIMGIACFVLAV 217
           G  Y  G  RKN+V S  GA AP G  LG  F+ ++G +    WPWA++   I   +  +
Sbjct: 198 GNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLI 257

Query: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277
              + IP+  +P+ +   F +    D+ GS  GV+GL+L N  WNQ P+ GW   Y   L
Sbjct: 258 LSIYAIPNN-IPT-NVHRFSM----DWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVL 311

Query: 278 LIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFME 335
           LI+   FLV+F   E               D   +   ++   GW SFGI+ FY +QF  
Sbjct: 312 LIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQL 371

Query: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395
           + R  TPL +   +    I G  AA+  GF +    PS  + FAM AF VG+I+ +  PV
Sbjct: 372 NIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPV 431

Query: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455
           H+TY+     ++I++ +GMD+SFPA++I+ SD +P E+QG+A SLVNTVVNYS+S+ LG+
Sbjct: 432 HETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGM 491

Query: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSK--KRISEKQH 512
             T+E +++  G   LKGYR + Y+GIGL+ L   ++  Y    ++K    K ++E + 
Sbjct: 492 GATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKR 550

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  330 bits (846), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/523 (36%), Positives = 295/523 (56%), Gaps = 24/523 (4%)

Query: 10  KNLDTNAEALKKEDKVLSEFDIQDERP---------KSLLWESAFVGVLCSAQLMTQAGL 60
           KN+D+ +       +VLS     ++           K+   E  F+      QL++QAGL
Sbjct: 33  KNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGL 92

Query: 61  GQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 120
            Q+L+ ++++     +T++ Q +W  S++ L +G+FIL++GRLGDI+G KK  + G+   
Sbjct: 93  TQTLSIMNVLAKELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIIT 151

Query: 121 ALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFG 178
            +WS++ G S Y+ N  FF   RAFQG+G AF LPN I ++G  Y+PG  RKNM+ S+ G
Sbjct: 152 TVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIG 211

Query: 179 ASAPGGFFLGAVFSSMLGQL--AWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSF 236
           A +P G  LG +F+ +  +   + WPW+++  G+  FV  +  ++ IP++ +P+      
Sbjct: 212 AMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNS-IPTNIHG-- 268

Query: 237 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXX 296
               ++D+ GSV GV GLI+ NF +NQ P+VGWQ+ Y   LL++    LVIF   E +  
Sbjct: 269 ---LKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYA 325

Query: 297 XXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAI 354
                    SS+     +L  +  GW SFGIW FY + F  + R  +PL + + +    I
Sbjct: 326 KTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVI 385

Query: 355 SGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGM 414
           SG   A+  G  +    PS +   +M  F  G I+ A  PV+QT++      + ++P GM
Sbjct: 386 SGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGM 445

Query: 415 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGY 474
           D SFPA++I+LSDS+P ++QG+A SLVNTV+NYS SI LG+AGT+E + N  G   L GY
Sbjct: 446 DFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGY 505

Query: 475 RCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISE--KQHFIE 515
           R + Y  IGL+GL + V+  Y      K +    E  KQ  IE
Sbjct: 506 RAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  328 bits (842), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/519 (38%), Positives = 303/519 (58%), Gaps = 25/519 (4%)

Query: 2   STSSSVTQKNLDTNA-EALKKEDKVLSEFDIQDERPK--SLLWESAFVGVLCS-AQLMTQ 57
            +S+SV++K    +  E    + +  S+ +   + P   S  W+     + C  + L+ Q
Sbjct: 37  DSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQ 96

Query: 58  AGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 117
           AG  Q+ + +++IG++F   ++ + +W  +++ L  G+FIL++GR+GDI+G K+  + G 
Sbjct: 97  AGQTQATSTMNVIGSAFNADSSSK-TWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGL 155

Query: 118 FWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFS 175
               +WSL+ GF+ YS+ + FF  CRAFQG+G AF+LPN + ++G  YK G  RKN+V S
Sbjct: 156 IVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVIS 215

Query: 176 LFGASAPGGFFLGAVFSSMLGQLA--WWPW---AYWIMGIACFVLAVAGYFVIPHT-PMP 229
             G  AP G   GA ++ ++   A   WPW   AY   GI   VLA+   + IP T P+ 
Sbjct: 216 CIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAI---YSIPDTVPVN 272

Query: 230 SRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFA 289
               S       +D+ GSV GV+GLILFNF WN+ P+VGW+  Y   LLI     +V+F 
Sbjct: 273 VHGFS-------MDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFF 325

Query: 290 YIESRXXXXXXX--XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 347
             E +             + +   +LS +  GW SFGIW FY + F+ + RG TPL + A
Sbjct: 326 IYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGA 385

Query: 348 QFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSI 407
                 + G  AA T  F +    PS ++  +M AFTVG+I+++  PVHQTYW  TF   
Sbjct: 386 SHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQ 445

Query: 408 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGG 467
           I++ +GMD+SFPA++I+LSD++P E+QG+A SLVNT+VNYS S+ LG+  T E +VN  G
Sbjct: 446 IILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNG 505

Query: 468 AKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKR 506
              LKGYR + Y+GIGL  +G+ +AA + + +  + + R
Sbjct: 506 TDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQKRGR 544

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  328 bits (840), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/522 (37%), Positives = 307/522 (58%), Gaps = 25/522 (4%)

Query: 2   STSSSVTQK-NLDTNAEALKKEDKVLSEFDI-QDERPK--------SLLWESAFVGVLCS 51
           S +SS+T++ ++  + +  + E  V+S+ +  Q E  K        +   E  F+     
Sbjct: 18  SAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMM 77

Query: 52  AQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKK 111
           +QL+ QA   Q+L+ ++II +SF  +  G+ +W  +++ L  G+FILI+GR+GDI+G KK
Sbjct: 78  SQLLNQAATPQTLSIMNIITDSF-NSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKK 136

Query: 112 FFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKP-GRR 169
             V G+ ++ +WS+++G + YS+   FF   RAFQG+  AF+LPN + I+G  YKP   R
Sbjct: 137 TLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNR 196

Query: 170 KNMVFSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIA-CFVLAVAGYFVIPHT 226
           KN+V S+ GASAP G F G++F+ ++G      WPWA++   IA  F LA++ Y +    
Sbjct: 197 KNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSV 256

Query: 227 PMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLV 286
           P    +   F +    D+ GSV  V+GLIL NF WNQGP+VGWQT Y  ALL+V  FFL 
Sbjct: 257 P---TNVHGFAM----DWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLA 309

Query: 287 IFAYIESRXXXXXXXXXXXSSDTAFV--LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLL 344
           +F   E +           + +   +  L+ +  GW SFGI+ FY + F+ + R  + L 
Sbjct: 310 LFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALW 369

Query: 345 SSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTF 404
           +   +   AI G  AAV  G  +     + ++  +M AF +G I+++  PV QTY+    
Sbjct: 370 AGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNL 429

Query: 405 VSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVN 464
            ++I++ +GMDMSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+  T+E ++N
Sbjct: 430 GTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQIN 489

Query: 465 DGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKR 506
             G   LKGYR + Y+GIGL+GLGI + A Y        +K+
Sbjct: 490 KSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQ 531

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/519 (36%), Positives = 297/519 (57%), Gaps = 26/519 (5%)

Query: 6   SVTQKNLDTNAEALKKEDKVLSEFDIQDER--PKSLL---------WESAFVGVLCS--A 52
           ++ + + + N E L+       E D Q E   PKS L         W+  ++ VL S  +
Sbjct: 2   NMKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKE-YIFVLSSMLS 60

Query: 53  QLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 112
           QL+ QA   Q+  PL  + +        Q  W  +++ L  G+FIL++G++GDI+G KK 
Sbjct: 61  QLLNQAATTQT-NPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKT 119

Query: 113 FVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR-K 170
            + G+    +WSL+ G S Y++ + FF   R+FQG+G AF+LPN + I+G  YKP    K
Sbjct: 120 LLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAK 179

Query: 171 NMVFSLFGASAPGGFFLGAVFSSMLG-QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMP 229
           N+VFSL GA AP G  LG VFS ++G +   W W ++   I   +  +   ++IP+  +P
Sbjct: 180 NLVFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNN-IP 238

Query: 230 SRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFA 289
           + + + +K+    D+ GS  GV GLILFNF WNQ P+ GW + Y   LLIV    L+ F 
Sbjct: 239 T-NVNEYKM----DWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFI 293

Query: 290 YIESRXXXXXXX--XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 347
             E R             +     +LS +  GW SFGIW FY   FM + R  +PL +  
Sbjct: 294 TYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGG 353

Query: 348 QFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSI 407
            +   AI G  A++  G+ +  T P+ ++  +M AF  G I++A  PVHQTY+  T   +
Sbjct: 354 TYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIM 413

Query: 408 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGG 467
           I++ +GMD+SFPAA+I+LSD +P ++QG+A SLV+T+++YS+S+ LGI+GT E +VN  G
Sbjct: 414 IILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNG 473

Query: 468 AKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKR 506
              LKGY+ + Y+GIGL+ LG+ ++  +    +  S+++
Sbjct: 474 IDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRK 512

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/476 (38%), Positives = 278/476 (58%), Gaps = 15/476 (3%)

Query: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101
           E  FVG    +QL+ QA + Q+L+ ++I+  SF  +NA   +W  +++ L  G+FILI+G
Sbjct: 68  EYIFVGTCMMSQLLNQACIPQTLSLMNILTKSF-HSNAKNQTWLMASFPLVSGSFILISG 126

Query: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160
           R+GDI+G K   V G  ++ +W+L++GF+ Y++   FF   R+FQG+G AF+LPN +  +
Sbjct: 127 RVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCV 186

Query: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAV 217
           G  YKP   RKN+V SL GA AP G F+GA F+ ++G      WPW+++ M IA  +  +
Sbjct: 187 GNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLL 246

Query: 218 AGYFVIP-HTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYA 276
              + IP H P      S       +D+ GS   VVGLIL NF WNQGP+ GW   Y   
Sbjct: 247 GALYSIPNHIPTNVHGFS-------MDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIV 299

Query: 277 LLIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFM 334
           LLIV  F L +F   E             + +   V+  +A   GW SFGI+ FY + F+
Sbjct: 300 LLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFL 359

Query: 335 EDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAP 394
            + R  + + +   +   AI G  A+V  G  +     S ++ F+M AF VG I+++  P
Sbjct: 360 LNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTP 419

Query: 395 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 454
           V QTY+     ++I++ +GMDMSFPAA I+LSDS+P+++QG+A SL NT+VNYS+S+ LG
Sbjct: 420 VKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLG 479

Query: 455 IAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEK 510
           +  T+ES++N  G   LKGYR + Y+GIG++ L + ++  Y        +K   E 
Sbjct: 480 MGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMES 535

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/500 (38%), Positives = 293/500 (58%), Gaps = 17/500 (3%)

Query: 22  EDKVLSEFDIQDERPKSLLW---ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTN 78
           ED+++ E + + + PK   +   E  F+     +QL+ QAG  Q+L+ ++I+ +SFG+  
Sbjct: 49  EDEMV-ECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEG 107

Query: 79  AGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIF 137
             + SW  +++ L  G+FILI+GRLGDI+G KK  ++G+    +WSL+ G + YS +  F
Sbjct: 108 NSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTF 166

Query: 138 FDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLG 196
           F  CRAFQG+G AF+LPN + I+G  Y  G  RKN+V S  GA AP G  LG +F+ ++G
Sbjct: 167 FIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIG 226

Query: 197 --QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGL 254
                 WPWA++   IA  +      + IP+  +P+ +   F +    D+ GSV GV+GL
Sbjct: 227 TENPNQWPWAFYAFSIASLINFGLSIYAIPNN-IPT-NIHHFSM----DWIGSVLGVIGL 280

Query: 255 ILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLS 314
           IL NF WNQ P+ GW   Y   +LI+   FL +F   E               D   +  
Sbjct: 281 ILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQI 340

Query: 315 CIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPP 372
            +A   GW SFGI+ FY +QF  + R  T L +   +    I G  AA+  GF + +  P
Sbjct: 341 MLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSP 400

Query: 373 STVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHE 432
           S  + F+M AF VG+I+ +  PVH+TY+     ++I++ +GMD+SFPA++I+ SD++P E
Sbjct: 401 SVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPME 460

Query: 433 HQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVA 492
           +QG+A SLVNTVVNYS+S+ LG+  T+E++++  G   LKGYR + Y+GIGL+ L   ++
Sbjct: 461 YQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMIS 520

Query: 493 ATYAWSTFMKSKKRISEKQH 512
             Y   +F+   K  +  ++
Sbjct: 521 GLYMVESFINDHKAKAATEN 540

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  325 bits (834), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/523 (37%), Positives = 296/523 (56%), Gaps = 18/523 (3%)

Query: 4   SSSVTQKNLDTNAEALKKEDKVLSEFD-----IQDERPKSLLWESAFVGVLCSAQLMTQA 58
            SS T+++ D N   + K      E D      +     SLL E  FV ++ S+Q++  A
Sbjct: 35  DSSKTRRDSDDNVSDINKSAPAPEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLA 94

Query: 59  GLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 118
           G  Q +  + +I   F  T+     W    Y+ T G+F+LIAG++GD+ GHK  F++G+ 
Sbjct: 95  GAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYA 154

Query: 119 WYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLF 177
           W ALWSLL GFS Y  +  FF  CRA QG+G AF   +A++ILG++Y P +RKN +FS F
Sbjct: 155 WLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPPCKRKNFIFSFF 214

Query: 178 GASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK 237
           GA    G  LG VFS++  QLA W WAYW M IAC V+ +   F IP   +   + S+  
Sbjct: 215 GACGSFGVVLGMVFSALFTQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSN-- 272

Query: 238 LLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXX 297
            +   D+ G+   V GL+LF+ AWNQ P  G+   Y Y LLIV    L +  Y+E++   
Sbjct: 273 -VFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETKVDD 331

Query: 298 XXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGF 357
                   S++T  VL  I   +ASF +W  YT++F   ++G T LL++A+ +P+A+SG 
Sbjct: 332 PLLPWTHISANTLKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGV 391

Query: 358 CAAVTTGFLLS-HTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDM 416
            AA+ +  LL+ H      ML ++ AF V  IL+AT    QTYW + FV+ IV+ +G+D+
Sbjct: 392 FAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDI 451

Query: 417 SFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI------ESRVNDGGAKP 470
           SFP+AT++LS+ +P + +GL ASLV  V+NY+ ++G   A ++      +   + G A  
Sbjct: 452 SFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFT 511

Query: 471 LKGYRCSWYMGIGLSGLGIFVAATYAWSTFMK-SKKRISEKQH 512
            K      Y+GIG +GLG  VA     + + K + K+  +++H
Sbjct: 512 -KTINIIGYVGIGTAGLGTLVAIFGVITEYPKVAGKKGEDRKH 553

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  321 bits (823), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/486 (38%), Positives = 290/486 (59%), Gaps = 15/486 (3%)

Query: 32  QDERP-KSLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYS 90
           Q+E+  +S L E  F+     A L+ QAG  Q L+ +++I  SF  ++ G  +W  +++ 
Sbjct: 29  QNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESF-HSDVGTQTWLMASFP 87

Query: 91  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGP 149
           L  G+FILI+GR+GDI+G KK  + G+ +  +W+LL GF+ Y++   FF  CRAFQG+G 
Sbjct: 88  LVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGI 147

Query: 150 AFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLGQLA--WWPWAYW 206
           +F+LPN + ++G  YK G  RKN+V SL G +AP G  +GA++  ++   +   WPW ++
Sbjct: 148 SFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFY 207

Query: 207 IMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPV 266
              +A FV  +   + +P   +P+ +  +F +    D+ G++ GVVGLILFNF WNQGPV
Sbjct: 208 AYALAAFVNLIMAIYSVPEN-VPT-NVHNFAM----DWMGAIIGVVGLILFNFVWNQGPV 261

Query: 267 VGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAF--VLSCIAAGWASFG 324
            GW  PY   LLI+   FLV F   E +           + +     +L  +  GW SFG
Sbjct: 262 NGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSFG 321

Query: 325 IWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFT 384
           IW FY + F  + R  +PL + A      I G  AA   GF ++   P+ ++ F+   FT
Sbjct: 322 IWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFT 381

Query: 385 VGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTV 444
           +G+++++  P+HQTYW       I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNT+
Sbjct: 382 MGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTI 441

Query: 445 VNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVA-ATYAWSTFMKS 503
           +NYS S+ LG+  T+E ++N  G + L+GYR + Y+ +GL GLG  VA     +  + K 
Sbjct: 442 INYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLWRKR 501

Query: 504 KKRISE 509
           K R+ +
Sbjct: 502 KSRLDD 507

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  322 bits (825), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/478 (38%), Positives = 273/478 (57%), Gaps = 14/478 (2%)

Query: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101
           E  F+     AQL+ QAG   +L  ++++  SF + +  Q +W  +++ L  G+FILI+G
Sbjct: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISG 127

Query: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160
           RLGDI+G KK  ++G+    +WS+++G S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 128 RLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLV 187

Query: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217
           G  YK G  RKN+V S+ GA AP G   G VF  ++       WPW ++   IA F+  +
Sbjct: 188 GHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLL 247

Query: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277
             ++ IP+    +    S      +D+ GS   V+GLILFNF WNQ P+ GW   Y   L
Sbjct: 248 MAWYSIPNNVPTNVHGLS------MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVL 301

Query: 278 LIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFME 335
           LI+  FFL+ F   E +           + +   ++  +A   GW SFGIW FY   F  
Sbjct: 302 LILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361

Query: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395
           + R  +P+ +   +    I G  AA    F +    P+ ++ FA+ AF  G+I+ +  PV
Sbjct: 362 NLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPV 421

Query: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455
            Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481

Query: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQHF 513
             T+E ++N  G   LKGYR + Y+GIGL+ LG+ ++ TY    F    K  SEK+  
Sbjct: 482 GVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKE-SEKKRL 538

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  322 bits (825), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/478 (38%), Positives = 275/478 (57%), Gaps = 17/478 (3%)

Query: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101
           E  F+     AQL+ QAG   +L  ++++  SF  + A   +W  +++ L  G+FILI+G
Sbjct: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSF-NSEANNQAWLMASFPLAAGSFILISG 127

Query: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160
           RLGDI+G KK  ++G+    +WS+++G S YSN   FF   RAFQG+G AF+LPN + ++
Sbjct: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187

Query: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217
           G  YK G  RKN+V S  GA AP G   G +F  ++       WPW ++  GIA F+  +
Sbjct: 188 GHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLL 247

Query: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277
             ++ IP+    +    S      +D+ GS   ++GLILFNF WNQ P+VGW  PY   L
Sbjct: 248 MAWYSIPNNVPTNIHGLS------MDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVL 301

Query: 278 LIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFME 335
           LI+   FLV F   ES+           + +   ++  +A   GW SFGIW FY   F  
Sbjct: 302 LIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361

Query: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395
           + R  +P+ +   +    I G  AA    F +    P+ ++ F++ AF  G+I+ +  PV
Sbjct: 362 NLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPV 421

Query: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455
            Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481

Query: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYA----WSTFMKSKKRISE 509
            GT+E ++N  G   LKGYR + Y+G+GL+ LG+ ++ TY     W+   KS+ R  E
Sbjct: 482 GGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  319 bits (817), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/514 (36%), Positives = 291/514 (56%), Gaps = 25/514 (4%)

Query: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLG 61
             +  V +K  DT A    ++ +    FD       S L E  F+     +QL+ QAG  
Sbjct: 29  DNNDIVDEKQCDTQAIDGNQKWQNPEYFD-------STLKEYLFLCSCFVSQLLNQAGAI 81

Query: 62  QSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 121
           Q+   ++I+ +S  + N G+ +W  +A+ L  G+FILI+GR+GDI+G KK  ++G+ +  
Sbjct: 82  QTQPIMNIVADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLI 140

Query: 122 LWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMVFSLFGA 179
           +WSL+ G + Y++   FF   RAFQG+G + +LPN + I+G  Y  G +RKNMV SL G 
Sbjct: 141 VWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGC 200

Query: 180 SAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK 237
            AP G  LGAVFS ++G      WPWA++   I   +  V   ++IP+T +P+       
Sbjct: 201 MAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT-IPTNVHG--- 256

Query: 238 LLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVG-----TFFLVIFAYIE 292
              ++D+ GS  GVVGLI+ NF WNQ P+ GW + Y   LLI+       FF+    ++ 
Sbjct: 257 --HKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVN 314

Query: 293 SRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 352
                        S  T  VL  +  GW SFGI+ FY + F  + R  TPL +   +   
Sbjct: 315 GNPLLPKEVLK--SPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMF 372

Query: 353 AISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPW 412
            I G  AA+  GF +    PS ++  +M AF  G+I+++  P+HQTY+      +I++ +
Sbjct: 373 LIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSF 432

Query: 413 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLK 472
           GMD+SFPA++I+LSD +P ++QG+A SLVNT+VNYS+S  LG+AG +E  VN+ G   LK
Sbjct: 433 GMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLK 492

Query: 473 GYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKR 506
           GYR ++Y+GIGL+ +   ++     S  ++ +K 
Sbjct: 493 GYRGAFYLGIGLASMACIISGALMLSEIIQGRKN 526

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  317 bits (811), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/522 (36%), Positives = 302/522 (57%), Gaps = 23/522 (4%)

Query: 3   TSSSVTQKNLDT--NAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGL 60
           T S +++K +D   +++ L      L   D  D++ K  L    FV     +QL+ QA  
Sbjct: 13  TGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYL----FVISSMLSQLLNQAAA 68

Query: 61  GQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 120
            Q+  PL  + +      A Q +W  +++ L  G+FIL++G++GDI+G KK  + G+   
Sbjct: 69  LQA-NPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVV 127

Query: 121 ALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR-KNMVFSLFG 178
            +WSL+ G S Y++ + FF   R+FQG+G AF+LPN   I+G  YKP  + KNMVFS+ G
Sbjct: 128 VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIG 187

Query: 179 ASAPGGFFLGAVFSSMLG-QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK 237
           A AP G  LG +FS ++G +   W W ++   I   +  +  ++VIP   +P+ +   FK
Sbjct: 188 ACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDN-IPT-NVHKFK 245

Query: 238 LLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXX 297
           +    D+ GS  GV GLI+FNF WNQ P  GW + Y   LL++    L+IF   E+R   
Sbjct: 246 M----DWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAK 301

Query: 298 XXX--XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAIS 355
                     +     +L+ +  GW SFGIW +Y   F+ + R  TPL +   +   AI 
Sbjct: 302 EPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIF 361

Query: 356 GFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMD 415
           G  AA   G  +  T P+ ++L ++ AF VG I+++  PV QTY+  +  +++++ +GMD
Sbjct: 362 GTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMD 421

Query: 416 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYR 475
           +SFPA++I+LSD +P ++QG+A SLVNT++NYS+S+ LG++GT E +VN  G   LKGYR
Sbjct: 422 LSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYR 481

Query: 476 CSWYMGIGLSGLGIFVAATYA----WSTFMKSKKRIS-EKQH 512
            + Y+GIGL+ +GIFV+  YA    W+   +   RI  +++H
Sbjct: 482 AALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKH 523

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  317 bits (811), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/534 (34%), Positives = 290/534 (54%), Gaps = 37/534 (6%)

Query: 3   TSSSVTQKNLDTNAEALKKEDKVLSEFDIQD-------ERP---KSLLWESAFVGVLCSA 52
           T++   Q +LD  ++++KK+   +++ D+         + P   KS   E  F+G    A
Sbjct: 24  TTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLA 83

Query: 53  QLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 112
            L+ QAG  Q+L+ ++++ +S  +  A + +W  ++++L  G+FIL++GR+GDI+G K  
Sbjct: 84  NLLNQAGQTQTLSTMNVLADSLNSDGAAK-TWLMASFTLASGSFILVSGRIGDIYGLKAT 142

Query: 113 FVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RK 170
           F+ G   + +WS+L G S Y+  + FF  CRAFQG+G AF+LPN + ++G  Y  G  RK
Sbjct: 143 FIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRK 202

Query: 171 NMVFSLFGASAP-----GGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIP- 224
           N+V S  G  AP     GG + G +  S   Q   WPW ++   IA F+  + G + IP 
Sbjct: 203 NIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQ---WPWIFFATAIAVFINLIMGIYSIPN 259

Query: 225 HTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFF 284
           H P    +        ++D+ GS+ GV+GLIL NF WNQ P+ GW   Y   +LIV  FF
Sbjct: 260 HVPTNIYNL-------KMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFF 312

Query: 285 LVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTP 342
           LV F   E +           + +   V   I+   GW +FGIW FY + F  + R  +P
Sbjct: 313 LVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSP 372

Query: 343 LLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQ 402
           L + +      I G   A+T  F ++   PS +   +   FT G I+ +     QTYW  
Sbjct: 373 LWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRN 432

Query: 403 TFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESR 462
           +    I++  GMD+SFP ++I+LSD +P ++QG++ SLVNT+ NY+ S+ LG+  T E +
Sbjct: 433 SLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQ 492

Query: 463 VNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYA----WSTFMKSKKRISEKQH 512
            N+GG   LKGYR + Y+ IGL  LG   + +Y     W  +   K+R +EK+ 
Sbjct: 493 YNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRY--RKRRQNEKKE 544

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  303 bits (776), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 181/522 (34%), Positives = 294/522 (56%), Gaps = 18/522 (3%)

Query: 3   TSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSA-QLMTQAGLG 61
           TSS +      +  + +   +++LS+    DE P ++ ++   + +L S+ Q ++  G  
Sbjct: 11  TSSKLQPHEPTSPVKVVPSHNEILSK---TDEHPLNMQFKEIIIVLLISSGQFISLLGAV 67

Query: 62  QSLAPLHIIGNSFGT--TNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 119
           Q +  +  I ++F        +L W  +AY+ T  TF++IAG+LGDI GHK  F+ G+ W
Sbjct: 68  QGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFGYAW 127

Query: 120 YALWSLLAGFSVYS--NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLF 177
             LWSLL GFS Y+  N +FF  CR  QG+G AFL P  +A+LG+ Y P +RKN VFS +
Sbjct: 128 LTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPPCKRKNYVFSFY 187

Query: 178 GASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK 237
           GA  P G   G+VFS++  QL  W W YW M + C ++ +  Y  IP    P R+ S+F 
Sbjct: 188 GACGPFGIVAGSVFSALFTQLTTWAWTYWSMAVTCLIITILSYIFIPKDNTPKRERSAF- 246

Query: 238 LLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXX 297
                D+ G   G+ G+ILF+  WNQ P+  ++ PY Y+LLIV   F+ +   I+SR   
Sbjct: 247 --YSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSRVKD 304

Query: 298 XXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGF 357
                    S+    L  +  G+  F IW+FY+W+F   ++  + LL++A+F P+ ISG 
Sbjct: 305 PLIPWKSMCSNVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPLGISGI 364

Query: 358 CAAVTTGFLLSHTPPSTV-MLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDM 416
            AA  +  LL+   P  + +L A+ AF +  ILI+T  + +TYW   FV+ +++  G+D+
Sbjct: 365 FAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIAIGLDV 424

Query: 417 SFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES-RVNDGGAKP----L 471
           +FP+AT++LS+ + +E QGLAA+L  T +NY  ++G G+A  I + + +D  A+     +
Sbjct: 425 AFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCDDCLARSDGRFV 484

Query: 472 KGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSK-KRISEKQH 512
                + Y+ IG +G+ + VA   + + + K +   + EK+ 
Sbjct: 485 HAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDDLREKKR 526

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  288 bits (737), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 175/478 (36%), Positives = 261/478 (54%), Gaps = 12/478 (2%)

Query: 26  LSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNA--GQLS 83
           L+E D     PK+ + E   V +L S+QL+T  G  Q +     +   +    A  G + 
Sbjct: 22  LTEVDTSIRLPKTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVG 81

Query: 84  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS--NQIFFDCC 141
           W  ++Y L     +LIAG+LGD+ GHK+  V G+ W  +WSL+ GFS Y   NQ F+   
Sbjct: 82  WANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTA 141

Query: 142 RAFQGMGPAFLLPNAIAILGRTY-KPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAW 200
           RA QG+G  F++PN++AI+GRTY +PG +K ++FS+FG     GF +G  FSS+  QL  
Sbjct: 142 RALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTK 201

Query: 201 WPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFA 260
           W W YW +   C +  V     IP   +  +  S   L +R D+ G++TGV GL+LF+ A
Sbjct: 202 WAWNYWALACVCVLYTVGAILFIPPDNIVHKPNSK-PLYKRFDYLGAITGVSGLVLFDVA 260

Query: 261 WNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIAAGW 320
           + Q   +GW  P+TY  LI+G   ++I  +++ R            +D   +L C+  G+
Sbjct: 261 FTQASALGWSPPHTYITLIIGVILILIAMFVDWRVDDPLVPLQHLRADVVVILICVYFGF 320

Query: 321 ASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAV-TTGFLLSHTPPSTVMLFA 379
            SF IW  + WQF E     +PL  +A+  P+AI    AA+ T   L  +    T+M+ +
Sbjct: 321 LSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVIS 380

Query: 380 MTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAAS 439
           M  F V  IL+AT   + TYWAQ FVS I+ P+ +D++ P AT++ SDS+  E QG+AAS
Sbjct: 381 MVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAAS 440

Query: 440 LVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKG-----YRCSWYMGIGLSGLGIFVA 492
           L+ TV++Y+ISIG      +   V   G     G        ++  GI LSG+G+  A
Sbjct: 441 LIITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTA 498

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  288 bits (736), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 175/481 (36%), Positives = 273/481 (56%), Gaps = 19/481 (3%)

Query: 9   QKNLDTNAEALKKEDKVLSEFDIQDERP---KSLLWESAFVGVLCSAQLMTQAGLGQSLA 65
           Q ++  +  + +K + ++ E   + + P   K+   E  FVG   + QL+ QA   Q+L+
Sbjct: 14  QSDISIDKSSNEKCEVIVRE-KSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLS 72

Query: 66  PLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 125
            ++++ +SF ++ + Q +W  +++ L  G+FILI+GR+GDI+G KK  + G+ +  +WSL
Sbjct: 73  IMNVLSDSFNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131

Query: 126 LAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPG 183
           + GF+ YS +  F    RAFQG+G AF LPN +  +G  Y  G  RKNMV SL  ASAP 
Sbjct: 132 ICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPV 191

Query: 184 GFFLGAVFSSML--GQLAWWPWAYWIMGIAC-FVLAVAGYFVIPHTPMPSRDASSFKLLE 240
           G  +G  F+ ++     + WPW+++   IAC F L ++ Y +  + P    + + FK+  
Sbjct: 192 GAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIP---TNVNGFKM-- 246

Query: 241 RIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXX 300
             D+ GS   V GLILFNFAWNQGP+VGW   Y   LLI+   F++ F   E        
Sbjct: 247 --DWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPL 304

Query: 301 XXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFC 358
                +     +++      GW S+GIW FY + F+ + R  +P+ +   +    I G  
Sbjct: 305 IAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVL 364

Query: 359 AAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSF 418
           A+   G  +       ++LF+M  F VGT L++ APV Q+Y+  T   + ++  G+D SF
Sbjct: 365 ASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSF 424

Query: 419 PAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSW 478
           PAATI+LSD +P E+QG+A SL  T+VNYS+S+ LG+  T+E ++N  G   LKGYR + 
Sbjct: 425 PAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAE 484

Query: 479 Y 479
           Y
Sbjct: 485 Y 485

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  284 bits (726), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 190/517 (36%), Positives = 287/517 (55%), Gaps = 19/517 (3%)

Query: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLG 61
           S   SVT K    + +   + D   S F    E  ++   E  F+     AQL+ QAG  
Sbjct: 49  SDQLSVTSKGCICSVDDCHEND---SPFQ-NPEYFETGFKEVMFIISCMVAQLLNQAGQT 104

Query: 62  QSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 121
           QSL+ ++++ + F  +N+ +  W  +++ L  G+FILI+GRLGDI+G KK   +G+    
Sbjct: 105 QSLSTMNVLADYF-KSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMT 163

Query: 122 LWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGA 179
           LWS++ G + Y+N   FF  CR+FQG+G AF+LPN + ++G  YK G  RKN+V S  G 
Sbjct: 164 LWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGC 223

Query: 180 SAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK 237
            AP G  LGA+F  ++       WPW ++  GIA FV  +   + IP+  +P+   +   
Sbjct: 224 MAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNN-VPTNLNN--- 279

Query: 238 LLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXX 297
               +D+ GS+ GV GL+L N  WNQ P+VGW   Y   LLI+    L+IF   E +   
Sbjct: 280 --LNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYAT 337

Query: 298 XXXX--XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAIS 355
                     +     +L+ +  GW SFGIW +Y + F  + R  TPL +        I 
Sbjct: 338 SPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIW 397

Query: 356 GFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMD 415
           G  AA      +    P+ ++ F+M AF  G+I+++  PVHQTYW       I++ +GMD
Sbjct: 398 GTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMD 457

Query: 416 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYR 475
           +SFPA++I+LSD +P ++QG+A SLVNTVVNYS S+ LG+  T+E + N  GA  LKGYR
Sbjct: 458 LSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR 517

Query: 476 CSWYMGIGLSGLGIFVAATYAWSTFM--KSKKRISEK 510
            + Y+ IGL+  G+ V+  +  +  +  + +KRI  +
Sbjct: 518 SALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESE 554

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  267 bits (683), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 163/491 (33%), Positives = 257/491 (52%), Gaps = 16/491 (3%)

Query: 34  ERP---KSLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYS 90
            RP   K+   E  FV V    Q ++Q GL Q L+ ++I+     TT   Q  W  +A+ 
Sbjct: 111 RRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQ-PWLMAAFP 169

Query: 91  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGP 149
           L +G  ILI+GRLGDIFG KK  +LG+    +W+L+ GFS Y++    F   R FQG+G 
Sbjct: 170 LGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGL 229

Query: 150 AFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFS--SMLGQLAWWPWAYW 206
           A  LPN   ++G  YKP   +KNM+F + GA +P G  LG +F+  S+   +  WPW+++
Sbjct: 230 ACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFY 289

Query: 207 IMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPV 266
              I  F+  +  +F IP+      D        ++D+ GS  G+ GL++ NF +NQ P+
Sbjct: 290 SFAIVAFLNGIIAWFCIPN------DIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPI 343

Query: 267 VGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTAFVLSCIA--AGWASFG 324
            GW + Y   LL+V    L++F   E              S+   +L  +    GW  F 
Sbjct: 344 DGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFA 403

Query: 325 IWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFT 384
           IW FY + F  + R  +PL +S+    + ISG    +     +    P  ++ F+M  F 
Sbjct: 404 IWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFL 463

Query: 385 VGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTV 444
            G IL A  P+HQT++   F S+ + P GM  SFP+A++M ++++P  ++ +A SLVN  
Sbjct: 464 GGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVA 523

Query: 445 VNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSK 504
           +NY+ SI +G+AG+     N+ G   L G+R + Y+ IGLSG  +F++  Y   +    +
Sbjct: 524 INYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDR 583

Query: 505 KRISEKQHFIE 515
            +  ++   I 
Sbjct: 584 NQKMKENKLIN 594

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  246 bits (627), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 169/571 (29%), Positives = 279/571 (48%), Gaps = 73/571 (12%)

Query: 11  NLDTNAEALKKED--KVLSEFDIQDER----PKSLLWESAFVGVLCSAQLMTQAGLGQSL 64
           N+ T  E ++ +   KV     I+ ++      S L +  F+ ++CS+Q +T A   Q++
Sbjct: 34  NIPTVTETVQDQQSHKVTHSSLIRLQKLQSPTNSYLNDIIFIFLICSSQFITLASASQAI 93

Query: 65  APLHIIGNSFGT--TNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYAL 122
             +  +   F    T+  QL W  +++++T G FI++AG+L DI   +  F+ G+ W++L
Sbjct: 94  LQMDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSL 153

Query: 123 WSLLAGFSVY--SNQIFFDCCRAFQGMGPAFLLPNAIAILGRTY---------------- 164
           W+L+ GF+ Y   N IF   CR  QG+G A L P+A+ +L + Y                
Sbjct: 154 WTLITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPT 213

Query: 165 ----KPGRR---------------------------KNMVFSLFGASAPGGFFLGAVFSS 193
                P                              K++ FSL+GA AP G  +G +FS+
Sbjct: 214 TSAPSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSA 273

Query: 194 MLGQLAWWPWAYWIMGIACFVLAVAGYF-VIPHTPMPSRDAS--SFKLLERIDFAGSVTG 250
           +  QLA WPW YW M I   +L++  YF V+   P+   D++  S K  +  DF G + G
Sbjct: 274 IFTQLATWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILG 333

Query: 251 VVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXXXXXXSSDTA 310
           +  LILF  +W+Q  +  ++T + Y  L+      +     E                T 
Sbjct: 334 ISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYFNNPIIPIRQIHPGTI 393

Query: 311 FVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHT 370
             L  +   + SF  W+FYTW+   + +  +P+L S +F P++++G  +A  +  L+   
Sbjct: 394 KALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKR 453

Query: 371 PPSTVMLFA-MTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSM 429
            P  + L A  ++F +  IL+ T  +  +YW   F SII +  G+D+SFP+AT++L++ +
Sbjct: 454 VPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGI 513

Query: 430 PHEHQGLAASLVNTVVNYSISIGLGIAGTI-----ESRVNDGGAKP--LKGYRCSWYMGI 482
           P E QG+ A+LV +V+NY  +IG  IA TI     ES ++D   K   LKG   +  +G+
Sbjct: 514 PPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGV 573

Query: 483 GLSGLGIFVA-----ATYAWSTFMKSKKRIS 508
           G SG+ + +        Y+W T   SKK I 
Sbjct: 574 GCSGIAVLIGIYGTITEYSWKTKGFSKKCIK 604

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  244 bits (624), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 172/531 (32%), Positives = 273/531 (51%), Gaps = 27/531 (5%)

Query: 2   STSSSV---TQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQA 58
           ST+SS+     K   +N +  + +D++ S   +      S L E  F+ ++ S+Q ++ A
Sbjct: 31  STASSLHSQRTKEQCSNLQPAQAQDQLES---MNPPPGPSRLRECMFIVIIASSQFISLA 87

Query: 59  GLGQSLAPLHIIGNSFGTTNAGQLS--WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 116
              Q++  +  I   F       L   W  +A+++T GTFI+ AG+L D+ G K  F+ G
Sbjct: 88  AASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFG 147

Query: 117 FFWYALWSLLAGFSVYSNQ---IFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMV 173
           + WY LWSLL G S Y+ +    FF   R  QG+G A L P+++A+LG+ Y P  +KN+V
Sbjct: 148 YAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYPPSCKKNIV 207

Query: 174 FSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGI-ACFVLAVAGYFVIPHTPMPSRD 232
           FSL+G   P G  +G VFS++  QLA W W YW M I + F   ++ +++ P   + S +
Sbjct: 208 FSLYGFCVPLGVVVGGVFSAIFTQLAHWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEE 267

Query: 233 ASSFKL---LERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFA 289
               +    L + D+ G+   V  L+LF   WNQ     +++   Y  LIV     V   
Sbjct: 268 QKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMV 327

Query: 290 YIESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 349
            +E                T   L  +   + SF IW+FY W++    R  T LL +A+F
Sbjct: 328 IVEFYVDDPIIPARKIHPQTIKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKF 387

Query: 350 SPVAISGFCAAVTTGFLLSHTPPSTVMLFA-MTAFTVGTILIATAPVHQTYWAQTFVSII 408
            P++I+GF AA+ +  L+S   P  + L A   +F +  IL  T    ++YWA+ F++II
Sbjct: 388 VPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTII 447

Query: 409 VMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGA 468
           ++  G+D+SFP+AT++LS+ +P E +G++A+LV T +NY   IG  IA TI     D   
Sbjct: 448 IISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIAQTIIGYQCDKCM 507

Query: 469 KP------LKGYRCSWYMGIGLSGLGIFV-----AATYAWSTFMKSKKRIS 508
                   +K    +  +GIG SG+ + V        Y+W T   SK+ + 
Sbjct: 508 ASGDMDQFVKAIHIAAAVGIGASGIAVVVGLYGTVTEYSWETHSYSKRCVE 558

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  179 bits (453), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 140/496 (28%), Positives = 238/496 (47%), Gaps = 24/496 (4%)

Query: 5   SSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQSL 64
           S  T++++  N E+ K+     S   ++      L  E AFV     AQ   QAG    L
Sbjct: 15  SECTERSISCNQESSKEAYDRCSW--LKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMIL 72

Query: 65  APLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWS 124
             ++++ +SF         +  ++Y +  G+F+LI GRLG++ G+K+  + G+    L S
Sbjct: 73  PLVNVLSDSF------HGKFLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSS 126

Query: 125 LLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYK---PGRRKNMVFSLFGAS 180
           LL G S YS + IF+  CRAFQG+G A +LPN  A     Y+      RK ++ ++ G  
Sbjct: 127 LLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCG 186

Query: 181 APGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKL 238
           A  G FLG   S +      + W WAY+   IA  +     Y+ +P              
Sbjct: 187 ASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPC---- 242

Query: 239 LERIDFAGSVTGVVGLILFNFAWNQGPVV--GWQTPYTYALLIVGTFFLVIFAYIESRXX 296
           L  + +  + +   GL++ N A N   V    W       ++ V    L +   ++    
Sbjct: 243 LNGLGWFSNRS--CGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSED 300

Query: 297 XXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISG 356
                    ++  + VL+ I  GW ++GIW  Y ++F+ + R  +PL + + +  + I G
Sbjct: 301 PVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGG 360

Query: 357 FCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDM 416
           + A +    L+  T P   +LF+   FT   I+++  P+HQ+Y+  T  S+I +  G+D 
Sbjct: 361 YVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDF 420

Query: 417 SFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRC 476
           SFP++ I+L + +P ++  + A L N + NY+IS   GI  +    ++    + +K YR 
Sbjct: 421 SFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IELIKYYRY 478

Query: 477 SWYMGIGLSGLGIFVA 492
            +Y  IGLS +G+F A
Sbjct: 479 VYYFAIGLSAIGLFAA 494

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 75/126 (59%), Gaps = 3/126 (2%)

Query: 52  AQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKK 111
           +QL+ Q G  Q+L  ++++   F ++ A Q    AS   L  G+FIL++G++GDI+G K 
Sbjct: 3   SQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVAS-IPLVSGSFILVSGKVGDIYGLKN 61

Query: 112 FFVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-R 169
             + G+    +WS + G + Y+  + FF   RAFQG+G AF+LPN +  +   Y  G  R
Sbjct: 62  TLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSIR 121

Query: 170 KNMVFS 175
           KNMV++
Sbjct: 122 KNMVYA 127

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 444 VVNYSISIGLGIAGTIESRVNDGGAKPL 471
           ++ YS+ + LGIAGT+E RV+ GGA  L
Sbjct: 156 MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 79.0 bits (193), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 119/519 (22%), Positives = 206/519 (39%), Gaps = 58/519 (11%)

Query: 17  EALKKEDKVLSEFDIQDERPKSLLWESAFVGVL---CSAQLMTQAGLGQSLAPLHIIGNS 73
           + + K    L E  I+++  KS    +  VG++   C+  L+  A +   +  L    N 
Sbjct: 4   DKIAKLSNALEE--IRNKCQKSRYQLNVNVGLIFLGCTFDLLNVASMISLIDDLAKTYNI 61

Query: 74  FGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS 133
             TT     SW  ++Y++T   FI   GRLGDI G+   F +    +A+ SLL   +V  
Sbjct: 62  SYTTA----SWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLC--AVMP 115

Query: 134 NQIFFDCCRAFQGMGPAFLLPNA---IAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAV 190
           N   F   RA QG+  A L+P A   I IL    K  +  ++V   F ++   G  +G  
Sbjct: 116 NFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGA 175

Query: 191 F-SSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVT 249
           F ++ +G    +   + +M +   +     Y V      P +D +S  + + +DF GS+ 
Sbjct: 176 FATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSV-KSLDFIGSLI 234

Query: 250 GVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIF--------------------- 288
            V G IL      +G    W  P TY  L++G      F                     
Sbjct: 235 FVAGSILIVVGLTEGGE-SWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDT 293

Query: 289 -AYIESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 347
             Y E              +    VL+  A   A     ++   Q+ + +   +PLL+  
Sbjct: 294 SKYFEKVQLLIPIDVLFMKNFIPIVLA-FALNNACLFSCLYIIDQYSQYAERNSPLLAGV 352

Query: 348 QFSPVAI-----SGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQT-YWA 401
           +  P+ I     +  CA  +T       P   V +    A     ILI    V +  +W 
Sbjct: 353 KLVPLIICMVIGNALCAFESTKL----RPRVGVAIGFFLALAGSIILIQLHLVKEDLFWK 408

Query: 402 QTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES 461
             F +  ++ +G+ + +P A  +     P E +G+A+ +  T     I I   +  ++  
Sbjct: 409 IFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLG 468

Query: 462 RVND--GGAKPLKGYR-----CSWYMGIGLSGLGIFVAA 493
            +N+  G +  ++ +R     CS++  + +  LG  V A
Sbjct: 469 NINEMKGKSNAIQKFRTGFQNCSYFT-VAVGALGFLVTA 506

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 98/451 (21%), Positives = 173/451 (38%), Gaps = 51/451 (11%)

Query: 83  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 142
           SW  ++Y++T   FI   GRLGDI G+   F +    +A+ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLC--AVMPNFPAFAVFR 124

Query: 143 AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVFSSMLGQL 198
           A QG+  A L+P A A++     P  +    FS+    F ++   G  +G  F++   ++
Sbjct: 125 AIQGICAAGLVPCAYALI-PILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAAT--KI 181

Query: 199 AWWPWAYWIMGIACFVLAVAGYFV-----IPHTPMPSRDASSFKLLERIDFAGSVTGVVG 253
            +    Y    +   +  +A +F          P   +  +S K L   DF GS+  V G
Sbjct: 182 GYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSL---DFIGSLIFVAG 238

Query: 254 LILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIF----------------------AYI 291
            IL      +G    W  P TY  LI+G      F                       Y 
Sbjct: 239 SILIVVGLTEGGE-SWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYF 297

Query: 292 ESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSP 351
           E              +    VL+  A   A     ++   Q+ + +   +PLL+  +  P
Sbjct: 298 EKVQLLIPVDVLFMKNFIPIVLA-FALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVP 356

Query: 352 VAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV--HQTYWAQTFVSIIV 409
           + I          F  +   P   +    +    G+I++    +     +W   F S  +
Sbjct: 357 LIICMVVGNALCAFESTKLKPRVGVALGFSLALAGSIILIQLHLIKDNVFWKIFFSSQAL 416

Query: 410 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVND--GG 467
           + +G+ + +P A  +     P + +G+A+ +  T     I I   +  ++   +N+  G 
Sbjct: 417 VGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGK 476

Query: 468 AKPLKGYR-----CSWYMGIGLSGLGIFVAA 493
              ++ +R     CS++  + +  LG  V A
Sbjct: 477 EDAIQNFRTGFQNCSYFT-VAVGALGFLVTA 506

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 105/487 (21%), Positives = 194/487 (39%), Gaps = 52/487 (10%)

Query: 19  LKKEDKVLSEF-DIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTT 77
           +K  D + S F +I   R  +L+     + V C+  L+    +   L+    I N++   
Sbjct: 6   IKTRDSIRSNFQNISFHRYINLV----LIMVSCAFDLINVTAV---LSATRDIENTY-QI 57

Query: 78  NAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIF 137
                SW  +AY++T   FI   GR+GDI G+   FV   F +++ SL+   +V +N   
Sbjct: 58  EFTTASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLIC--AVVNNFGT 115

Query: 138 FDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVFS- 192
           F   RA QG+  A ++P+  A++  T          F++    F  S   GF +G  F+ 
Sbjct: 116 FAVFRALQGIAAAGIVPSGYALI-PTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTL 174

Query: 193 SMLGQLAWWPWAYWIMGIACFVLAVAGYFVI----PHTPMPSRDASSFKLLE--RIDFAG 246
           + +G    +   + +M     V+++  YF I       P       + K  +   +DF G
Sbjct: 175 TRIGYKGIFYLTFAVM----LVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIG 230

Query: 247 SVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIF----------------AY 290
           S   +   IL      +G    W+ P  Y  LIVG    V+F                A 
Sbjct: 231 SFMFISSTILIVVGLTEGG-ESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSAS 289

Query: 291 IESRXXXXXXXXXXXSSDTAFVLSCI---AAGWASFGIW---IFYTWQFMEDSRGQTPLL 344
                            D   + + I    A +A++G     ++   Q+ +     +PLL
Sbjct: 290 NPKVYNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLL 349

Query: 345 SSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV--HQTYWAQ 402
           ++ +  P+ +S     V          P   ++       +G+I++    +     YW  
Sbjct: 350 AAVKLLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITDNLYWKI 409

Query: 403 TFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESR 462
            F S  ++ +G  + FP +  +L    P E++G+A+ ++ T   + + +   +  +I   
Sbjct: 410 FFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGN 469

Query: 463 VNDGGAK 469
           +N+   K
Sbjct: 470 INELSGK 476

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 99/452 (21%), Positives = 179/452 (39%), Gaps = 57/452 (12%)

Query: 83  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 142
           SW  ++Y++T   FI   GRLGDI G+   F +  F++A+ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLC--AVMPNFPAFAVFR 124

Query: 143 AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVF-SSMLGQ 197
           A QG+  A L+P A A++     P       FS+    F ++   G  +G  F ++ +G 
Sbjct: 125 AIQGISAAGLVPCAYALI-PMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGY 183

Query: 198 LAWWPWAYWIMGIACFVLAVAGYFV---IPHTPMPSRDASSFKLLERIDFAGSVTGVVGL 254
              +   + +M    F++++  +F    + +   P R   +   +  +DF GS+  V G 
Sbjct: 184 KGIFYLTFAVM----FLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGS 239

Query: 255 ILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFA----------------------YIE 292
           IL      +G    W  P TY  L++G      F                       Y E
Sbjct: 240 ILIVVGLTEGG-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFE 298

Query: 293 SRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 352
                         +    VL+  A   A     I+   Q+ +     +PL +  +  P+
Sbjct: 299 KVQLLIPVDVLFMKNFIPIVLA-FALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPL 357

Query: 353 AI-----SGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV--HQTYWAQTFV 405
            I     +G CA     F  +   P   ++   +    G+I++    +     +W   F 
Sbjct: 358 IICMVIGNGLCA-----FESTKLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFS 412

Query: 406 SIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTV----VNYSISIGLGIAGTIES 461
           S  ++ +G+ + +P A  +     P   +G+A+ +  T     +  + S+   + G I+ 
Sbjct: 413 SQALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDG 472

Query: 462 -RVNDGGAKPLK-GYRCSWYMGIGLSGLGIFV 491
            R   G ++  + G++   Y  + +  LG  V
Sbjct: 473 IRGKSGASQKFRTGFQNCTYFTVAVGALGFLV 504

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 115/260 (44%), Gaps = 18/260 (6%)

Query: 37  KSLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTF 96
           +  L    F+ +L +  L   A +G  +  +  I   F  ++  Q  W  ++Y +T   F
Sbjct: 17  QDTLKHLKFICILIACGL-DLASVGAMIVLVTDIETRFNVSHT-QSGWALTSYVITFAGF 74

Query: 97  ILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNA 156
           I   GR+GDI G+     +    + ++SLL   +V  N I F   RAFQGM  A ++P A
Sbjct: 75  IAFFGRVGDIVGNGIMMCVFSVIFGIFSLLC--AVVPNFIAFTVFRAFQGMAGAGIVPCA 132

Query: 157 IAILGRTYK-PGRRK--NMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWI----MG 209
            A++ + ++ P  ++  +++ S+  A A  GF +G  F      L +  + Y++    + 
Sbjct: 133 YALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGET--ALGYKSFFYFLFAASLA 190

Query: 210 IACFVLAVAGYFVIPHTPMPSRD-ASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVG 268
            A  +  + GY   P   +        F+ + ++D  G +  + G IL      QG    
Sbjct: 191 TAAVICVLIGY---PELLLNRHSYKEKFQRVYKLDVIGCLLFISGSILLVVGLTQGG-ES 246

Query: 269 WQTPYTYALLIVGTFFLVIF 288
           W  P  Y  L V    L+IF
Sbjct: 247 WNDPTAYVPLAVSIVLLIIF 266

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 103/479 (21%), Positives = 183/479 (38%), Gaps = 69/479 (14%)

Query: 38  SLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFI 97
            L+   A + + C+  L+  AG+   ++ +  +G ++G       SW  ++Y++T    I
Sbjct: 29  QLIINMALIFLGCTFDLLNVAGV---ISVIEDLGETYGLEYT-TASWALTSYAITFAGLI 84

Query: 98  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 157
              GRLGDI G+   F +  F+++L+ LL   +V +N   F   RA QG+  A L+P   
Sbjct: 85  AFMGRLGDIIGNSVLFTISGFFFSLFCLLC--AVVTNFPAFAVLRALQGIAAAGLVPCGY 142

Query: 158 AILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIA---CFV 214
           A++     P   +     LF A    GF      SS +G       A+ +  +     F 
Sbjct: 143 ALIPTLADPEDVQ-----LFFAVVSCGF------SSTIGIGLIIGGAFALTNVGYKGIFY 191

Query: 215 LAVAG------------YFVIPHTPMPSRDASSFKL---LERIDFAGSVTGVVGLILFNF 259
           L+ AG            Y +  H         S      +  +DF GS+  + G +L   
Sbjct: 192 LSFAGMLLVSIAAFFFTYRIEEHKFAEQDYEGSIHRPGKVASLDFVGSLIFISGSVLIVV 251

Query: 260 AWNQGPVVGWQTPYTYALLIVGTFF-------------LVIF---------AYIESRXXX 297
              +G    W+ P  Y    +G  F             LVIF          Y+E     
Sbjct: 252 GLTEGGE-SWKRPVAYVPFTIGMIFFCGFFAWNCSYQNLVIFLKKLGCDTSRYLEKVQVL 310

Query: 298 XXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAIS-- 355
                   ++     L  +  G   +   I+   Q+ +     +PLL+  +  P+ I+  
Sbjct: 311 IPRDVLFMTNFIPITLGFLCNGGCLYS-NIYIIDQYSQYVDKNSPLLAGVKLVPLIITMV 369

Query: 356 ---GFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQT-YWAQTFVSIIVMP 411
                CA+ +    +   P   V L  ++      ILI    V +  YW   F S I++ 
Sbjct: 370 IGNTICASKS----VKLRPRIGVALGFLSMVCGSIILIQLHLVEENLYWKIMFCSQILVG 425

Query: 412 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKP 470
           +G  + +P A  ++    P   +G+A+ +  T     I +   +  ++   +    ++P
Sbjct: 426 FGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVSVLGNITQVKSRP 484

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 89/452 (19%), Positives = 177/452 (39%), Gaps = 49/452 (10%)

Query: 50  CSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGH 109
           C+  L+  AG+   ++ +  +G ++     G  SW  ++Y++T   FI   GRLGDI G+
Sbjct: 37  CTFDLLNVAGV---ISVIEDLGETYKLGYTGA-SWALTSYAITFAGFIAFMGRLGDIVGN 92

Query: 110 KKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR 169
              F +  F + L+SLL   +V  +   F   RA QG+  A ++P   A++    +P   
Sbjct: 93  SVLFTISCFLFTLFSLLC--AVVRDFPTFAVFRALQGISAAGIVPCGYALIPLLAEPQDI 150

Query: 170 KNMVFSL----FGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPH 225
           +   FS+    F ++   G  +G  F+  L ++  +   +++      V+++A  F    
Sbjct: 151 QKF-FSIVSCGFSSTIGIGLIVGGAFA--LTKVG-YAGIFYLSFAGMLVVSIAASFYTYR 206

Query: 226 TPMPSRDASSFKL---------LERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYA 276
             +  R     K+         +  +DF GS+  V G +L      +G    W+ P  Y 
Sbjct: 207 --IEERKFLEVKVEDIPHDHPKVASLDFVGSLIFVSGSVLIVAGLTEGG-ESWRRPVAYV 263

Query: 277 -----LLIVGTFFL--VIFAYIESRXXXX--------XXXXXXXSSDTAF------VLSC 315
                +L+  +FF+    +  + SR                     D  F      ++  
Sbjct: 264 PFSIGVLLFCSFFIWNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPIILS 323

Query: 316 IAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTV 375
            A   A     I+   Q+ +     +PL++  +  P+ +S      T         P   
Sbjct: 324 FACNNACLFSVIYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKVG 383

Query: 376 MLFAMTAFTVGTILIATAPVHQT--YWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEH 433
           ++        G+I++      +   +W   F S I +  G  + +P A  ++    P   
Sbjct: 384 VVLGFLFMLCGSIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDGA 443

Query: 434 QGLAASLVNTVVNYSISIGLGIAGTIESRVND 465
           +G+A+ +  T   + + +   +  ++   + D
Sbjct: 444 KGIASGMTQTFAQFGVEVTFSVMVSVLGNITD 475

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 84/196 (42%), Gaps = 23/196 (11%)

Query: 79  AGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFF 138
           + Q+SW A+AY L+   F  + G+L DIFG K   +L    +AL   + G S ++N ++ 
Sbjct: 75  SSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWV 133

Query: 139 DCCRAFQ----GMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSM 194
                F     G G A L     + +    K G  + +V   F      G  LGAV    
Sbjct: 134 LSTGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVLQQG 193

Query: 195 LGQLAWWPWAYWI---MGIACFVLAVAGYFVIP-HTP------MPSRDASSFK---LLER 241
           +G    W WA+ +   M + C  L +A    +P  +P      +  +     K   + E 
Sbjct: 194 IG----WRWAFLVQVPMALVC-ALMIAVVLDLPADSPGRGLLWLELKRGKRLKWCTVTEM 248

Query: 242 IDFAGSVTGVVGLILF 257
           +DF GS T +  +IL 
Sbjct: 249 VDFVGSFTLIASMILL 264

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 82/416 (19%), Positives = 149/416 (35%), Gaps = 39/416 (9%)

Query: 83  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 142
           SW  ++Y++T   FI   GRLGDI G+ + F +    +A+ SLL G  +  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCG--LMPNFEAFAVMR 124

Query: 143 AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWP 202
           A QG+  A L+    A++     P  +    FS+             +   + G    + 
Sbjct: 125 ALQGIAAAGLVMCGYALI-PILSPKEQVQEYFSIVSCGFSST---IGIGFIIGGAXXGYK 180

Query: 203 WAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK----LLERIDFAGSVTGVVGLILFN 258
             +++   A  ++ +  +F               K     +  +DF GS+  + G IL  
Sbjct: 181 GIFYLTFAAMTLICIMAFFFTCDVEKNEEKGLEVKESTATVASLDFIGSLIFITGSILIV 240

Query: 259 FAWNQGPVVGWQTPYTYALLIVG-TFFLVIFA---------------------YIESRXX 296
               +G    W+    Y    +G   FL  FA                     Y E    
Sbjct: 241 VGLTEGG-ESWREAKAYVTFAIGIILFLSFFAWNCFYLKIVNGIRLIGIDTTKYFEKVQL 299

Query: 297 XXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISG 356
                       T  VL+        F   I+   Q+ +     +PL++  +  P+ IS 
Sbjct: 300 LVPLNIHFM---TXIVLAFAMNNACPFS-SIYIIDQYSQYKENDSPLMAGVKLVPLIISM 355

Query: 357 FCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIAT--APVHQTYWAQTFVSIIVMPWGM 414
                  G   +   P   +         G+I++    A  +  +W   F + +++ +G+
Sbjct: 356 IIGNFLCGIEKTRMRPKFGVTLGFFLALSGSIILTQLRAVKYDVFWKIFFSAEVLVGFGV 415

Query: 415 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKP 470
            + +P A  +     P E +G+A+ +  T     I I   I  ++   + +   +P
Sbjct: 416 AIFYPYAQQLAVGRAPDEAKGIASGVAQTFGQLGIEIAFSIMASVLGNIEEIRGRP 471

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 89/194 (45%), Gaps = 20/194 (10%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  ++  Q  W A+++ LT   F  + G+L DI G K   ++  F++ L  LL
Sbjct: 60  MNRVAEDFSESSRKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFFFGLGCLL 117

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 181
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 182 PGGFFLGAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFV-IPHTPMPSRDASSFK 237
             G  LG VF   +G    W   + +   M + C +LA+    + + H P P ++  + K
Sbjct: 174 LLGAPLGGVFIETIG----WRALFGVQVPMIMLCTILAIKNINIKLFHVP-PMKERYTLK 228

Query: 238 LLERIDFAGSVTGV 251
            L RID  GS++ V
Sbjct: 229 NLSRIDLFGSLSLV 242

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 128/303 (42%), Gaps = 31/303 (10%)

Query: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLG 61
           +T SS++ +N   +A          +EF +   R   +++ S F+G+  +A       + 
Sbjct: 51  TTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMF-SMFLGIFLAA---LDGTIV 106

Query: 62  QSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 121
            +L  L  IG+ F + +  + SW A++Y L+  T   + G+L D  G K   V     +A
Sbjct: 107 STL--LTHIGSEFNSLD--KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFA 162

Query: 122 LWSLLAGFSVYSNQIFFDCC-RAFQGMGPAFLLPNAIAILGRTYKPGRR---KNMVFSLF 177
           +  L+ G    SN I+     R   G+G   L   A  I+        R   + +   +F
Sbjct: 163 IGCLICGL---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVF 219

Query: 178 GASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK 237
           G     G  +GA F         W  A+ +    C +  ++G  ++ +  +P R ++S K
Sbjct: 220 GLGTASGGLVGAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNK 269

Query: 238 -----LLERIDFAGSVTGVVGLILFNFAWNQ-GPVVGWQTPYTYALLIVGTFFLVIFAYI 291
                 L R+D+AG+ + +  L LF    +  G  V + +    A+      F  +F Y+
Sbjct: 270 DCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYV 329

Query: 292 ESR 294
           E R
Sbjct: 330 ELR 332

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 129/324 (39%), Gaps = 44/324 (13%)

Query: 4   SSSVTQKNLDTNAEALKKEDKVLSEFDI-------QDERPKSLLWESAFVGV-----LCS 51
           + +V+  N  TNA+ + +    +S  D+        D+    L  E+  +       L  
Sbjct: 11  TRTVSSSNKQTNADKINQHYLSISHSDVGEYREEPNDDEQGDLDDETTPLSRIPHLWLIE 70

Query: 52  AQLMTQAGLG-----QSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDI 106
           A L T   L       + +    IGN F   +    SW  ++Y +T  +F  + G   D+
Sbjct: 71  AALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLS--SWITASYLITSTSFQPLYGSFSDV 128

Query: 107 FGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKP 166
            G +K        +++  L  G S+  N ++    RAF G+G   L+  +  +       
Sbjct: 129 LGRRKCLFFASMIFSIGCLGCGISI--NILWLSFMRAFTGIGGGGLITLSTIVNSDMIPT 186

Query: 167 GRR------KNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGY 220
            +R      +N+   L G  A  G   G V +S +G    W W + +        A+ G+
Sbjct: 187 SKRGIFQAFQNL---LLGLGAICGASFGGVITSSIG----WRWCFLLQVPISLAGALIGH 239

Query: 221 FVI----PHTPMPSRDASSFK-LLERIDFAGSVTGVVGLILFNFAWNQGPVVG-----WQ 270
             +     +    S+++S  K +L+ IDF+G+   ++GL L     + G         W 
Sbjct: 240 LYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIIIGLTLQLVYLSLGSAADESGNTWS 299

Query: 271 TPYTYALLIVGTFFLVIFAYIESR 294
           +P   A+L+     LV+F   E R
Sbjct: 300 SPGLSAVLVASFIVLVLFVLTEER 323

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 83/181 (45%), Gaps = 12/181 (6%)

Query: 77  TNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQI 136
           + + +  W A+++ LT   F  + G+L DI G K   +   F++ +  LL  F+   N  
Sbjct: 68  SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFA--RNVT 125

Query: 137 FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASAPGGFFLGAVF 191
            F   RA  G+G   L  NAI  +  +     R+  V+      +FG     G  LG VF
Sbjct: 126 EFSIARAICGIGAGGL--NAIGSIAVSDICTARERGVYQGYANIVFGLGQLLGAPLGGVF 183

Query: 192 SSMLGQLAWWPWAYWIMGIACFVLAVAGYFV-IPHTPMPSRDASSFKLLERIDFAGSVTG 250
              +G  A +     ++ + C VLA+    + + H P P ++  + K L RID  GS++ 
Sbjct: 184 IETIGWRALFGVQVPVI-MLCSVLAIKNINIKLFHVP-PMKERYTLKNLSRIDIFGSLSL 241

Query: 251 V 251
           V
Sbjct: 242 V 242

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 88/191 (46%), Gaps = 14/191 (7%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L  LL
Sbjct: 60  MNRVAEEFSESSKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLGCLL 117

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 181
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 182 PGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFV-IPHTPMPSRDASSFKLLE 240
             G  LG VF   +G  A +     ++ + C VLA+    + + H P P ++  + K L 
Sbjct: 174 LLGAPLGGVFIETIGWRALFGIQVPVI-MLCSVLAIKNINIKLFHVP-PMKERYTLKNLS 231

Query: 241 RIDFAGSVTGV 251
           RID  GS++ V
Sbjct: 232 RIDIFGSLSLV 242

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 88/194 (45%), Gaps = 20/194 (10%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  ++  Q  W A+++ LT   F  + G+L DI G +   +   F++ L  L+
Sbjct: 60  MNRVAEEFSESSKKQ--WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLM 117

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 181
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAVCGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 182 PGGFFLGAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFV-IPHTPMPSRDASSFK 237
             G  LG +F   +G    W   + +   M I C +LA+    + + H P P ++  + K
Sbjct: 174 LLGAPLGGIFIETIG----WRALFGVQVPMIIVCSILAIKNINIKLFHVP-PMKERYTLK 228

Query: 238 LLERIDFAGSVTGV 251
            L RID  GS++ V
Sbjct: 229 NLSRIDIFGSLSLV 242

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 132/321 (41%), Gaps = 47/321 (14%)

Query: 1   MSTSSS-----VTQKNLDTNAEALKKEDKVLSEFDIQD--ERPKSLLWESA-FVGVLCSA 52
           MS S+S     + QK +  +  +++ E+            ER + LL E+A F  V  S 
Sbjct: 1   MSNSASTERGWIDQKKVPRSYASIQTEETTTEPLAPSSWTERNRILLIETALFTNVFLS- 59

Query: 53  QLMTQAGLGQSLAP--LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHK 110
                 GL  ++      +IGN F        SW  +AY +T  +F  + G   D  G +
Sbjct: 60  ------GLDSTITASIYQLIGNEFEDVKVS--SWITTAYLVTCTSFQPLYGSFSDTLGRR 111

Query: 111 KFFVLGFFWYALWSLLAGF--SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR 168
           +        +AL  L  G   ++YS  I     RA  G+G   L+  +  I+     P +
Sbjct: 112 RCLFFANTIFALGCLGCGLTSTIYSLIIM----RAVTGIGGGGLITLS-TIVNSDIIPAK 166

Query: 169 RKNMVFS----LFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIM------GIACFVLAVA 218
           ++ M  S    L G  A  G   G   +S +G    W W + +       G     L V 
Sbjct: 167 KRGMYQSFQNILVGTGAVVGASCGGEIASSMG----WRWCFLLQVPISIGGAVMAYLFVQ 222

Query: 219 GYFVIPHTPMPSRDASSFKLLERIDFAGS---VTGVVGLILF---NFAWNQGPVVGWQTP 272
              V+   P      S+   +++IDF G+   ++G+V  ++F   N +  +G    W + 
Sbjct: 223 DQDVVDKNPRSGALPSNVSKIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGKST-WLSG 281

Query: 273 YTYALLIVGTFFLVIFAYIES 293
            + AL +V    L++FAY+E 
Sbjct: 282 RSLALGLVTAVSLILFAYVEK 302

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 98/234 (41%), Gaps = 27/234 (11%)

Query: 70  IGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 129
           IG+ F + +  ++SW A++Y L+  T   + G+L D  G K   V     +++  L+ G 
Sbjct: 109 IGSEFNSLD--KVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166

Query: 130 SVYSNQIFFDCCRAFQ----GMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGF 185
              S  I++     F     G G   L    I+ L    +    + +   +FG     G 
Sbjct: 167 ---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGG 223

Query: 186 FLGAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERI 242
            +GA F         W  A+ I   + +A   L V+ Y  +P      +D      L  +
Sbjct: 224 LVGAAFQD-------WRMAFTIQCPISLASCALIVS-YLELPPRHEDDKDRHWTSKLRDL 275

Query: 243 DFAGSVTGVVGLILFNFAWNQGPVVGWQTPYT---YALLIVGTFFL-VIFAYIE 292
           D+AG VT V  L LF    + G   G +  Y    +ALL V T  L  IFAY+E
Sbjct: 276 DWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFALLCVTTLVLGSIFAYVE 326

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 100/222 (45%), Gaps = 17/222 (7%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ I   F  ++  Q  W A++Y LT   F  + G+L DI G K   +   F++AL  LL
Sbjct: 66  MNSIAAEFAESDKKQ--WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCLL 123

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GF 185
             F+    Q  F   RA    G      NA++ +  T     R+  V+  +     G G 
Sbjct: 124 TCFAQNVTQ--FSIARAI--CGIGGGGINAMSSITVTDICSARERGVYQGYANVVFGTGQ 179

Query: 186 FLGAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFV-IPHTPMPSRDASSFKLLER 241
            LGA     L     W   + I   M + C VLA+    + + H P P  +  ++K L R
Sbjct: 180 LLGAPIGGFLLDSIGWRSIFGIQVPMLMLCSVLALKNVNIKLVHIP-PRNERFTWKNLSR 238

Query: 242 IDFAGSVTGVVGL--ILF--NFAWNQGPVVGWQTPYTYALLI 279
           ID  GS++ V  +  ILF  +  WN+  ++G  T  +++L I
Sbjct: 239 IDIFGSISLVATISGILFLTSSNWNKS-LLGIFTVLSFSLFI 279

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 87/400 (21%), Positives = 157/400 (39%), Gaps = 34/400 (8%)

Query: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 140
            +SW A+AY L+  TF  + G++ DIFG K   +     +AL  L+ G S          
Sbjct: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS--PGLWCLVA 222

Query: 141 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVFSSMLG 196
            R   G+G   L   + +I      P R + +   +    FG     G  +G  FS   G
Sbjct: 223 GRFIAGIGGGGLTSMS-SITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGG 281

Query: 197 QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMP----------SRDASSFKLLERIDFAG 246
               W  A+ I    C   A++   ++ +  +P            D    + L RID+ G
Sbjct: 282 ---GWRVAFLIQIPLC---AISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWFG 335

Query: 247 SVTGVVGLILFNFAWNQGPVVGWQTPYT----YALLIVGTFFLVIFAYIESRXXXXXXXX 302
           +++ VV L+LF  A + G   G + P+     YAL +        F Y+E+         
Sbjct: 336 ALSLVVFLLLFMLASSLG---GKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILP 392

Query: 303 XXXSSDTAFVLSCIAAGWASFGIWI--FYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAA 360
                +   + S +A  ++  G+    ++   +        P     +  P   S    +
Sbjct: 393 VAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGS 452

Query: 361 VTTGFLLSHTPPSTVMLFAMTAF-TVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419
           +  G+ +  T     +L A  A   VG + I+    +   W Q ++ +++  +G+ +   
Sbjct: 453 LGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQ-YILLVIPGFGLSVLIT 511

Query: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 459
              + +  ++PHEHQ    S+     +   ++G+ I G I
Sbjct: 512 VTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAI 551

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 87/194 (44%), Gaps = 20/194 (10%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L  LL
Sbjct: 67  MNRVAEEFAESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLL 124

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 181
             F+    Q  F   RA  GMG   +  NA++ +  +     R+  +F      +FG   
Sbjct: 125 TCFAQNVTQ--FSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVFGMGQ 180

Query: 182 PGGFFLGAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFV-IPHTPMPSRDASSFK 237
             G  LG +F   +G    W   + I   M + C  L +    + + H P P ++  ++K
Sbjct: 181 VLGAPLGGLFLDHIG----WRTLFGIQVPMIMFCSYLTITNVNIKLLHVP-PRKERFTWK 235

Query: 238 LLERIDFAGSVTGV 251
            L RID  GS++ V
Sbjct: 236 NLSRIDIFGSLSLV 249

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 85/201 (42%), Gaps = 33/201 (16%)

Query: 79  AGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFF 138
           + Q+SW A++Y L+   F  + G+L DIFG K   V     +A+   L G S ++  I+ 
Sbjct: 75  SSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCG-SPWTTNIWI 133

Query: 139 DCCRAFQGMGPAFLLPNAIAILGRTYKPGRRK-------NMVFSLFGASAPGGFFLGAVF 191
                F        L     I      P R++       N+ FSL  AS   G  LGAV 
Sbjct: 134 LSAGRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCAS---GSVLGAVL 190

Query: 192 SSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRD------------ASSF--- 236
              +G    W WA+ I      +  ++G  ++    +PS               ++F   
Sbjct: 191 QQGIG----WRWAFLIQ---VPIALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWS 243

Query: 237 KLLERIDFAGSVTGVVGLILF 257
           K+ + IDF GS+T V+ ++L 
Sbjct: 244 KVTKMIDFVGSITLVMSMLLL 264

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 137/320 (42%), Gaps = 64/320 (20%)

Query: 2   STSSSVTQKNLDTNAEALK--KEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAG 59
           S+S + + K+   ++ AL+  KED+   E D++D  PK+  W      +  ++ L    G
Sbjct: 64  SSSENDSYKSGREHSGALEGNKEDEEDLEIDLRD--PKTFKW--VLTSLWTNSALSALDG 119

Query: 60  LGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 119
              S   ++ + + F    A  ++W A+AY LT      + G++ DI G +K  + G   
Sbjct: 120 TIVS-TTVNDVASRF--QQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIV 176

Query: 120 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 179
           +A+     G  ++S  I            P   +   I  +G +   G   N++ S    
Sbjct: 177 FAVG---VGLCIFSKSI------------PQLAIARGICGIGGS-GTGAMTNIILSDMAP 220

Query: 180 SAPGGFF------LGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTP------ 227
            +  G +      LG VF S+ G L      Y+          V+G F IP  P      
Sbjct: 221 LSERGKYWGYGSMLGGVFQSLGGPLGGILLTYF---------GVSGLF-IPQIPFCLATL 270

Query: 228 ------MPSRDASSFKLLERIDFAGSVTGVVGL--ILFNFAWNQGPVV----GWQTPY-- 273
                 +   +  +    +RIDF GS+  +VG+   +F F+ ++ P +    GW +PY  
Sbjct: 271 YLSWKYVQDYNQDTKGSWKRIDFGGSICLLVGISSFIFFFSADENPSISEHSGW-SPYKK 329

Query: 274 -TYALLIVGT-FFLVIFAYI 291
            ++A+ ++ T  FLV+  Y+
Sbjct: 330 WSFAIFVLFTILFLVVEKYV 349

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 145/387 (37%), Gaps = 25/387 (6%)

Query: 68  HIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 127
             IGN F   N    SW  +AY +T  +F  + G   D  G +         + +  L  
Sbjct: 80  QTIGNEFNHMNIS--SWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLAC 137

Query: 128 GFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GFF 186
           G S   N +     RA  G+G   L+  +  I+     P  ++  +F  F     G G  
Sbjct: 138 GLS--PNIVVLSFMRALTGIGGGGLITLS-TIVNSDMIPSSKRG-IFQAFQNLLLGLGAI 193

Query: 187 LGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSF-----KLLER 241
            GA F   +     W W +++    C   ++     +P+          F     K+L+ 
Sbjct: 194 CGASFGGSIASSIGWRWCFFVQVPICITNSLIMSSYVPNQKEYEDREIGFLFHPKKILKD 253

Query: 242 IDFAGSVTGVVGLILFNFAWNQGPV---VGWQTPYTYALLIVGTFFLVIFAYIESRXXXX 298
           ID  GSV  ++GL L     + G     V W +P    LL      LV+F Y E++    
Sbjct: 254 IDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKTSAR 313

Query: 299 XXX-XXXXSSDTAFVLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAIS 355
                    S  +FV+  I+   G+AS+  ++F    F +   G +   +  + +  ++ 
Sbjct: 314 AIIPLELMRSSFSFVVLTISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLF 372

Query: 356 GFCAAVTTGFLLSHTPPSTVMLFA-MTAFTVGTILIATAPVHQTYWAQTFVSIIVMP--W 412
                + TG  +S      ++L+A +    +G  L          W    V + ++P   
Sbjct: 373 TPVGGLITGICMSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNW---LVGLFLIPANL 429

Query: 413 GMDMSFPAATIMLSDSMPHEHQGLAAS 439
           G  ++FPA       + P   Q  A S
Sbjct: 430 GQGITFPATLFTFIFAFPKSRQATATS 456

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 98/222 (44%), Gaps = 30/222 (13%)

Query: 79  AGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFF 138
           + Q+SW A++Y L+   F  + G+L D+FG K   +     +    +L G + ++  ++ 
Sbjct: 66  SNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWM 124

Query: 139 DCC-RAFQGMGPAFLLPNAIA-ILGRTYKPGRRK-------NMVFSLFGASAPGGFFLGA 189
            C  R   G+G   L  N+++ I      P R++       N+VF+L  AS       G+
Sbjct: 125 LCIGRFIAGVGGGGL--NSLSTITTSDIIPLRQRGVYQGMGNIVFALGCAS-------GS 175

Query: 190 VFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTP----------MPSRDASSFKLL 239
           +  + L Q   W WA+ +  +   +L+ +      + P          + ++  ++  + 
Sbjct: 176 LIGAFLQQRIGWRWAF-LCQVPLSLLSCSLIMKFLNLPAGSPGRGLINLSNKKITTADVR 234

Query: 240 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVG 281
           E +DF GS T +  ++L     +        T  T+AL IVG
Sbjct: 235 EHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWALFIVG 276

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 112/494 (22%), Positives = 201/494 (40%), Gaps = 51/494 (10%)

Query: 9   QKNLDTNAEALKKEDKV--LSEFDIQDERPKSLLWESA-FVGVLCSAQLMTQAGLGQSLA 65
           +KN+  +  ++ +E+++  L+E     ER K LL E+A F  V  S       GL  +++
Sbjct: 11  RKNVPPSYSSISREEQMFSLTERPSWSERHKVLLIETALFTNVFLS-------GLDSTIS 63

Query: 66  P--LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFG--HKKFFVLGFFWYA 121
                +IGN FG       SW  +AY +T  +F  + G   D  G  H  FF    F   
Sbjct: 64  ASTYQLIGNEFGDVKLS--SWITTAYLITCTSFQPLYGSFSDTLGRRHCLFFANTIFALG 121

Query: 122 LWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASA 181
            +      ++YS  +     RA  G+G   L+  +  I+     P +++ +  +      
Sbjct: 122 CFGCGTTTTIYSLILM----RALTGIGGGGLITLS-TIINSDIIPAKKRGIYQAFQNVLL 176

Query: 182 PGGFFLGAVFSSMLGQLAWWPWAYWI-MGIACFVLAVAGYFVIPHTPMPSRDASSFKL-- 238
             G  +GA    ++     W W + + + I+     VA +FV    P  +   S+ +   
Sbjct: 177 GTGAVVGASCGGLIATTMGWRWCFLLQVPISVGGTLVAFFFVHDQRPDINGGVSAVRTTG 236

Query: 239 ---LERIDFAGSVTGVVGLI--LFNFAWN---QGPVVGWQTPYTYALLIVGTFFLVIFAY 290
              LE+IDF+G++  V+GL   LF    N   +     W +P +  L +     L++FAY
Sbjct: 237 WEKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSESYWYSPQSIVLTLSTGVSLILFAY 296

Query: 291 IESRXXXX----XXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSS 346
           +E                    T  ++S +  G+ ++  +IF    + +   G T   + 
Sbjct: 297 VEHTTKANPIIPHDLLRQAHGATVLIIS-VLVGFVAYA-YIFTLPLYFQVVIGDTAAKAG 354

Query: 347 AQFSPVAISGFCAAV---TTGFLLSHTPPSTVMLFA-MTAFTVGTILIATAPVHQTYWAQ 402
            + +   +  FC  +    TG  + +     V+L + +T   +G +          YW Q
Sbjct: 355 LRLT---VPSFCTPIGGLITGLSMKNPNHLPVLLISGITCMLLGNLCFLFIKPWTPYW-Q 410

Query: 403 TFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGT---I 459
           T + ++    G  ++FP+       + P   Q  A S +   +  S+    G+AGT   I
Sbjct: 411 TSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTL--YLFRSVGCVWGVAGTSSLI 468

Query: 460 ESRVNDGGAKPLKG 473
           +  V +   K L G
Sbjct: 469 QYAVRNQAKKSLNG 482

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 99/235 (42%), Gaps = 25/235 (10%)

Query: 3   TSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQ 62
           T S  T + +D   ++L+  D+  +E   +   P +LL      G++    L+T  G   
Sbjct: 49  TLSRATTREID--GDSLQSSDEEKNEQASESTSPYTLLTYKQKWGMVA---LLTMCGFWS 103

Query: 63  SLAP------LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 116
           SL        L  +   FG  +  +++     Y L  G    I+G L D+FG +   ++G
Sbjct: 104 SLGSPIYYPALRQLEKQFGL-DENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIG 162

Query: 117 FFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS 175
              Y + S+ LA    Y   +F    R  Q +G +  +  +  ++G       R   V  
Sbjct: 163 MLIYVVASIGLACAPSYGVIVFL---RIIQSIGISPTIAISSGVVGDFTLKHERGTFV-- 217

Query: 176 LFGASAPGGFFLGAVFSSMLGQL--AWWPWA--YWIMGIACFVLAVAGYFVIPHT 226
             GA++ G   LG  F S++G +  A W W   +W + I C    +  + ++P T
Sbjct: 218 --GATS-GLVLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPET 269

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 19/157 (12%)

Query: 68  HIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 127
             IG  F   N   + W  + YSL+   F L+ GR+  + G K   +L    + + SL+A
Sbjct: 68  ETIGEKFNDYN--DVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIA 125

Query: 128 GFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMV-----FSLFGASAP 182
             +V ++       R   G G +  + + + I+G +    R + MV     F+  G++A 
Sbjct: 126 --AVSNSMGMLIAGRVVAGAGGSG-IQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAG 182

Query: 183 GGFFLGAVFSSMLGQLAWWPWAYWIM----GIACFVL 215
           G    GA     L + A W W ++I     G A F+L
Sbjct: 183 GPILGGA-----LNEHASWRWCFFINLPIGGAAAFML 214

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 94/228 (41%), Gaps = 24/228 (10%)

Query: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 140
           ++SW A+AY L+  TF  + G+L DIFG +   V     + L +L+ G S   N      
Sbjct: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMS--KNLWVLVL 233

Query: 141 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVFSSMLG 196
            R   G+G    L +  +I      P R + +   +    FG     G  +G +F+    
Sbjct: 234 GRFVAGIGGGG-LTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLFAD--- 289

Query: 197 QLAWWPWAYWIMGIACFV--LAVAGYFVIPHTPMPSRDASSFKL-----LERIDFAGSVT 249
           +   W  A+ +      +   A+  +  +P      + A    +     L  +D+ G+VT
Sbjct: 290 RAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVT 349

Query: 250 GVVGLILFNFAWNQGPVVGWQTPYTYALLIV----GTFFLVIFAYIES 293
            VV L  F    +   + G   P+ Y + +V    G++F+    Y+ +
Sbjct: 350 LVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHELYVAT 394

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 96/246 (39%), Gaps = 50/246 (20%)

Query: 80  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFD 139
           G + W  + Y+L+   F+L+ GRL +I G K+  ++    + + SL++  S  ++     
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALS--NSMATLI 100

Query: 140 CCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL---FGASAPGGFFLGAVFSSMLG 196
             R   G G + +   A  +     +   R  M+ +L   +  +   G F+G  F+  L 
Sbjct: 101 SGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLS 160

Query: 197 QLAWWPWAYWIM----GIACFVLAVAGYFVIPHTPM--PSR-------------DASSFK 237
               W W ++I       A  +LA       PH  M  PS+              AS +K
Sbjct: 161 ----WRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIMNYDYGELLKASFWK 216

Query: 238 -----LLERIDFAGSVTGVVGLILF---------NFAWNQGPVVGWQTPYTYALLIVGTF 283
                L+ ++D  G +    G  L          NF WN G ++ + T        VG  
Sbjct: 217 NTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICFFT--------VGPI 268

Query: 284 FLVIFA 289
            L++F 
Sbjct: 269 LLLLFC 274

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 95/238 (39%), Gaps = 25/238 (10%)

Query: 2   STSSSVTQKNLDTNAEALKKEDKV--LSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAG 59
            T++   + +LD+   +   +DKV    +   + + P +LL      G++    ++T  G
Sbjct: 54  KTTTREIEGDLDSETSSHSSDDKVDPTQQITAETKAPYTLLSYGQKWGMVA---ILTMCG 110

Query: 60  LGQSLAP------LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFF 113
              SL        L  +   F   +   ++     Y L  G    ++G L D FG +   
Sbjct: 111 FWSSLGSPIYYPALRQLEKQF-NVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPII 169

Query: 114 VLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNM 172
           + G   Y + S+ LA    Y   IF  C ++  G+ P   + + + +   T K  R    
Sbjct: 170 LAGMLIYVIASIGLACAPSYGVIIFLRCIQSI-GISPTIAISSGV-VGDFTLKHER---- 223

Query: 173 VFSLFGASAPGGFFLGAVFSSMLGQL--AWWPWA--YWIMGIACFVLAVAGYFVIPHT 226
               F  +  G   LG  F S++G +  A W W   +W + I C    +  + ++P T
Sbjct: 224 --GTFVGATSGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPET 279

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 83/189 (43%), Gaps = 8/189 (4%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  +N  Q  W A++Y LT   F  + GRL DI G K   ++  F++ + S L
Sbjct: 90  MNRVAEDFNASNQKQ--WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSFL 147

Query: 127 AGFSVYSNQIFFDCCRAF---QGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG 183
             FS    Q  F   RA     G G + +   A++ +    + G  +      +GA    
Sbjct: 148 TTFSKTLPQ--FALARAVAGIGGGGISAMSSIAVSDICTVKERGMYQGYANIFYGAGQLI 205

Query: 184 GFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERID 243
           G  +G +    +G  A + +   ++ +A F+        + H P P  +   +K L ++D
Sbjct: 206 GAPIGGLLIDRIGWRALFAFQVPMVAVAMFLSFTYLNIKLAHLP-PKEERYKWKHLSKLD 264

Query: 244 FAGSVTGVV 252
             GS+T V+
Sbjct: 265 IFGSITLVI 273

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 89/202 (44%), Gaps = 22/202 (10%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L   L
Sbjct: 64  MNKVAEEFEESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFL 121

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 181
             F+    Q  F   RA  G+G   +  NA++ +  +     R+  ++      +FG   
Sbjct: 122 TCFAQNITQ--FSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQ 177

Query: 182 PGGFFLGAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFV-IPHTPMPSRDASSFK 237
             G  LG +F   +G    W   + +   M + C  LA     V + H P P ++  ++K
Sbjct: 178 LLGAPLGGLFIDSVG----WRVIFGVQVPMLLLCSTLATRNINVKLAHIP-PRKERFTWK 232

Query: 238 LLERIDFAGS--VTGVVGLILF 257
            L RID  GS  + G +  +LF
Sbjct: 233 NLSRIDIFGSLALVGTISSLLF 254

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 93/246 (37%), Gaps = 50/246 (20%)

Query: 80  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFD 139
           G + W  + Y+LT   F+L+ GRL +I G  +  ++    + + SL++  S     +   
Sbjct: 43  GNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLI-- 100

Query: 140 CCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL---FGASAPGGFFLGAVFSSMLG 196
             R   G G + +   A  +     +   R  M+ +L   +  +   G F+G  F+  L 
Sbjct: 101 SGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLS 160

Query: 197 QLAWWPWAYWI-MGIACFVLAVAGYF-----VIPHTPMPSRDAS--SFKLLE-------- 240
               W W ++I + I  F L +  +       +P   + S+  S  S+K  E        
Sbjct: 161 ----WRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKASFWK 216

Query: 241 --------RIDFAGSVTGVVGLILF---------NFAWNQGPVVGWQTPYTYALLIVGTF 283
                   ++D  G      G  L          NFAWN   ++        +L  VG  
Sbjct: 217 KAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTII--------SLFTVGPI 268

Query: 284 FLVIFA 289
            L++F 
Sbjct: 269 LLILFC 274

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 58/132 (43%), Gaps = 13/132 (9%)

Query: 100 AGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIA 158
            G L D+FG +   + G   Y + S+ LA  + Y   +F  C ++  G+ P   + +  A
Sbjct: 147 CGGLADLFGRRPVILTGMLIYTVASIGLACSNSYGVIVFLRCLQS-AGISPTISISSG-A 204

Query: 159 ILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQ-LAW---WPWAYWIMGIACFV 214
           +   T K  R        F  +  G   LG  F S++G  LA    W   +W + I C V
Sbjct: 205 VGDFTVKSER------GTFVGAVSGLVLLGQAFGSLIGAALAASFNWRAIFWFLTIGCGV 258

Query: 215 LAVAGYFVIPHT 226
             +  +FV+P T
Sbjct: 259 SMMVAFFVLPET 270

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 60/144 (41%), Gaps = 13/144 (9%)

Query: 88  AYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQG 146
            Y L  G    I+G L D FG +   + G   Y + S+ LA    Y   IF  C ++  G
Sbjct: 144 VYLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSI-G 202

Query: 147 MGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQL--AWWPWA 204
           + P   + + + +   T K  R        F  +  G   LG  F S++G +  A W W 
Sbjct: 203 ISPTIAISSGV-VGDFTLKHER------GTFVGATSGFVLLGQCFGSLIGAVLTARWDWR 255

Query: 205 --YWIMGIACFVLAVAGYFVIPHT 226
             +W + I C    +  + V+P T
Sbjct: 256 SIFWFLTIGCGSCFLIAFLVLPET 279

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 70/166 (42%), Gaps = 11/166 (6%)

Query: 84  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRA 143
           W  + YSL    F LI GR   + G +    L  F + + S+++  +   + +     R 
Sbjct: 97  WLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVG--RV 154

Query: 144 FQGMGPAFLLPNAIAILGRTYKPGRRK---NMVFSLFGASAPGGFFLGAVFSSMLGQLAW 200
             G+G + L   ++ I     +   R    ++V S F A++  G F+G  F++ +     
Sbjct: 155 IAGVGGSGLQTLSLVIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHV----I 210

Query: 201 WPWAYWIMGIACFVLAVAGYFVI--PHTPMPSRDASSFKLLERIDF 244
           W W +WI      V A+  YF          SR  S FK ++ + F
Sbjct: 211 WRWCFWINLPIGAVTALLFYFTYNPKRLSAASRFTSCFKSVKALSF 256

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 57/133 (42%), Gaps = 13/133 (9%)

Query: 99  IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 157
           + G L D FG +   + G   Y + S+ LA    Y   IF  C ++  G+ P   + + +
Sbjct: 155 VCGGLADCFGRRPIILGGMLVYVVASVGLACAPSYGVIIFLRCVQSI-GISPTIAISSGV 213

Query: 158 AILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQL--AWWPWA--YWIMGIACF 213
            +   T K  R        F  +  G   LG  F S++G +  A W W   +W + I C 
Sbjct: 214 -VGDFTLKHER------GTFVGATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCG 266

Query: 214 VLAVAGYFVIPHT 226
              +  +F++P T
Sbjct: 267 TCFLIAFFILPET 279

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 93/240 (38%), Gaps = 46/240 (19%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           + ++   FG  N  +  W  + YSL      LI GR   I G +   +L    +   SL+
Sbjct: 61  IDVVAEQFG--NYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLI 118

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAP 182
           A  +   N + F   R   G+G +  L     ++G T    R + +V S+    F  +A 
Sbjct: 119 AALASSMNMLIFG--RVVAGVGGSG-LQTLCFVIGCTMVGERSRPLVISILSCAFAVAAI 175

Query: 183 GGFFLGAVFSSMLGQLAWWPWAYWI------MGIACFVLA--VAGYFVIPHTPMPSRDAS 234
            G  +G  F++ +     W W ++I      + I  F+L        ++          S
Sbjct: 176 VGPIIGGAFTTHV----TWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTIS 231

Query: 235 SF---KLLERIDFAGSVTGVV-------------GLILF---------NFAWNQGPVVGW 269
           SF   K   +++F   + G++             GL+LF          ++WN G V+ +
Sbjct: 232 SFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVITY 291

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 63/157 (40%), Gaps = 9/157 (5%)

Query: 65  APLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWS 124
           A + +I   F   +  +  W  S YSLT     L+ GR   I G K   ++    +   S
Sbjct: 140 ASIEVIAEQF--KDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGS 197

Query: 125 LLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGG 184
           L++  S   N +     R   G+G +  + +   ++  T  P R + ++ S+   S    
Sbjct: 198 LISAISNSMNMLIGG--RVVAGIGGSG-IQSLCFVIASTLTPDRSRVIIISVLSCSYAVA 254

Query: 185 FFLGAVFSSMLGQLAWWPWAYWIM----GIACFVLAV 217
             +G      L     W W ++I     G+A  VLA+
Sbjct: 255 AVVGPFLGGALTTHVTWRWCFYINLPIGGLAFVVLAM 291

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 5/129 (3%)

Query: 99  IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 157
           I+G L D++G +   + G   Y + S+ LA  + Y   +F  C ++  G+ P  L+  + 
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFLRCVQS-AGISP--LIAISS 208

Query: 158 AILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAV 217
            ++G       R + V ++ G +  G  F G++  + L     W   +W + I C    V
Sbjct: 209 GVVGDFTTKSERGSFVGAVSGFALMGQAF-GSLIGAGLTAAYDWRAIFWFLTIGCGTCFV 267

Query: 218 AGYFVIPHT 226
             +F++P T
Sbjct: 268 INFFLLPET 276

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 84/392 (21%), Positives = 144/392 (36%), Gaps = 53/392 (13%)

Query: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 140
            +SW A+AY L+  TF  + G++ DIFG +   ++   ++ L  L+ G S   N      
Sbjct: 97  HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS--KNLWTLVA 154

Query: 141 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAW 200
            R   G+G   +     +I      P R + +   +F       FF G   +       W
Sbjct: 155 GRFIAGIGGGGVTSLG-SITASDIVPLRSRALYQGIF------NFFFGLGIAIGGLIGGW 207

Query: 201 -------WPWAYWIMGIACFVLAVAGYFVIPHTPMP---------SRDASS----FKLLE 240
                  W  A+ +    C   A++   +I    +P         S D          L+
Sbjct: 208 FSESKNGWRMAFLVQVPLC---AISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLK 264

Query: 241 RIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYT---YALLIV-----GTFFLVIFAYIE 292
           RID+ GS++ V  L  F  A + G   G + PY    + LL+V     GT F+ +  YI 
Sbjct: 265 RIDWLGSLSLVTFLFAFMLASSLG---GKEIPYNSNIFKLLVVATILSGTAFIYVELYIS 321

Query: 293 SRXXXXXXXXXXXSSDTAFVLSCIAAGWASF--GIWI-FYTWQFMEDSRGQTPLLSSAQF 349
                        S     +L    A W     G+ + FY   +    +   P     + 
Sbjct: 322 DDPILPIRFLTNRS-----ILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRI 376

Query: 350 SPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTV-GTILIATAPVHQTYWAQTFVSII 408
           +P   S    ++  G+ +  T      L   T   V G + +       + W Q ++ + 
Sbjct: 377 APNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTGLMVLGQLQVLLMKPDISTWRQ-YILLP 435

Query: 409 VMPWGMDMSFPAATIMLSDSMPHEHQGLAASL 440
           +  +G  +      + +  ++PHEHQ    S+
Sbjct: 436 LPHFGSSVLITVTLLAMIAAVPHEHQAATTSI 467

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 48/238 (20%), Positives = 85/238 (35%), Gaps = 40/238 (16%)

Query: 68  HIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 127
             IG  F   +  ++ W  + Y+L    F L+ GRL  I G K         + + SL+ 
Sbjct: 32  ETIGEKF--KDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIV 89

Query: 128 GFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFL 187
             S     I     R   G G +  + + + ++G +    R + MV ++ G +    F +
Sbjct: 90  AVSNSMGMIIGG--RVVAGCGGSG-IQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAV 146

Query: 188 GAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFVIPHTPMPS-------------- 230
           G V      +   W W ++I   +G     +    Y     +   +              
Sbjct: 147 GPVIGGAFTENVSWRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYG 206

Query: 231 --------RDASSFKLLERIDFAGSVTGVVGLILF---------NFAWNQGPVVGWQT 271
                   R A +F + + +DF G      G +LF          +AWN G ++ + T
Sbjct: 207 QWVTASFWRRAYNFLMFD-LDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISFLT 263

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 130
           ++SW A+AY L+  TF  + G+L DIFG K   +L    + +  L+ G +
Sbjct: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 60/144 (41%), Gaps = 13/144 (9%)

Query: 88  AYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQG 146
            Y L  G    ++G L D FG +   + G   Y + S+ LA    Y   IF  C ++  G
Sbjct: 143 VYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSI-G 201

Query: 147 MGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQL--AWWPWA 204
           + P   + + + +   T K  R        F  +  G   LG  F S++G +  A W W 
Sbjct: 202 ISPTIAISSGV-VGDFTLKHER------GTFVGATSGFVLLGQCFGSLIGAVLTARWDWR 254

Query: 205 --YWIMGIACFVLAVAGYFVIPHT 226
             +W + I C    +  + ++P T
Sbjct: 255 SIFWFLTIGCGSCFLIAFLILPET 278

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 84/231 (36%), Gaps = 12/231 (5%)

Query: 70  IGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 129
           IGN F   +    SW  +AY +T  +F  + G   D  G +      FF  A++++    
Sbjct: 85  IGNEFNQMSIS--SWITTAYLITSTSFQPLYGSFSDALGRRNCL---FFANAVFTIGCLA 139

Query: 130 SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GFFLG 188
             +S  I+               L     I+     P  ++  +F  F     G G   G
Sbjct: 140 CSFSTNIYMLSFMRALAGIGGGGLITLSTIVNSDVIPSSKRG-IFQAFQNLLLGFGAICG 198

Query: 189 AVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDA-----SSFKLLERID 243
           A F   +     W W + I      + ++   + +P+             SS K+L+ ID
Sbjct: 199 ASFGGTITSTIGWRWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILLSSKKILKDID 258

Query: 244 FAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR 294
             GS+  + GL L     + G    W  P    LL+     +++F   E +
Sbjct: 259 ITGSILIIAGLTLQLLYLSLGASFSWTNPPVLMLLLASIVIIILFILNERK 309

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 86/416 (20%), Positives = 166/416 (39%), Gaps = 58/416 (13%)

Query: 70  IGNSFGT-TNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 128
           +  SFG  T +G   W  + YSL    F L+ GRL  + G +   +     +   SL++ 
Sbjct: 71  VCTSFGDYTKSG---WIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLISA 127

Query: 129 FSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGG 184
            +   N +     R   G+G + L   ++ I G      + + +V SL    F  ++  G
Sbjct: 128 LAKSMNMLI--SGRVIAGVGGSGLQTLSLVI-GCQLVNEKSRPLVLSLLNCTFAVASIVG 184

Query: 185 FFLGAVFSSMLGQLAWWPWAYWI-MGIACFVLAVAGYFVIPH-TPMPSRDASSFK----- 237
            FLG  F++ +     W W ++I + I    +A+  +F  P    +  + + +FK     
Sbjct: 185 PFLGGAFTTHVT----WRWCFYINLPIGGLAIAIFIFFYNPEGADLLEKGSQTFKKLLSY 240

Query: 238 ---------LLERIDFAGSVTGVV----GLILFNFAWN-QGPVVGWQTPYTYALLIVGTF 283
                    LL+++ F   +   V    G +LF  A    G    W++    + +IVG  
Sbjct: 241 RRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGGQTHPWKSGIVISFIIVGVL 300

Query: 284 FLV--------IFAYIESRXXXXXXXXXXXSSDTAFVLSCIAAGWAS---FGIWIFYTWQ 332
            +         +F +I++             S  A +L+    G+ S   + + + Y+ Q
Sbjct: 301 LIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRA-ILNANFTGFFSTIAYNVQMIYSVQ 359

Query: 333 FMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLS---HTPPSTVMLFAMTAFTVGTIL 389
           F +   G +   +     P+ +S    ++ +G ++    H  P  V   AM     G ++
Sbjct: 360 FFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMGVLGSGLMI 419

Query: 390 IATAPVHQTYWAQTFVSIIVMPWGMDMSF--PAATIMLSDSMPHEHQGLAASLVNT 443
           +    ++ T    T + ++++P G+ + F  PAA I     +        A ++ T
Sbjct: 420 L----LNNTSTKHTQIGVLILP-GVALGFVLPAALITCHVQLDRTSPSYGADMLET 470

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 130
           ++SW A+AY L+  TF  I G++ DIFG K   +     + + SL+ G S
Sbjct: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 82/185 (44%), Gaps = 16/185 (8%)

Query: 78  NAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIF 137
            + ++ W A+++ LT   F  I G+L D+ G +   VL +  + L  L+  ++   N   
Sbjct: 80  ESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFLLGCLVTAYA--RNIWE 137

Query: 138 FDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQ 197
           F   RA  G+G   +    +  +G  +    +     S++ + A   + +G V  + +G 
Sbjct: 138 FAFGRAICGIGAGGIPTMCVITMGDMFSVKEQ-----SIYQSYAHIIYTIGEVLGAPIGG 192

Query: 198 LAWWPWAYWIMGIACF-VLAVAGYFVI-------PHTPMPSRDASSFKLLERIDFAGSVT 249
           +A     +  + +A   VL +  Y  +        H P P  +  ++K + R+D +GS+ 
Sbjct: 193 IALETVGWRAIFLAQVPVLTICIYLTLCDDDLAQQHIP-PHGERLTWKNISRMDLSGSIL 251

Query: 250 GVVGL 254
            ++ L
Sbjct: 252 LIISL 256

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 15/134 (11%)

Query: 99  IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 157
           ++G L DI+G +   + G   Y + S+ +A  + Y   IF  C ++  G+ P   + +  
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYGVIIFLRCLQS-TGISPLIAISSG- 210

Query: 158 AILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQ-LAW---WPWAYWIMGIAC- 212
           A+   T K  R        F  +  G   +G  F S++G  LA    W   +W + I C 
Sbjct: 211 AVGDFTVKAER------GTFVGAVSGLVLMGQAFGSLIGAALAAAYNWRAIFWFLAIGCG 264

Query: 213 FVLAVAGYFVIPHT 226
             +A+AG  V+P T
Sbjct: 265 ACMAIAG-IVLPET 277

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 59/143 (41%), Gaps = 13/143 (9%)

Query: 89  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGM 147
           Y L  G    ++G L D+FG +   + G   Y + S+ LA    Y    F  C ++  G+
Sbjct: 146 YLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGLACAPSYGVICFLRCIQSI-GI 204

Query: 148 GPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQL--AWWPWA- 204
            P   + + + +   T K  R        F  +  G   LG  F S++G +  A W W  
Sbjct: 205 SPTIAISSGV-VGDFTLKHER------GTFVGATSGLVLLGQCFGSLIGAVLTARWDWRA 257

Query: 205 -YWIMGIACFVLAVAGYFVIPHT 226
            +W + I   V  +   F +P T
Sbjct: 258 IFWFLAIGSGVALIVAAFTLPET 280

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 102/263 (38%), Gaps = 37/263 (14%)

Query: 1   MSTSSSVTQKNLDTNAEA-----LKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLM 55
           MS     + K L T AE+     +++  KV+S    QD+  K      A +G L  A  +
Sbjct: 1   MSALEDNSSKELCTQAESSTSEVVEQNKKVVS----QDQVVKGFALY-ACLGSLTLALFL 55

Query: 56  TQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 115
           +   +      +  +   F      +  W  + YSL      L+ GR   I G K   +L
Sbjct: 56  SALDILIVSTIIETVSRDF--NEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLL 113

Query: 116 GFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS 175
               + + SL++  +   N +     R   G+G + L      I+  T    R + M  S
Sbjct: 114 SIIIFEVGSLVSALANSMNMLIGG--RVISGVGGSGLQTLCFLII-STLVNERSRGMAIS 170

Query: 176 L----FGASAPGGFFLGAVFSSMLGQLAWWPWAYWIM----GIACFVLAVAGYFVIPHTP 227
           +    F  ++  G FLG  F++ +     W W ++I     G+A  V      FV+ + P
Sbjct: 171 VLSCSFAVASIVGPFLGGAFTTHV----TWRWCFYINLPIGGLAFLV------FVLSYNP 220

Query: 228 MPSRDASSF----KLLERIDFAG 246
                  +F    + +  +DF G
Sbjct: 221 NGGNSIKNFTKAVRSISHVDFGG 243

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 102/228 (44%), Gaps = 26/228 (11%)

Query: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 140
           ++SW A++Y L+  TF  + G++ DIFG K   V     + +  L+ G S   +  +   
Sbjct: 147 KVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS--KSFWWLVI 204

Query: 141 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVFSSMLG 196
            R   G+G   L   + +I      P R + M   +    +G     G  +G  FS   G
Sbjct: 205 ARFVAGVGGGGLTSMS-SITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKG 263

Query: 197 QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSR------DASSFKLLERIDFAGSVTG 250
               W  A+ I      + A++   +I H  +PS+      D S  + L  ID+ G+ T 
Sbjct: 264 ---GWRMAFLIQ---VPLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLGASTL 317

Query: 251 VVGLILFNFAWNQGPVVGWQTPY---TYALLIVGTFF-LVIFAYIESR 294
           V+ L+LF    + G   G +  Y   T+AL+++ +    ++F Y+E R
Sbjct: 318 VIFLVLFLLTASLG---GKEIAYGSRTFALMLISSLLSCLVFIYVELR 362

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 11/128 (8%)

Query: 84  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRA 143
           W  + YSL      L+ GR+  I G K   +     + + SL++G +   N +     R 
Sbjct: 117 WIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGG--RV 174

Query: 144 FQGMGPAFLLPNAIAILGRTYKPGRRKNMVF----SLFGASAPGGFFLGAVFSSMLGQLA 199
             G+G + +   A  ++G      RR+ ++     S F  ++  G FLG  F++     A
Sbjct: 175 IAGVGGSGIQSLAF-VIGSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTH----A 229

Query: 200 WWPWAYWI 207
            W W ++I
Sbjct: 230 TWRWCFYI 237

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 59/146 (40%), Gaps = 12/146 (8%)

Query: 98  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGM---GPAFLLP 154
           +I   L +I+G +   V+  F + ++      +     I    CR F G+    P  ++P
Sbjct: 253 VIYAPLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMI--CRFFSGVIGSAPMAVVP 310

Query: 155 NAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGI---A 211
            A A +  T   G+   + FSLF    P    L  VF S + Q   W W  +++GI    
Sbjct: 311 AAFADMFDTNLRGKAICL-FSLFVFVGP---ILSPVFGSYMAQRTTWRWLEYVVGIFAGV 366

Query: 212 CFVLAVAGYFVIPHTPMPSRDASSFK 237
            FVL V  Y    H  +    A   +
Sbjct: 367 VFVLIVLFYEETHHPSILVNKAKQMR 392

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 11/128 (8%)

Query: 84  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRA 143
           W  + YSL      LI GR   + G +   ++  F + + S+++  +   N +     R 
Sbjct: 114 WLITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIVSATATSMNNLVVG--RV 171

Query: 144 FQGMGPAFLLPNAIAILGRTYKPGRRKNMVF----SLFGASAPGGFFLGAVFSSMLGQLA 199
             G+G + L   ++ I+G +    R + +V     S F  S+  G F+G  F++     A
Sbjct: 172 VAGIGGSGLQTVSM-IIGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIGGAFTTH----A 226

Query: 200 WWPWAYWI 207
            W W +WI
Sbjct: 227 TWRWCFWI 234

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 94/236 (39%), Gaps = 27/236 (11%)

Query: 4   SSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQS 63
           S   T +   +++E+++  D       +    P +LL  +      C   L+T AG   S
Sbjct: 44  SRVTTHEMKGSSSESIEGHDIAHDNAPLPQHAPYTLLSNAQ---KWCMVALLTSAGFWSS 100

Query: 64  L-APLHIIGNSFGTTNAGQLSWFASAYSLTVGTFIL-------IAGRLGDIFGHKKFFVL 115
           L +P++            Q S      ++TV  +++       I+G L D++G +   ++
Sbjct: 101 LGSPIYYPALK---QLEKQFSVSEELVNITVVVYLIFQGVAPTISGGLADVYGRRPVILI 157

Query: 116 GFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVF 174
           G   Y   S+ LA  + Y   +F  C ++  G+ P   + N+  +   T K  R      
Sbjct: 158 GMLIYVCASIGLACSNSYGVIVFLRCLQS-AGISPIIAI-NSGVVGDFTVKQER------ 209

Query: 175 SLFGASAPGGFFLGAVFSSMLGQLAW----WPWAYWIMGIACFVLAVAGYFVIPHT 226
             F  +  G   +G  F S++G        W   +W + I C    +  + ++P T
Sbjct: 210 GTFVGAVSGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMLVNFLLLPET 265

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 99  IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 157
           I+G L D++G +   ++G   Y   S+ LA    Y   +F  C ++  G+ P   + N+ 
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFLRCLQS-AGISPIIAI-NSG 198

Query: 158 AILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAW----WPWAYWIMGIACF 213
            +   T K  R        F  +  G   +G  F S++G        W   +W + I C 
Sbjct: 199 VVGDFTLKHER------GTFVGAVSGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCG 252

Query: 214 VLAVAGYFVIPHT 226
              +  + ++P T
Sbjct: 253 TCMIINFLILPET 265

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 80/188 (42%), Gaps = 12/188 (6%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  ++  Q  W A+++ LT   F  + G+L D+ G K   ++ +F+  +  LL
Sbjct: 59  MNRVAEEFSESDKKQ--WIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLL 116

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASA 181
              +   N   F   RA    G      NA + +  +     ++  ++      +FG   
Sbjct: 117 TCLA--RNVTEFAVARAI--CGIGGGGINACSSITVSDICTAKERGIYQGYANIVFGMGQ 172

Query: 182 PGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLER 241
             G  LG +F   +G  A +     ++ ++ F+        + H P P  +  + K L R
Sbjct: 173 MLGAPLGGLFIDTIGWRAIFGIQVPVVMVSAFLAYRNVNIKLSHVP-PISERFTRKNLSR 231

Query: 242 IDFAGSVT 249
           IDF GSVT
Sbjct: 232 IDFLGSVT 239

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 66/153 (43%), Gaps = 11/153 (7%)

Query: 78  NAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQI 136
           +  +++     Y L  G    I+G L D++G +   + G   + + S+ +A    Y   +
Sbjct: 124 DENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASIGIAKAPSYGVIV 183

Query: 137 FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG---GFFLGAVFSS 193
           F  C ++  G+ P   + + + +   T K   R   V +  G    G   G  LGAV ++
Sbjct: 184 FLRCIQSI-GISPTIAISSGV-VSDFTVK-RERGTFVGATSGLVLIGQGIGPLLGAVITA 240

Query: 194 MLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHT 226
            L     W   +W + I C    + G+F++P T
Sbjct: 241 AL----HWRAVFWFLTIGCGSCMIIGFFLLPET 269

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 52/133 (39%), Gaps = 13/133 (9%)

Query: 99  IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAI 157
           + G L DI+G +   + G   Y + S+ LA  + Y   IF  C    Q  G + ++  + 
Sbjct: 157 VCGGLADIYGRRPVILFGMLVYIVASIALACANSYGVIIFLRC---LQSCGISPIIAISS 213

Query: 158 AILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQL--AWWPWA--YWIMGIACF 213
             +G       R   V      +  G   LG  F S++G    A W W   +W + I   
Sbjct: 214 GCVGDFTMKAERGTFV-----GAVSGLVLLGQAFGSLIGAALAAAWDWRAIFWFLAIGAG 268

Query: 214 VLAVAGYFVIPHT 226
                G  V+P T
Sbjct: 269 CCLFVGILVLPET 281

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 9/127 (7%)

Query: 84  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRA 143
           W  + YSL      LI GR+  + G K   +     + + SL+A  +   + +     R 
Sbjct: 94  WIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGG--RV 151

Query: 144 FQGMGPAFLLPNAIAILGRTYKPGRRKNMVF---SLFGASAPGGFFLGAVFSSMLGQLAW 200
             G+G + +      I+    +  +R  ++    S FG ++  G FLG  F++ +     
Sbjct: 152 IAGLGGSGIQTLCFVIISTLVEESKRGLLIACMGSAFGIASVVGPFLGGAFTTHVT---- 207

Query: 201 WPWAYWI 207
           W W +WI
Sbjct: 208 WRWCFWI 214

>Kwal_33.13713 s33 (361891..363393) [1503 bp, 500 aa] {ON} YCR028C
           (FEN2) - Amino acid permease [contig 114] FULL
          Length = 500

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 123 WSLLAGFSVYSNQIFFDCC--RAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGAS 180
           W LL  FS+Y    F  CC  R FQ +  +        ILG  YK  R   +  ++F +S
Sbjct: 131 WGLLT-FSMYKVTSFQQCCAIRFFQAVFESCTFSGTHLILGSWYKE-RELTIRTAIFTSS 188

Query: 181 AP-----GGFFLGAVFSSMLGQ--LAWWPWAYWIMGIACFVLAVAGYFVIPHTP 227
                   GF   A+  S+ G   LA W W + +  +    +AV G+   P TP
Sbjct: 189 GLVGSIFSGFMQVAIHKSLDGHRGLAGWRWLFIVDFLITLPVAVYGFIFFPTTP 242

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 13/112 (11%)

Query: 376 MLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 435
           ++F +  + VGTI+  +A      W Q F+  I+  WG+      A +++S++ P   +G
Sbjct: 145 LMFVVGVYVVGTIIQISA---SDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRG 201

Query: 436 LAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGL 487
              S    +V + I +G  +     +R  DG  +        W + +GLS L
Sbjct: 202 TLISCYQLMVTFGIFLGYCVV--YATRKYDGSEQ--------WRIPLGLSFL 243

>KLTH0E04400g Chr5 (397784..399256) [1473 bp, 490 aa] {ON} weakly
           similar to uniprot|Q08777 Saccharomyces cerevisiae
           YOR306C MCH5
          Length = 490

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 98/238 (41%), Gaps = 28/238 (11%)

Query: 3   TSSSVTQKNLDTNAEALKKEDKVLSEFDIQDE-RPKSLLWES------AFVGVLCSAQLM 55
           T SS    N+ T+    KK ++V+ ++ + DE       W++      +F+G   +    
Sbjct: 13  TESSKVLANISTSQG--KKREEVVEDYSVPDEFEYAEGGWKAWMAILGSFLGFFPTWGFF 70

Query: 56  TQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLT-VGTFILIAGRLGDIFGHKKFFV 114
             AG+ Q+    +I  N   T +   +SW  S Y+   +G+F+  +G   D+ G ++  +
Sbjct: 71  YTAGVMQN----YIAKNQLATASTSTISWVFSVYNFCLLGSFVF-SGLYFDLNGARRPLI 125

Query: 115 LG--FFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNM 172
           LG   F   +++L     V+    F  C     GMG        I ++   +   RR+ +
Sbjct: 126 LGNVMFLTGMFALGNCTKVWH---FIVCLGILVGMGSGISSSPLIGVVCHHFN--RRRGI 180

Query: 173 VFSLFGASAPGGFFLGAVFSSMLGQL---AWWPWAYWIMGIACFVLAVAGYFVIPHTP 227
             +L   +  GG   G V   ML  L   + +PWA   +G       V   F+    P
Sbjct: 181 ATAL---AMNGGSIGGVVIPLMLRSLFEKSGYPWAMRSLGFLSTGFLVCSVFLAREDP 235

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 73/337 (21%), Positives = 122/337 (36%), Gaps = 35/337 (10%)

Query: 3   TSSSVTQKNLDTNAEALKKEDKVLSEFD---IQDERPKSLLWESAFVGVLCSAQLMTQAG 59
           T +S+ + N D   +  K ED  LS      I +    S ++ S F G + ++   T   
Sbjct: 24  TETSLVEDNADIE-DVDKDEDMALSRIPNLWIIEATLFSNVFLSGFDGTVTASTYQT--- 79

Query: 60  LGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 119
                     IGN F   +     W  +AY +T  +F  + G   D  G +      FF 
Sbjct: 80  ----------IGNEFNQMSISN--WITTAYLITSTSFQPLYGSFSDALGRRNCL---FFA 124

Query: 120 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 179
            A +++       S  I+               L     I+     P  ++  +F  F  
Sbjct: 125 NAAFTIGCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRG-IFQAFQN 183

Query: 180 SAPG-GFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSF-- 236
              G G   GA F   +     W W + I      + +V   + +P+    + + S+   
Sbjct: 184 LLLGFGAICGASFGGTIASTIGWRWCFLIQVPISIISSVLMNYYVPNQKEYNHENSNIFR 243

Query: 237 ---KLLERIDFAGS---VTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAY 290
              ++L  ID  GS   +TG+   +L+      G  + W +P    LL+     L++F  
Sbjct: 244 NSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVGSIAILLLFIS 303

Query: 291 IESRXXXXXXX-XXXXSSDTAFV--LSCIAAGWASFG 324
            E +            SS  +FV  L  I  G+AS+ 
Sbjct: 304 HEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYA 340

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 89/229 (38%), Gaps = 13/229 (5%)

Query: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESA---FVGVLCSAQLMTQA 58
            T   VT +  D  +     + + LSE D+    P +LL        V +L SA   +  
Sbjct: 42  DTDDVVTHEIYDEESFPDGSKQEQLSEEDV----PYTLLTYRQKWFMVALLTSAGFWSSL 97

Query: 59  GLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 118
           G       L  +   F   N   ++     Y L  G    I+G L D++G +   +LG  
Sbjct: 98  GSPIYYPALKELEAEFDV-NEELINITVVVYLLFQGIAPTISGGLADVYGRRPIILLGML 156

Query: 119 WYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLF 177
            Y + S+ LA    Y   +F  C ++  G+ P   + + +A  G       R   V ++ 
Sbjct: 157 IYVIASIGLACSKSYGAVVFLRCLQS-AGISPIIAINSGVA--GDFTVKSERGTFVGAVS 213

Query: 178 GASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHT 226
           G +  G  F G++  + L     W   +W + I C    +   F++  T
Sbjct: 214 GFTLMGQAF-GSLIGAALTAAYDWRAIFWFLVIGCGTCMIILCFLLIET 261

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 93/254 (36%), Gaps = 36/254 (14%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           L+ I + F   +  ++ W  + YSL+   F L+ GR   IFG K   ++    + + SL+
Sbjct: 44  LNTIADKFNAYS--KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLV 101

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFF 186
              S   + I     R   G G + +     AI         R  +V +L   S      
Sbjct: 102 IAVSNSMDMIIGG--RVIAGCGASGIQTLVFAIATSLVDEHTRGTIV-TLLSLSYAVASA 158

Query: 187 LGAVFSSMLGQLAWWPWAYWI-MGIACFVLAVAGYFVIPHTPMPSRDASS----FKLLER 241
           LG      L +   W W ++I + I    L   G F + + P   +        FK +  
Sbjct: 159 LGPYIGGALTEYVTWRWCFYINLPIGGLAL---GVFYLSYNPAQRKVLKCFPHFFKSVTS 215

Query: 242 IDFAGSVTGVVGLILFNFAWNQGPVVG-----------------------WQTPYTYALL 278
           ++F   ++     +L  F   +    G                       WQ+    A L
Sbjct: 216 LEFKQLLSLKFYRMLLKFLVFELDFFGFTFCSVGFVLLLLGLTFGGNLHPWQSGTIIAYL 275

Query: 279 IVGTFFLVIFAYIE 292
           +VG+FF+VIF   E
Sbjct: 276 VVGSFFIVIFFVYE 289

>Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067C
           (REAL)
          Length = 591

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 53/116 (45%), Gaps = 15/116 (12%)

Query: 123 WSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIA---ILGRTYKPGR--RKNMVFSL 176
           WSLL   + Y N +      R F G   AF  P+ +A   + G  YK     R++  + L
Sbjct: 212 WSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYL 268

Query: 177 ---FGASAPGGFFLGAVFSSMLGQ--LAWWPWAYWIMGIACFVLAVAGYFVIPHTP 227
               G  + GG    AVFSS+ G   LA W W + I  I    + + G++V+P  P
Sbjct: 269 GQYLGILSAGGI-QSAVFSSLNGVNGLAGWRWNFIIDAIVSVAVGIIGFYVLPGDP 323

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 376 MLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 435
           ++  +  + VGTI+  +A   Q  W Q F+  I+  WG+      A +++S++ P   +G
Sbjct: 148 LMIVIVLYVVGTIIQISA---QDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRG 204

Query: 436 LAASLVNTVVNYSISIG 452
              S    +V + I +G
Sbjct: 205 TLISCYQLMVTFGIFLG 221

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 100/256 (39%), Gaps = 20/256 (7%)

Query: 83  SWFASAYSLTVGTFILIAGRLGDIFGHKK--FFVLGFFWYALWSLLAGFSVYSNQIFFDC 140
           +W  +AY +T  +F  + G   D  G +   FF  G F   +  L  GFS   N      
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAF--TIGCLACGFS--KNIYMLSF 60

Query: 141 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GFFLGAVFSSMLGQLA 199
            RA  G+G   L+  +  I+     P  ++  +F  F     G G   GA F   +    
Sbjct: 61  MRALTGIGGGGLITLS-TIVNSDVIPSSKRG-IFQAFQNLLLGFGAICGASFGGTIASSI 118

Query: 200 WWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSF-----KLLERIDFAGSVTGVVGL 254
            W W + I      + ++   + +P+    +R  SS      K+L  ID  GS+  + GL
Sbjct: 119 GWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGL 178

Query: 255 ILFNFAWNQG---PVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXX--XXXXXSSDT 309
            L     + G     + W +P    LL+     L++F   E +             SS +
Sbjct: 179 TLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYS 238

Query: 310 AFVLSC-IAAGWASFG 324
             VLS  I  G+AS+ 
Sbjct: 239 VVVLSISILVGFASYA 254

>Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON}
           (12238..13980) [1743 nt, 581 aa]
          Length = 580

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 59/147 (40%), Gaps = 9/147 (6%)

Query: 98  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGM---GPAFLLP 154
           +I   L +++G K   +L  F ++++      S     I    CR F G+    P  ++P
Sbjct: 194 IIYAPLSELYGRKGVIILSAFGFSVFQFAVAVSKDFQSIMI--CRFFGGLIGAAPMAVVP 251

Query: 155 NAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFV 214
              A +  T   G+      +LF      G  LG V  S + Q   W W  +++G     
Sbjct: 252 ACFADMFDTNMRGK----AIALFSLGVFVGPILGPVMGSYIVQHTTWRWLEYVIGCFSAA 307

Query: 215 LAVAGYFVIPHTPMPSRDASSFKLLER 241
           + VA  F +  T  PS   +  K + +
Sbjct: 308 IFVALLFFMEETHHPSILVNKAKQMRK 334

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 83/196 (42%), Gaps = 20/196 (10%)

Query: 70  IGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 129
           IG+ F      ++ W A++Y L+   F  + G+L DIFG K   +     +    ++ G 
Sbjct: 424 IGSEFN--QIPKVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGM 481

Query: 130 SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGF 185
           S   N + +   R   G+G   +  +   I      P R + +   +    FG     G 
Sbjct: 482 SNSLNMLVWG--RFVAGIGGGGIT-SMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGG 538

Query: 186 FLGAVFSSMLGQLAWWPWAYW----IMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLER 241
            +G +F   +     W   +W    + G++   L +  + V+P   + + + S  + L R
Sbjct: 539 VIGGIF---VDHQYGWRMVFWSQVPVSGLS--TLLICSFLVVPR--IKNYEVSLGRKLMR 591

Query: 242 IDFAGSVTGVVGLILF 257
           +D+ GS++ ++ L  F
Sbjct: 592 VDWLGSISMILWLTSF 607

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 58/131 (44%), Gaps = 11/131 (8%)

Query: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 140
           ++ W  + YSL     +LI GR+    G K   +     + + SL++  +   N +    
Sbjct: 97  EIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLI--G 154

Query: 141 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVFSSMLG 196
            R   G+G   +   +  ++G T     ++ M+ ++    F  ++  G FLG VF+S + 
Sbjct: 155 GRVIAGIGGCGIQSLSF-VIGSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSVT 213

Query: 197 QLAWWPWAYWI 207
               W W ++I
Sbjct: 214 ----WRWCFYI 220

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 13/132 (9%)

Query: 100 AGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIA 158
           +G L D FG +   ++G   Y + S+ LA    Y   +F  C ++  G+ P+  + + + 
Sbjct: 155 SGGLADKFGRRPVLLIGMLIYVVASIGLACAPSYGVIVFLRCVQSI-GISPSIAISSGV- 212

Query: 159 ILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQL--AWWPWA--YWIMGIACFV 214
            +G       R   V    GA++ G   LG  F S++G    A W W   +W + I C  
Sbjct: 213 -VGDFTVKSERGTFV----GATS-GFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGCGA 266

Query: 215 LAVAGYFVIPHT 226
                + ++P T
Sbjct: 267 SFAICFALLPET 278

>NCAS0A02290 Chr1 complement(429274..431079) [1806 bp, 601 aa] {ON}
           Anc_4.212
          Length = 601

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 43/96 (44%), Gaps = 10/96 (10%)

Query: 142 RAFQGMGPAF---LLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLG----AVFSSM 194
           R +Q +  AF     P +  ILG  Y P    + VF  F     GG   G     +F ++
Sbjct: 232 RGYQFILNAFGAAYYPVSQYILGCWYAPDEISSRVFLFFCGQLLGGVTSGLLQARIFENL 291

Query: 195 LGQ--LAWWPWAYWIMGIACFV-LAVAGYFVIPHTP 227
            G   LA W W + I  IA  +  A+ G+FVIP  P
Sbjct: 292 DGVNGLAGWRWMFLINAIAISIPTAIMGFFVIPGIP 327

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 80/400 (20%), Positives = 154/400 (38%), Gaps = 52/400 (13%)

Query: 84  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRA 143
           W  + YSL    F L+  RL  + G +   V     +   SL++  +   N +     R 
Sbjct: 83  WIVTGYSLPNALFSLLWARLSAVLGPRISVVSCIILFEAGSLISALANSMNMLI--AGRV 140

Query: 144 FQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVFSSMLGQLA 199
             G+G + L   ++ I G      + + +V SL    F  ++  G FLG  F++ +    
Sbjct: 141 VAGIGGSGLQTLSLVI-GCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVT--- 196

Query: 200 WWPWAYWI------MGIACFVL--AVAGYFVIPHTPMPSRDASSF--------KLLERI- 242
            W W ++I      + IA FV      G  ++       +  SSF        K+L+++ 
Sbjct: 197 -WRWCFYINLPIGGLAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVKKSPKKVLQQLL 255

Query: 243 ---DFAGSVTGVVGLILFNFAWN-QGPVVGWQTPYTYALLIVGTFFLVI--------FAY 290
              D    ++   G +LF  A    G    W +    + +I+G   + I        F  
Sbjct: 256 FGFDILSFISFTAGWLLFLLALTFGGQTHAWNSGIVISFIIIGVLLIAISLVYDFKVFEQ 315

Query: 291 IESRXXXXXXXXXXXSSDTAFVLSCIAAGWAS--FGIWIFYTWQFMEDSRGQTPLLSSAQ 348
           I+++            S+ + +LS     +++  + + + Y+ QF +   G +   +   
Sbjct: 316 IKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLH 375

Query: 349 FSPVAISGFCAAVTTGFLLS---HTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFV 405
             P+ +S    ++ +G L     H  P  V   AM     G + +    +       T +
Sbjct: 376 LIPILVSTVVFSIASGILTKKTGHIKPLLVFGSAMGVLGGGLMTL----LDNKSTKHTQI 431

Query: 406 SIIVMPWGMDMSF--PAATIMLSDSMPHEHQGLAASLVNT 443
            ++++P G+ + F  P+A I     +   +    A L+ T
Sbjct: 432 GVLILP-GVALGFVLPSALIACHVQLDKGNPSYGADLLET 470

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 82  LSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 128
           +SW A++Y L+   F  + G+L DIFG K   +     + L  L+ G
Sbjct: 189 ISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCG 235

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 100/260 (38%), Gaps = 35/260 (13%)

Query: 21  KEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQSLAP---------LHIIG 71
             DK L+E     E  +SL            A ++T   LG  LA          ++ I 
Sbjct: 23  NSDKTLTETQRCQEHNRSL----------PKAPILTSLWLGSFLASIDASIVANIMNKIA 72

Query: 72  NSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSV 131
             F  ++  Q  W A+++ LT   F  + GR  DI G K   ++   ++ L +LL  F+ 
Sbjct: 73  EEFHESDKKQ--WMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLLTCFA- 129

Query: 132 YSNQIFFDCCRAFQGMGPAFLLPN---AIAILGRTYKPGRRKNMVFSLFGASAPGGFFLG 188
             N   F   RA  GMG   +       ++ +  T + G  +     +FGA    G  LG
Sbjct: 130 -RNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGMYQGYANVIFGA----GQVLG 184

Query: 189 AVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIP----HTPMPSRDASSFKLLERIDF 244
           A    ++ +   W   +    +A  +  +  Y  I     H P P     + K L RID 
Sbjct: 185 APVGGLIMETFNWRIIFAAQVVAIMICMILAYRNINLKLLHIP-PFHQRFTRKNLSRIDL 243

Query: 245 AGSVTGVVGLILFNFAWNQG 264
            GS      L+ F   ++ G
Sbjct: 244 FGSSMLSCSLVSFLMLFSSG 263

>NDAI0D04220 Chr4 complement(987497..989347) [1851 bp, 616 aa] {ON}
           Anc_4.212
          Length = 616

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 44/99 (44%), Gaps = 9/99 (9%)

Query: 154 PNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLG----AVFSSMLGQ--LAWWPWAYWI 207
           P +  ILG  Y P    + VF  F     GG   G     +F S+ G   LA W W + I
Sbjct: 258 PVSQYILGCWYAPDELTSRVFLFFCGQLLGGVTSGLLQARIFKSLNGVNGLAGWRWMFLI 317

Query: 208 MGIA-CFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245
             IA     A+ G+FVIP   +PS+  S F   E I  A
Sbjct: 318 DAIAISLPTAILGFFVIPG--IPSKCYSLFLTDEEIRIA 354

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 78/206 (37%), Gaps = 32/206 (15%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  +   Q  W A+++ LT   F  + G+L DI G K   +    ++ L   L
Sbjct: 58  MNKVAEEFQESQEKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFALLTALSFFGLGCFL 115

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIA--ILGRTYKPGRR------KNMVF---S 175
              S    Q  F   RA    G      NAI+   +G       R       N+VF    
Sbjct: 116 TSLSTNIKQ--FAIARAI--CGIGGGGINAISSITVGDICTAKDRGIYQGYANIVFGMGQ 171

Query: 176 LFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIP----HTPMPSR 231
           L GA   GG F+  +          W   +WI      +  + G   +     H P PS 
Sbjct: 172 LLGAPV-GGLFIATI---------GWRALFWIQVPLVIIAIILGEMYVNIKLVHVPPPS- 220

Query: 232 DASSFKLLERIDFAGSVTGVVGLILF 257
           +   +K + RIDF GS T V  +  F
Sbjct: 221 ERFKWKNISRIDFLGSFTLVSSITCF 246

>KNAG0G03530 Chr7 (750723..752477) [1755 bp, 584 aa] {ON} Anc_8.858
           YML123C
          Length = 584

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 73/196 (37%), Gaps = 42/196 (21%)

Query: 79  AGQLSWFASAYSLTVGTFILI-AGRLG---------DIFGHKKFFVLGFFWYALWSLLAG 128
           AG  + +   Y+  VG  ILI AG L          DI G K   + GFF   +   + G
Sbjct: 374 AGSKNVYHKLYNSAVGNLILICAGSLPGYWASVFTIDIIGRKPIQLFGFFILTVLFCVIG 433

Query: 129 FSVYSNQI-----FFDCCRAFQGMGP---AFLLPNAIAILGRTYKPGRRKNMVFSLFGAS 180
           F+ +          +  C+ FQ  GP    F++P  +        P R ++   +  G S
Sbjct: 434 FAYHRITDHGLLGLYIVCQFFQNFGPNVTTFIIPGEVF-------PTRYRS---TAHGIS 483

Query: 181 APGGFFLGAVFSSMLGQL-------------AWWPWAYWIMGIACFVLAVAGYFVIPHTP 227
           A  G     +  + LG L              W P    I  +   +L +   F+IP T 
Sbjct: 484 AACGKIGAIIAQTALGTLINHHCARDGKKENCWLPHVMEIFALF-MLLGLCLTFLIPETK 542

Query: 228 MPSRDASSFKLLERID 243
             + +  S K  + +D
Sbjct: 543 RMTLEEISEKYHDEVD 558

>KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {ON}
           uniprot|Q701Q9 Kluyveromyces lactis KLLA0F10043g jen2
           Carboxylic acid permease
          Length = 528

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query: 98  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQG--MGPAFLLPN 155
           LI G LGD +G K  FVL      +  +  GF V S   F   CRA  G  MG  F + +
Sbjct: 132 LIFGYLGDRYGRKYSFVLTMALIIVIQIGTGF-VNSFSAFLG-CRAIFGIIMGSVFGVAS 189

Query: 156 AIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSML 195
           A A+      P + K+++  +F      G+ LG VF   +
Sbjct: 190 ATAL---ENAPNKAKSILSGIFQEGYAFGYLLGVVFQRAI 226

>SAKL0F16632g Chr6 complement(1375911..1377758) [1848 bp, 615 aa]
           {ON} similar to gnl|GLV|KLLA0F24200g Kluyveromyces
           lactis KLLA0F24200g and some similarities with
           uniprot|P53918 Saccharomyces cerevisiae YNL125C ESBP6
          Length = 615

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 64/149 (42%), Gaps = 15/149 (10%)

Query: 96  FILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFD---CCRAFQGMGPAFL 152
           F+L+  R   IFG K   +LG  +  L  +LA ++    Q++      C    GMG AF+
Sbjct: 201 FVLLFSR---IFGFKVPMLLGTVFLFLGHMLASYAAKLWQLYLTQGLLC----GMGIAFV 253

Query: 153 LPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIAC 212
              A  +L   +   R   +  SL G  A GG       + ++ +     WA   + IAC
Sbjct: 254 FAPATVVLPGWFLRKRSFAVGLSLVGTGA-GGVTYSLAVNQIIQRTGDPRWALRTLAIAC 312

Query: 213 FVLAVAGYFVI----PHTPMPSRDASSFK 237
            V  +    VI    P TP+  + A++ K
Sbjct: 313 SVTCLVAIAVIRQRVPATPIGIKSAAALK 341

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 18/190 (9%)

Query: 70  IGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 129
           +   F  ++  Q  W A++Y LT   F  + G+L D+ G K   +   F++ L  LL  F
Sbjct: 64  VAEEFQESDKKQ--WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCF 121

Query: 130 SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFS-----LFGASAPGG 184
           +    Q  F   RA  G+G   +  NA++ +  +    +R+  ++      +FG     G
Sbjct: 122 ANSVTQ--FAIARAICGVGGGGI--NAMSSITVSDICTQRERGIYQGYANIVFGLGQILG 177

Query: 185 FFLGAVFSSMLGQLAWWPWAYWIMG---IACFVLAVAGYFVIPHTPMPSRDASSFKLLER 241
             +G +F   LG    W   + +     + C  L      +     +P  +   +  L R
Sbjct: 178 APIGGLFIDTLG----WRILFGLQVPTILLCSSLVHKNVNIKLSHLLPVEERFKWSNLSR 233

Query: 242 IDFAGSVTGV 251
           ID  GS T V
Sbjct: 234 IDILGSSTLV 243

>KLLA0D11330g Chr4 (970243..971808) [1566 bp, 521 aa] {ON} similar
           to uniprot|P15365 Saccharomyces cerevisiae YJR152W DAL5
           Allantoin permease ureidosuccinate permease expression
           is constitutive but sensitive to nitrogen catabolite
           repression
          Length = 521

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 8/113 (7%)

Query: 138 FDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQ 197
           F   R   G+  AF+ P  + ++ + YK       +  L+G +  G   L  +   +   
Sbjct: 166 FTLLRTLLGVLEAFVSPIFVIMMNQYYKKSEHFGYIGVLYGCNGLGTVILACISYGLYHN 225

Query: 198 LAWWPW-AYWIMGIACFVLAVAG----YFVIPHTPMPSR---DASSFKLLERI 242
           L  +   AY ++ I    L +       F++P+TP  +R   D     +LERI
Sbjct: 226 LGSYTMEAYKVLFIIVGCLTIFNGLLILFIMPNTPADARFLNDREKLAVLERI 278

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 70  IGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHK 110
           IG+ F      ++SW A+AY L+  TF  + G++ DIFG K
Sbjct: 122 IGSEFN--ELPRISWIATAYLLSSATFQPLYGKISDIFGRK 160

>SAKL0C04708g Chr3 (455246..456799) [1554 bp, 517 aa] {ON} similar
           to uniprot|P25621 Saccharomyces cerevisiae YCR028C FEN2
           Plasma membrane H -pantothenate symporter confers
           sensitivity to the antifungal agent fenpropimorph
          Length = 517

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 9/113 (7%)

Query: 123 WSLLAGFSVYSNQIFFDCC--RAFQGMGPAFLLPNAIAILGRTYKPGRR--KNMVFSLFG 178
           W +L   S+Y    F  CC  R FQ +  +        ILG  Y+      ++ +F+  G
Sbjct: 126 WGVLT-LSMYRVSSFNQCCAIRFFQALFESCTFSGTHLILGSWYREDELSVRSAIFTSSG 184

Query: 179 --ASAPGGFFLGAVFSSMLGQ--LAWWPWAYWIMGIACFVLAVAGYFVIPHTP 227
              S   GF   ++ SS+ G+  LA W W + I  +    +AV G+   P TP
Sbjct: 185 LVGSLFSGFMQVSIHSSLDGRRGLAGWRWLFIIDFLITLPIAVYGFVCFPDTP 237

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 82/198 (41%), Gaps = 28/198 (14%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           ++ +   F  ++  Q  W A+++ LT   F  + G+L DI G K   ++   ++ L  LL
Sbjct: 75  MNRVAEEFQESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLL 132

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR------KNMVFS---LF 177
             F+   N   F   RA  G+G   +   +   +        R       N+VFS   L 
Sbjct: 133 TCFA--RNVTEFSIARAICGIGGGGISAMSSITVSDICTARERGAYQGYANVVFSTGQLL 190

Query: 178 GASAPGGFFLGAVFSSMLGQLAWWPWAYWI---MGIACFVLAVAGYFV-IPHTPMPSRDA 233
           GA   GGF L  +          W   + +   M + C VL      + + H P P  + 
Sbjct: 191 GAPL-GGFALDRI---------GWRAIFGLQVPMLLICMVLGYRNVNIKLAHVP-PLEER 239

Query: 234 SSFKLLERIDFAGSVTGV 251
            ++K L RID  GS+T V
Sbjct: 240 FTWKNLSRIDIGGSITLV 257

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 95/231 (41%), Gaps = 34/231 (14%)

Query: 78  NAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIF 137
            A  ++W A+AY LT      + G++ DI G +K  + G   +AL  LL  F+   N I 
Sbjct: 93  QASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVLLCNFA---NTI- 148

Query: 138 FDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-----GFFLGAVFS 192
                      P   +  AI  +G +        M+  +   S        G  L ++F 
Sbjct: 149 -----------PQLAIARAICGIGGSGNSAMGNIMLNDILPLSVRATYWSYGAILASIFQ 197

Query: 193 SMLGQLAWWPWAYWIMGIACFVLAVA---GYFVIPHTPMPSRDASSFKLLERIDFAGSVT 249
           S+ G +      ++ +G   F   +    G   + +  +      +    +RIDF GS+ 
Sbjct: 198 SLGGPIGGLLLKWFGVG-GLFTPQIPFCIGSIYLSYKYIHDYKEHARSSWKRIDFGGSIC 256

Query: 250 GVVGLILFNFAWNQGPVV-----GWQTP--YTYALLIVGTFFLVIFAYIES 293
            +VG+  F F ++          GW TP  ++  LLIV    ++ FA+IE+
Sbjct: 257 LLVGISSFIFFFSASDNTTIEDDGWSTPKKWSVVLLIVS---IIAFAFIEN 304

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 69/172 (40%), Gaps = 14/172 (8%)

Query: 65  APLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWS 124
           A + +I   F   +  +  W  S YSL      L+ GR   IFG K   +L    +   S
Sbjct: 63  ASIEVISEQF--NDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGS 120

Query: 125 LLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGAS 180
           L++  S   N +     R   G+G +  + +   ++  T    R + +  S+    +  +
Sbjct: 121 LISAVSNSMNVLIGG--RVVAGIGGSG-IQSLCFVIASTLTTERSRGVAISVLSCAYAVA 177

Query: 181 APGGFFLGAVFSSMLGQLAWWPWAYWI-MGIACFVLAVAGYFVIPHTPMPSR 231
           A  G F+G  F++ +     W W ++I + I     AV      PH    +R
Sbjct: 178 AVAGPFMGGAFTTHV----TWRWCFYINLPIGSLAFAVLVLTYKPHEGNSAR 225

>Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 187] FULL
          Length = 567

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 13/112 (11%)

Query: 376 MLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 435
           ++F +  + VGTI+  +A      W Q F+  I+  WG+      A +++S + P   +G
Sbjct: 145 LMFVVGVYVVGTIIQISA---SDKWYQYFIGKIIYGWGVGGVSVLAPMLISLTAPKHVRG 201

Query: 436 LAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGL 487
              S    +V + I +G  +     +R  DG  +        W + +GLS L
Sbjct: 202 TLISCYQLMVTFGIFLGYCVV--YATRKYDGSEQ--------WRIPLGLSFL 243

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 56/131 (42%), Gaps = 9/131 (6%)

Query: 80  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFD 139
           G + W  + Y+L+   F+L+ GRL +I G  +  ++    + + SL++  S     +   
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGG 102

Query: 140 CCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL---FGASAPGGFFLGAVFSSMLG 196
             R   G G + +   A  +     +   R  M+ +L   +  +   G F+G  F+  L 
Sbjct: 103 --RVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVIAEGVGPFIGGAFNEHLS 160

Query: 197 QLAWWPWAYWI 207
               W W ++I
Sbjct: 161 ----WRWCFYI 167

>Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR260W
           (TNA1) - 1:1 [contig 261] FULL
          Length = 508

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 95/238 (39%), Gaps = 25/238 (10%)

Query: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLL--WESAFVGVLCSAQLMTQAG 59
           S+S+    +N      A  +E    S+  I  +  K+L+   +  FV VL  A  +    
Sbjct: 24  SSSAISIVENQACAESAFSEEQTASSDLYIDPDEEKALMRKLDRRFVPVLAFAYFL---- 79

Query: 60  LGQSLAPLHIIGNSF--GTTNAGQLS--WFASAYSLTVGTFILI---AGRLGDIFGHKKF 112
             QSL   +I GN++  G     QL+   +++A S+   TF++          I   + F
Sbjct: 80  --QSLDKTNI-GNAYTSGMKEDLQLTPHQYSNAVSVLYSTFLVAQVPTVLYLKIIPSRYF 136

Query: 113 FVLGFFWYALWSLLAGF-SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKN 171
                F +++ +L  GF   Y + I     R   G       P  I ++   YKP  +  
Sbjct: 137 LSAMVFCWSVITLGNGFIQSYHSLI---ALRVLLGAFEGGYFPAMILLVSMIYKPEEQAK 193

Query: 172 MVFSLFGASAPGGFFLGAVFSSM-----LGQLAWWPWAYWIMGIACFVLAVAGYFVIP 224
            +   FG +A  G F G + + +        L  W W Y I G+     ++  YF +P
Sbjct: 194 RIALFFGCAALAGAFGGLIATGLATVNGASGLNGWRWLYIIEGLISITASIWIYFGLP 251

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 183 GGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHT 226
           GG  +G +F  ++ +   W W +WI  I   V  V  +F++P T
Sbjct: 251 GGTVIGPIFGGLMEEHLSWHWNFWIQLIFNGVTQVLHFFIVPET 294

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 60/149 (40%), Gaps = 13/149 (8%)

Query: 98  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIF--FDCCR---AFQGMGPAFL 152
           +I   L +++G K   V+    +AL+     F+V + + F     CR    F G  P  +
Sbjct: 247 IIYAPLSELYGRKGVLVVSGLGFALFQ----FAVATAENFQTIMICRFFAGFIGAAPMAI 302

Query: 153 LPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIAC 212
           +P   A +  T   G+       LF      G  LG V  S + Q   W W  +++G   
Sbjct: 303 VPAVFADMFDTDFRGK----AICLFTLGVFVGPILGPVMGSYIVQHTTWRWLNYVVGFQA 358

Query: 213 FVLAVAGYFVIPHTPMPSRDASSFKLLER 241
             + VA    +  T  P+   +  KLL +
Sbjct: 359 CAVFVAIVLFVEETHHPTILVNKAKLLRK 387

>SAKL0F16478g Chr6 (1357813..1359300) [1488 bp, 495 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260w TNA1
          Length = 495

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 72/185 (38%), Gaps = 22/185 (11%)

Query: 70  IGNSFGTTNAGQLSWFASAYSLTVGTF--ILIAGRLGDIF----GHKKFFVLGF-FWYAL 122
           IGN++ +     L+  +  YS  V  F    +A  L  +        ++++    F +A+
Sbjct: 74  IGNAYTSGMKEDLNLTSRQYSNAVSVFYSTYLAAELPAVLVLRRARPRYYMSALVFCWAV 133

Query: 123 WSLLAGF-SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASA 181
            +L  GF   YS+ +     R   G       P    I+  TYK   +   +   FG+SA
Sbjct: 134 ITLCGGFVRSYSSLL---ATRVLLGTFEGGFFPAMTLIITMTYKKEEQARRIAFFFGSSA 190

Query: 182 PGGFFLGAVFSSM-----LGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSF 236
             G F G + + +      G L  W W Y I G+      V  +F +P       D ++ 
Sbjct: 191 LSGAFGGLIATGLASVKKTGGLEGWRWLYIIEGLISICACVWLFFGLPD------DVNNM 244

Query: 237 KLLER 241
           K L  
Sbjct: 245 KFLNE 249

>TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON} 
          Length = 493

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 74/185 (40%), Gaps = 39/185 (21%)

Query: 7   VTQKNLDTNAEALKK----EDKVLSEFDIQDER---PKS-----LLWESAFVGVLCSAQL 54
           + +  L+   + + K    +DK  + F  ++E+   P+      L   ++F+G++ S   
Sbjct: 37  IHKNQLEDKHDIIDKVSTIKDKTDTLFICKEEKNSFPEGGLRGWLAVFASFIGMVASYGT 96

Query: 55  MTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFV 114
           M   G+ ++    +I  N    T++ ++ W  S Y        ++ G L D FG KK  +
Sbjct: 97  MYAPGVIEN----YIKENQLNDTSSFEIGWIFSLYIFICFITFILGGTLFDNFGFKKPIL 152

Query: 115 LGFFWYA-----------LWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRT 163
           +G   +            LW  + G+S+              G G   L+P  I+I  + 
Sbjct: 153 IGTIIHVGSLFSLANCRELWQFILGYSI------------LGGFGNGILIPCLISIPSQY 200

Query: 164 YKPGR 168
           +   R
Sbjct: 201 FNRKR 205

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 51/124 (41%), Gaps = 10/124 (8%)

Query: 103 LGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGM---GPAFLLPNAIAI 159
           L +I+G K   V+  F +AL+      +     I    CR F G+    P  ++P   A 
Sbjct: 251 LSEIYGRKLILVISGFGFALFQFAVATAENLQTIMI--CRFFSGLIGGAPMAVVPAVFAD 308

Query: 160 LGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMG-IACFVLAVA 218
           +  T   G+       LF A    G  LG +  S + Q   W W  +++G +A  V  + 
Sbjct: 309 MFDTNFRGK----AICLFSAFVFIGPILGPIMGSYIVQHTSWRWLNYVVGCLASLVFVLL 364

Query: 219 GYFV 222
             FV
Sbjct: 365 CVFV 368

>TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON}
           Anc_8.858 YML123C
          Length = 598

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 79/211 (37%), Gaps = 51/211 (24%)

Query: 89  YSLTVGTFILI-AGRLG---------DIFGHKKFFVLGFFWYALWSLLAGFSVYS---NQ 135
           Y+  VG  ILI AG L          DI G K     GFF   +   + GF+ +    N 
Sbjct: 396 YNSAVGNLILICAGSLPGYWASVFTIDIIGRKPIQTFGFFILTVLFCVIGFAYHRLTPNS 455

Query: 136 I--FFDCCRAFQGMGP---AFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAV 190
           +   +  C+ FQ  GP    F++P  I        P R ++   +  G SA  G     +
Sbjct: 456 LLGLYIVCQFFQNFGPNTTTFIIPGEIF-------PTRYRS---TAHGISAASGKVGAII 505

Query: 191 FSSMLGQL-------------AWWPWAYWIMGIACFVLAVAGY-FVIPHTPMPSRDASSF 236
             ++LG L              W P    I   A F+L   G  F+IP T   + +  S 
Sbjct: 506 AQTVLGTLINHNCARDGKPTNCWLPHVMEIF--ALFMLCGLGLSFLIPETKRMTLEEISE 563

Query: 237 KLLERIDFAGSVTGVVGLILFNFAWNQGPVV 267
           K    +D       +  L   N  +N+  V+
Sbjct: 564 KYHGEVD-------LTKLAERNLNYNKNSVI 587

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 86/220 (39%), Gaps = 31/220 (14%)

Query: 40  LWESAFVGVLCS---AQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTF 96
           LW  +F+G L S   A +M +            +   F  ++  Q  W  +++ LT   F
Sbjct: 46  LWMGSFLGSLDSTIVANIMNK------------VAEEFEESDKKQ--WIVTSFLLTNTAF 91

Query: 97  ILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNA 156
             + G+L D+ G K   ++   ++ +  L    S   N + F   RA  GMG   +   +
Sbjct: 92  QPLYGKLSDLAGRKTALMVAHSFFLVGCLFTALS--RNLVEFSIARAVCGMGAGGISALS 149

Query: 157 IAILGRTYKPGRR------KNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGI 210
              +     P  R       N+VF     S  GG   G +  S   ++ +      IM  
Sbjct: 150 SISVSDICTPKERGVYQGYANVVFG--TGSMLGGPIGGWLMDSFGWKVIFAGQVPLIM-- 205

Query: 211 ACFVLAVAGYFV-IPHTPMPSRDASSFKLLERIDFAGSVT 249
            C  L      + + H P P  +   ++ ++RID  GS++
Sbjct: 206 TCMFLGYRNVNIKLLHVP-PRHERYRWENIKRIDLGGSIS 244

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 78/372 (20%), Positives = 141/372 (37%), Gaps = 23/372 (6%)

Query: 83  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCR 142
           +W  +AY +T  +F  + G   D  G +         + +  L  GFS  SN       R
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFS--SNIYMLSFMR 62

Query: 143 AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPG-GFFLGAVFSSMLGQLAWW 201
           A  G+G   L+  +  +        +R   +F  F     G G   GA F   +     W
Sbjct: 63  ALTGIGGGGLITLSTIVNSDVIPTSKRG--IFQAFQNLLLGFGAICGASFGGTIASTIGW 120

Query: 202 PWAYWI-MGIACFVLAVAGYFVIPHTPMPSRDASSF----KLLERIDFAGSVTGVVGLIL 256
            W + I + I+     +  Y+V        ++++ F    K+L  ID  GS+  + GL L
Sbjct: 121 RWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGLTL 180

Query: 257 FNFAWNQG---PVVGWQTPYTYALLIVGTFFLVIFAYIESRXXXXXXX-XXXXSSDTAFV 312
                + G     + W +P    LL      L++F   E +            SS  +FV
Sbjct: 181 QLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSFV 240

Query: 313 LSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLS-H 369
           +  I+   G+AS+  ++F    F +   G +   +  + +  ++     ++ TGF +S +
Sbjct: 241 VLSISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFSMSKY 299

Query: 370 TPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMP--WGMDMSFPAATIMLSD 427
               +++   ++   +G  L          W    +S+ ++P   G  ++FP        
Sbjct: 300 NCLRSLLYLGISLMFLGNFLFLFIEETSPNW---LISLFLIPANLGQGITFPTTLFTFIF 356

Query: 428 SMPHEHQGLAAS 439
             P   Q  A S
Sbjct: 357 MFPKSDQATATS 368

>KAFR0G00300 Chr7 (96299..97744) [1446 bp, 481 aa] {ON} Anc_1.155
           YCR028C
          Length = 481

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 53/123 (43%), Gaps = 11/123 (8%)

Query: 123 WSLLAGFSVYSNQIFFDCC--RAFQGMGPAFLLPNAIAILGRTYKPGRR--KNMVFSLFG 178
           W LL    +Y    +  CC  R FQG+  +     A  ILG  YK      ++ +F+  G
Sbjct: 108 WGLLT-LGLYGVSSYQHCCAIRFFQGIFESCTFSGAHLILGLWYKENELAIRSAIFTSSG 166

Query: 179 --ASAPGGFFLGAVFSSMLGQ--LAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDAS 234
              S   GF   ++F  + G   LA W W + I    C  + +A Y +I    +P  D+S
Sbjct: 167 LIGSMFSGFMQTSIFEHLDGHHNLAGWRWLFIID--FCITVPIALYGLIFFPGIPEHDSS 224

Query: 235 SFK 237
             K
Sbjct: 225 YSK 227

>SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} similar
           to gnl|GLV|KLLA0D12606g Kluyveromyces lactis
           KLLA0D12606g and weakly similar to YNR055C
           uniprot|P53389 Saccharomyces cerevisiae YNR055C HOL1
           Putative ion transporter similar to the major
           facilitator superfamily of transporters; mutations in
           membrane- spanning domains permit nonselective cation
           uptake
          Length = 579

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 40/90 (44%), Gaps = 9/90 (10%)

Query: 168 RRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYW---IMGIACFVLAVAGYFVIP 224
             +++  SL+G +     +L  V +  + Q   W W  W   I G  CFVL    +F++ 
Sbjct: 171 HERSLGLSLYGLTLLAASYLAPVLAGFISQGQGWEWVMWWCSIFGAVCFVLL---FFLME 227

Query: 225 HTPMPSR---DASSFKLLERIDFAGSVTGV 251
            T    +   D+++ K +      G V+G+
Sbjct: 228 ETNYERKVKIDSTTNKPITMDSHQGVVSGI 257

>Smik_6.148 Chr6 complement(243915..245723) [1809 bp, 602 aa] {ON}
           YGR065C (REAL)
          Length = 602

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 49/114 (42%), Gaps = 12/114 (10%)

Query: 142 RAFQGMGPAF---LLPNAIAILGRTYKPGRRKNMVFSLFGA----SAPGGFFLGAVFSSM 194
           RA++ +  AF     P +  ILG  Y P    + V   F      S   G     +F S+
Sbjct: 231 RAYRFILSAFGAAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRIFKSL 290

Query: 195 LGQ--LAWWPWAYWIMGIA-CFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245
            G   LA W W + I  IA     A+ G+FVIP   +PS+  S F   E I  A
Sbjct: 291 NGVHGLAGWRWMFLIDAIAISLPTAIIGFFVIPG--VPSKCYSLFLTDEEIRIA 342

>KLTH0C00330g Chr3 (25162..26811) [1650 bp, 549 aa] {ON} similar to
           uniprot|Q12235 Saccharomyces cerevisiae YLL055W
           Hypothetical ORF
          Length = 549

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 50/241 (20%), Positives = 99/241 (41%), Gaps = 31/241 (12%)

Query: 7   VTQKNLDTNAEALKKEDKVLSEFDIQDERP--KSLLW----ESAFVGVLCSAQ--LMTQA 58
           +T ++ D     L++ D ++     ++ER   + ++W     +A + ++  A   +M+ A
Sbjct: 53  ITSRDADVTLRFLEENDHLVEPITPEEERKLSRKVMWIVVSLTALINLILYADKAVMSYA 112

Query: 59  GLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFV--LG 116
            +        +  N +   NA  L +F             I G+ G++F  +KF +  + 
Sbjct: 113 AIFTFFEDTGLTQNKYN--NANTLFYFG-----------YIVGQ-GNLFFLQKFPLSRVM 158

Query: 117 FFWYALWSLLAGF--SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNM-- 172
           F   ALWS++     + Y+ Q  +   R F G   +  +P+    +G+   P  +     
Sbjct: 159 FVMTALWSIIIFLHCTAYNYQGVY-ALRFFLGFVESIGVPSLNTTMGQFLTPQEKSATAP 217

Query: 173 VF--SLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPS 230
           VF  +  G + P GF    V +     +  W     I+G   F+ +V  + V P  P  +
Sbjct: 218 VFYAACMGVTIPVGFIAYGVLNITNSSIPTWKIFSIIIGCCTFLSSVLIFLVYPSNPTDA 277

Query: 231 R 231
           +
Sbjct: 278 K 278

>KNAG0D04170 Chr4 complement(750800..752599) [1800 bp, 599 aa] {ON}
           Anc_4.212 YGR065C
          Length = 599

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 44/99 (44%), Gaps = 9/99 (9%)

Query: 154 PNAIAILGRTYKPGRRKNMVFSLFGASAPGG----FFLGAVFSSMLGQ--LAWWPWAYWI 207
           P +  I+G  Y P    + V   F  +  GG       G +F S+ G   LA W W + I
Sbjct: 244 PVSQYIMGCWYAPDEISSRVCLFFCGNLLGGVTSGLLQGRIFKSLDGVHGLAGWRWMFLI 303

Query: 208 MGIA-CFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245
             IA     A+ G+FVIP   +PS+  S F   E I  A
Sbjct: 304 DAIAISLPTAILGFFVIPG--IPSKCYSLFLTDEEIRIA 340

>Suva_7.346 Chr7 complement(593271..595052) [1782 bp, 593 aa] {ON}
           YGR065C (REAL)
          Length = 593

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 50/114 (43%), Gaps = 12/114 (10%)

Query: 142 RAFQGMGPAF---LLPNAIAILGRTYKPGRRKNMVFSLFGA----SAPGGFFLGAVFSSM 194
           RA++ +  AF     P +  ILG  Y P    + V   F      S   G     +F S+
Sbjct: 221 RAYRFILSAFGAAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRIFKSL 280

Query: 195 LGQ--LAWWPWAYWIMGIACFV-LAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245
            G   LA W W + I  IA  +  A+ G+FVIP   +PS+  S F   E I  A
Sbjct: 281 NGVHGLAGWRWMFLIDAIAISLPTAIIGFFVIP--GVPSKCYSLFLTDEEIRIA 332

>TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.451
           YCR023C
          Length = 572

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 53/127 (41%), Gaps = 19/127 (14%)

Query: 78  NAGQLSWFASAYSLTVGTFILIA----GRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS 133
           N  Q+S ++   S T      +A    GR  D +G K   +LG     +  L+ GFS + 
Sbjct: 56  NEAQVSRYSGYLSATFSLCKFLAAYHWGRFSDEYGRKLTVILGMLGTCISLLILGFSKH- 114

Query: 134 NQIFFDCCRAFQGMGPAFLLPNAIA----ILGRTYKPGRRKNMVFSLFGASAPGGFFLGA 189
              F+    A   MG   LL   IA    I+G     GR + + FS    + P  F  G 
Sbjct: 115 ---FYQAMIARSMMG---LLNGNIAVIRTIVGELTTEGRHQAIAFS----TIPLLFQFGT 164

Query: 190 VFSSMLG 196
           V  S++G
Sbjct: 165 VIGSIIG 171

>YGR065C Chr7 complement(618077..619858) [1782 bp, 593 aa] {ON}
           VHT1High-affinity plasma membrane H+-biotin (vitamin H)
           symporter; mutation results in fatty acid auxotrophy; 12
           transmembrane domain containing major facilitator
           subfamily member; mRNA levels negatively regulated by
           iron deprivation and biotin
          Length = 593

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 49/114 (42%), Gaps = 12/114 (10%)

Query: 142 RAFQGMGPAF---LLPNAIAILGRTYKPGRRKNMVFSLFGA----SAPGGFFLGAVFSSM 194
           RA++ +  AF     P +  ILG  Y P    + V   F      S   G     +F S+
Sbjct: 221 RAYRFILSAFGAAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRIFKSL 280

Query: 195 LGQ--LAWWPWAYWIMGIA-CFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245
            G   LA W W + I  IA     A+ G+FVIP   +PS+  S F   E I  A
Sbjct: 281 NGVHGLAGWRWMFLIDAIAISLPTAIIGFFVIPG--VPSKCYSLFLTDEEIRIA 332

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 183 GGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHT 226
           GG  LG VF  ++ +   W W +WI  I   V  +  +F++P T
Sbjct: 193 GGSVLGPVFGGLMQEHLSWHWNFWIQLIFNGVSQILHFFLVPET 236

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 60/140 (42%), Gaps = 15/140 (10%)

Query: 376 MLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 435
           ++F  + F VG ++I  A V +  W Q F+  I+   GM +    + +++S+  P E +G
Sbjct: 154 LIFGTSIFVVG-VIIQIASVSK--WFQYFIGRIIAGIGMGVIAVLSPMLISEVAPKELRG 210

Query: 436 LAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATY 495
              S    ++ + I +G            + G K  +  +  W + +GL  L   +  + 
Sbjct: 211 AMVSCYQLMITFGIFLG---------NCCNYGTKSYQNSK-QWRIAVGLQFLWCIIMVSG 260

Query: 496 AWSTFMKSKKRISEKQHFIE 515
              TF+    R   +Q+  E
Sbjct: 261 M--TFVPESPRYLVQQNMFE 278

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 63/154 (40%), Gaps = 13/154 (8%)

Query: 78  NAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNQI 136
           N  Q++     Y L  G     +G L D +G +   + G   Y + S+ LA    Y   +
Sbjct: 147 NESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASIGLARAPSYGVIV 206

Query: 137 FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLG 196
           F    ++  G+ P   + + +      Y   R +    +  GA++ G   +G     +LG
Sbjct: 207 FLRIVQSI-GISPTIAISSGVV---SDYTLKRERG---TFVGATS-GFVLIGQGIGPLLG 258

Query: 197 QL--AWWPWA--YWIMGIACFVLAVAGYFVIPHT 226
            +  A W W   +W + I C    +  +F++P T
Sbjct: 259 AVIAARWDWRAIFWFLVIGCGTSMLIAFFLLPET 292

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 77/207 (37%), Gaps = 22/207 (10%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           + ++   FG  N  +  W  + YSL      L+ GR   I G +   +L    +   SL+
Sbjct: 69  IDVVAKQFG--NYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSLV 126

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAP 182
           A  +   N +                L     ++G T    R + +V S+    F  +A 
Sbjct: 127 AALANSMNMLI---VGRVVAGVGGSGLQTLCFVIGCTMVDERSRPLVISILSCAFAVAAI 183

Query: 183 GGFFLGAVFSSMLGQLAWWPWAYWI------MGIACFVLA--VAGYFVIPHTPMPSRDAS 234
            G  +G  F++ +     W W ++I      + +  F+L        +I       R  S
Sbjct: 184 VGPIIGGAFTTHV----TWRWCFYINLPIGGLAVIMFLLTYDAKNDGIIQQMKGALRKIS 239

Query: 235 SFKLLERIDFAGSVTGVVGLILFNFAW 261
            F+   R+   G++   +  ++F F +
Sbjct: 240 GFE-FSRLKKPGNLRKAINCLIFKFDF 265

>TBLA0I02690 Chr9 complement(626113..628176) [2064 bp, 687 aa] {ON}
           Anc_4.212 YGR065C
          Length = 687

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 51/114 (44%), Gaps = 12/114 (10%)

Query: 142 RAFQGMGPAF---LLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLG----AVFSSM 194
           RA++ +  AF     P +  +LG  Y P    + V   F     GG   G     +F S+
Sbjct: 310 RAYRFILNAFGAAYYPVSQYLLGCWYAPDEITSRVCLFFFGQLLGGVTSGLLQARIFESL 369

Query: 195 LGQ--LAWWPWAYWIMGIA-CFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245
            G+  LA W W + I  IA     AV G+FVIP   +PS+  S F   E I  A
Sbjct: 370 NGKCGLAGWRWMFLIDAIAISLPTAVLGFFVIPG--IPSKCYSLFLTDEEIRVA 421

>Kwal_33.14054 s33 complement(501910..503163) [1254 bp, 417 aa] {ON}
           YKR051W - Hypothetical ORF [contig 105] FULL
          Length = 417

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 12/84 (14%)

Query: 60  LGQSLAPLHIIG-NSFGTTNAG--QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 116
           LG  L+P+ +   N + +   G  Q  WF   Y L        A  +G  +G   +F  G
Sbjct: 119 LGSILSPVDMSDPNDYLSIKRGILQYVWFKPFYCL--------ATTIGREYGWDHYF-WG 169

Query: 117 FFWYALWSLLAGFSVYSNQIFFDC 140
           FFW  L+++ A  S+Y+  +F+ C
Sbjct: 170 FFWALLYNISATLSLYNLALFWKC 193

>Skud_7.362 Chr7 complement(605192..606970) [1779 bp, 592 aa] {ON}
           YGR065C (REAL)
          Length = 592

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 50/114 (43%), Gaps = 12/114 (10%)

Query: 142 RAFQGMGPAF---LLPNAIAILGRTYKPGRRKNMVFSLFGA----SAPGGFFLGAVFSSM 194
           RA++ +  AF     P +  ILG  Y P    + V   F      S   G     +F S+
Sbjct: 221 RAYRFILSAFGAAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRIFKSL 280

Query: 195 LGQ--LAWWPWAYWIMGIACFV-LAVAGYFVIPHTPMPSRDASSFKLLERIDFA 245
            G   LA W W + I  +A  +  A+ G+FVIP   +PS+  S F   E I  A
Sbjct: 281 NGVHGLAGWRWMFLIDAVAISLPTAIIGFFVIPG--VPSKCYSLFLTDEEIRIA 332

>KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {ON}
           weakly similar to uniprot|P53322 Saccharomyces
           cerevisiae YGR260W TNA1 High affinity nicotinic acid
           plasma membrane permease
          Length = 503

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 107/273 (39%), Gaps = 33/273 (12%)

Query: 1   MSTSSSVTQKN-----LDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLM 55
           M T+ SV  K+     +  +AE L +E   L+E  I++E       ESA    L   +L+
Sbjct: 11  METTHSVATKDPIKVSIHDDAE-LSEE---LAEHVIEEEYYIDPQDESALTRKL-DTRLL 65

Query: 56  TQAGLGQSLAPLHI--IGNSFGTTNAGQLSWFASAYSLTVGTFI-------LIAGRLGDI 106
                   L+ L    IGN++ +     L   +  YS  V  F        L A  L  I
Sbjct: 66  PMLAFMYFLSALDRSNIGNAYTSGMKEDLRLTSHQYSNAVSVFYSTYLAAELPAVWLLKI 125

Query: 107 FGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKP 166
              + +  +  F +++ +L +GF    + +     R   G       P    ++   YKP
Sbjct: 126 AKPRYYMSILVFCWSVITLSSGFVKSYHSLL--ATRILLGTFEGGFFPAMTLLITMMYKP 183

Query: 167 GRRKNMVFSLFGASAPGGFFLGAVFSSM-----LGQLAWWPWAYWIMGIACFVLAVAGYF 221
             +   +   FG+SA  G F G + + +      G L  W W Y I G+     +   +F
Sbjct: 184 KEQAKRIAFFFGSSALSGAFGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFF 243

Query: 222 VIPHTP-----MPSRDASSFKLLE--RIDFAGS 247
            +P        +  R+ S  ++ E  RI + G+
Sbjct: 244 GLPDNLDKMKFLNERELSLMQIREKQRIQYMGA 276

>KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 503

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 107/273 (39%), Gaps = 33/273 (12%)

Query: 1   MSTSSSVTQKN-----LDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLM 55
           M T+ SV  K+     +  +AE L +E   L+E  I++E       ESA    L   +L+
Sbjct: 11  METTHSVATKDPIKVSIHDDAE-LSEE---LAEHVIEEEYYIDPQDESALTRKL-DTRLL 65

Query: 56  TQAGLGQSLAPLHI--IGNSFGTTNAGQLSWFASAYSLTVGTFI-------LIAGRLGDI 106
                   L+ L    IGN++ +     L   +  YS  V  F        L A  L  I
Sbjct: 66  PMLAFMYFLSALDRSNIGNAYTSGMKEDLRLTSHQYSNAVSVFYSTYLAAELPAVWLLKI 125

Query: 107 FGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKP 166
              + +  +  F +++ +L +GF    + +     R   G       P    ++   YKP
Sbjct: 126 AKPRYYMSILVFCWSVITLSSGFVKSYHSLL--ATRILLGTFEGGFFPAMTLLITMMYKP 183

Query: 167 GRRKNMVFSLFGASAPGGFFLGAVFSSM-----LGQLAWWPWAYWIMGIACFVLAVAGYF 221
             +   +   FG+SA  G F G + + +      G L  W W Y I G+     +   +F
Sbjct: 184 KEQAKRIAFFFGSSALSGAFGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFF 243

Query: 222 VIPHTP-----MPSRDASSFKLLE--RIDFAGS 247
            +P        +  R+ S  ++ E  RI + G+
Sbjct: 244 GLPDNLDKMKFLNERELSLMQIREKQRIQYMGA 276

>Smik_1.1 Chr1 complement(4254..6038) [1785 bp, 594 aa] {ON} YAL067C
           (REAL)
          Length = 594

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 52/116 (44%), Gaps = 15/116 (12%)

Query: 123 WSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIA---ILGRTYKPGR--RKNMVFSL 176
           WSLL   + Y N +      R F G   AF  P+ +A   + G  YK     R++  + L
Sbjct: 215 WSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYL 271

Query: 177 ---FGASAPGGFFLGAVFSSMLGQ--LAWWPWAYWIMGIACFVLAVAGYFVIPHTP 227
               G  + GG    AV+SS+ G   L  W W + I  I   V+ + G++ +P  P
Sbjct: 272 GQYIGILSAGGI-QSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYALPGDP 326

>NDAI0F03880 Chr6 complement(919772..921058) [1287 bp, 428 aa] {ON}
           Anc_2.7 YNL237W
          Length = 428

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 350 SPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIV 409
           +PVA+ GFC    TG  L+H    T  ++    ++   ++       +T ++Q  +   V
Sbjct: 152 APVAMFGFCRDNHTGQCLAHGIMGTAFVWYGFVYSFALVIPRITKSQETSYSQDHIDSWV 211

Query: 410 MP-WGMDMSFPAATIMLSDSMPHEHQGLAASLV 441
           M  WG+  +F        D   H++Q  A  ++
Sbjct: 212 MCIWGIVNTFTEHRWGREDWFTHDYQHTAMGII 244

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 237 KLLERIDFAGSV--TGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR 294
            +  +ID  G+V  T  +GLIL       G    W  P   A L++G   L++F + E++
Sbjct: 272 DIFNQIDIVGTVLVTAALGLILVPLTLAGGVSERWHEPGIIATLVIGIALLLVFLFWEAK 331

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 11/141 (7%)

Query: 70  IGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 129
           +   FG+ +  ++ W  + YSL      LI GR+    G K+  +     + + SL++  
Sbjct: 103 VAKQFGSYS--EIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLISAL 160

Query: 130 SVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL---FGASAPGGFF 186
           +   N +     R   G+G   +   +  I     +   R  ++  L   F  ++  G F
Sbjct: 161 ANSMNVLI--GGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAIASVVGPF 218

Query: 187 LGAVFSSMLGQLAWWPWAYWI 207
           LG VF+S +     W W ++I
Sbjct: 219 LGGVFTSRV----TWRWCFYI 235

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 48/240 (20%), Positives = 84/240 (35%), Gaps = 46/240 (19%)

Query: 67  LHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 126
           + ++   FG  N  +  W  + YSL      L+ GR   I G +   +L    +   SL+
Sbjct: 59  IDVVAEQFG--NYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLV 116

Query: 127 AGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAP 182
           A  +   N +                L     ++G T    R + +V S+    F  +A 
Sbjct: 117 AALANSMNMLI---VGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAI 173

Query: 183 GGFFLGAVFSSMLGQLAWWPWAYWI------MGIACFVLA--VAGYFVIPHTPMPSRDAS 234
            G  +G  F++ +     W W ++I        +  F+L        ++  T       S
Sbjct: 174 VGPIIGGAFTTHV----TWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRIS 229

Query: 235 SFKL----------------LERIDFAGSVTGVVGLILF---------NFAWNQGPVVGW 269
            F+L                L + DF G      GL+LF          ++WN G ++ +
Sbjct: 230 KFELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWNSGQIITY 289

>KLTH0D13442g Chr4 complement(1094195..1095973) [1779 bp, 592 aa]
           {ON} similar to uniprot|P53241 Saccharomyces cerevisiae
           YGR065C VHT1 vitamin H transporter H -biotin symporter
          Length = 592

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 12/111 (10%)

Query: 142 RAFQGMGPAF---LLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQL 198
           RA++ M  AF     P +  +LG  Y P    + V   F     GG   G + +S    L
Sbjct: 216 RAYRFMVSAFGSAYYPVSQYVLGSWYAPDEISSRVCLFFCGQLLGGVTSGLLQASTYKTL 275

Query: 199 ------AWWPWAYWIMGIACFV-LAVAGYFVIPHTPMPSRDASSFKLLERI 242
                 A W W + I  +A  +  A+ G+FVIP   +PS+  S F   E I
Sbjct: 276 NGVHGLAGWRWMFLIDAVAISIPCAIIGFFVIPG--VPSKCYSLFLTDEEI 324

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 60/131 (45%), Gaps = 11/131 (8%)

Query: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDC 140
           ++ W  + YSL     +LI GR+  + G K   +     + + SL++  +   + +    
Sbjct: 79  KVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSALANSMDMLI--G 136

Query: 141 CRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSL----FGASAPGGFFLGAVFSSMLG 196
            R   G+G +  + + + ++  T    R + ++ ++    FG ++  G FLG  F++ + 
Sbjct: 137 GRVIAGIGGSG-VQSLVFVISSTLVEERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHVT 195

Query: 197 QLAWWPWAYWI 207
               W W ++I
Sbjct: 196 ----WRWCFYI 202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.137    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,770,232
Number of extensions: 1922484
Number of successful extensions: 6569
Number of sequences better than 10.0: 274
Number of HSP's gapped: 6448
Number of HSP's successfully gapped: 281
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)