Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR301W (RAX1)8.774ON43543521640.0
Smik_15.4828.774ON42542818040.0
Skud_15.4688.774ON42342817460.0
Suva_8.3528.774ON46739415910.0
KAFR0D014908.774ON44344511391e-153
NCAS0B007808.774ON47246411081e-148
NDAI0E006308.774ON49048910881e-145
CAGL0A03828g8.774ON47647610741e-143
KNAG0G031008.774ON46346110431e-138
ZYRO0F12232g8.774ON42642510231e-136
TDEL0B033508.774ON42643210101e-134
Kpol_1010.138.774ON49950010111e-133
TPHA0G012108.774ON4944939971e-131
SAKL0B05456g8.774ON4324368841e-115
KLLA0F24904g8.774ON4244418211e-105
KLTH0H15070g8.774ON4384347981e-102
Kwal_34.159438.774ON4324307951e-101
TBLA0D008408.774ON5775768041e-101
AFR532W8.774ON4224397332e-92
Ecym_14768.774ON453652422e-21
Smik_12.3221.391ON104463705.3
KLLA0F26455g2.618ON86346696.5
TBLA0J010401.170ON74560679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR301W
         (435 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Prote...   838   0.0  
Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301...   699   0.0  
Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301...   677   0.0  
Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W ...   617   0.0  
KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.7...   443   e-153
NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.7...   431   e-148
NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {O...   423   e-145
CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} simila...   418   e-143
KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.7...   406   e-138
ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} simila...   398   e-136
TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {O...   393   e-134
Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {O...   394   e-133
TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {O...   388   e-131
SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} simila...   345   e-115
KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]...   320   e-105
KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} simi...   311   e-102
Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {...   310   e-101
TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.7...   314   e-101
AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic ...   286   2e-92
Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar t...    98   2e-21
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    32   5.3  
KLLA0F26455g Chr6 (2450871..2453462) [2592 bp, 863 aa] {ON} simi...    31   6.5  
TBLA0J01040 Chr10 (238108..240345) [2238 bp, 745 aa] {ON} Anc_1....    30   9.8  

>YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Protein
           involved in bud site selection during bipolar budding;
           localization requires Rax2p; has similarity to members
           of the insulin-related peptide superfamily
          Length = 435

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/435 (93%), Positives = 408/435 (93%)

Query: 1   MKEELSKVSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWV 60
           MKEELSKVSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWV
Sbjct: 1   MKEELSKVSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWV 60

Query: 61  DLMTHTRLCKNYIELVRKSLINFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLE 120
           DLMTHTRLCKNYIELVRKSLINFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLE
Sbjct: 61  DLMTHTRLCKNYIELVRKSLINFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLE 120

Query: 121 NSGPDVPFSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQL 180
           NSGPDVPFSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQL
Sbjct: 121 NSGPDVPFSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQL 180

Query: 181 LHSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLE 240
           LHSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLE
Sbjct: 181 LHSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLE 240

Query: 241 MDCFPKFLSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXX 300
           MDCFPKFLSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISR   
Sbjct: 241 MDCFPKFLSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRIGF 300

Query: 301 XXXXXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLL 360
                       YVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLL
Sbjct: 301 GLLWLGIGFWIGYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLL 360

Query: 361 HRHKNAGNDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGAT 420
           HRHKNAGNDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQ            VVGAT
Sbjct: 361 HRHKNAGNDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQLLRKRGLWCLLLVVGAT 420

Query: 421 AAFTVIFSCVPGRRV 435
           AAFTVIFSCVPGRRV
Sbjct: 421 AAFTVIFSCVPGRRV 435

>Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301W
           (REAL)
          Length = 425

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/428 (77%), Positives = 366/428 (85%), Gaps = 3/428 (0%)

Query: 8   VSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTR 67
           ++ +Q+FE IQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLM HTR
Sbjct: 1   MNRVQDFEKIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTR 60

Query: 68  LCKNYIELVRKSLINFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLENSGPDVP 127
           LCK+Y+ELV KSLINFP+E   NG  ST T DLLNALIEEGHLD EAP +LL++ G D+P
Sbjct: 61  LCKSYVELVTKSLINFPKE---NGGASTTTLDLLNALIEEGHLDLEAPGRLLKSDGQDMP 117

Query: 128 FSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLHSAVGL 187
           FSPKLN+LLGDWK QSG+ Q++LR +D+ALIVDEI+KRRSQQDG PQITTKQL HSAVGL
Sbjct: 118 FSPKLNQLLGDWKRQSGMSQDSLRRDDIALIVDEILKRRSQQDGIPQITTKQLFHSAVGL 177

Query: 188 CNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKF 247
           CNTYLVSPEQSERYLSNIP ETRNRIIE +Q+++KYDIE+FDD+KNLTYQFLEMDCFPKF
Sbjct: 178 CNTYLVSPEQSERYLSNIPTETRNRIIEDIQVQQKYDIEVFDDIKNLTYQFLEMDCFPKF 237

Query: 248 LSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXXXXXX 307
           LSRVALHNIHDEISDWRFHSV  TNEK  R RGQ HISRSPFSNHTSISR          
Sbjct: 238 LSRVALHNIHDEISDWRFHSVNATNEKGKRFRGQAHISRSPFSNHTSISRIGFGLLWLGI 297

Query: 308 XXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAG 367
                YVLIFLAY RAIRVVTVVPF LGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKN+ 
Sbjct: 298 GFWIGYVLIFLAYGRAIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNSS 357

Query: 368 NDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATAAFTVIF 427
           +D+   S+ +DHVP++LAVFGG+RRLTR++HPFTRQ            VVGATAAFTVIF
Sbjct: 358 SDQDGVSAGSDHVPVLLAVFGGKRRLTRVKHPFTRQLLRKRGLWCLLLVVGATAAFTVIF 417

Query: 428 SCVPGRRV 435
           SCVPGRRV
Sbjct: 418 SCVPGRRV 425

>Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301W
           (REAL)
          Length = 423

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/428 (75%), Positives = 360/428 (84%), Gaps = 5/428 (1%)

Query: 8   VSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTR 67
           ++S+ +FE +QR RLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFW+DLM HTR
Sbjct: 1   MNSVHDFEELQRVRLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWIDLMAHTR 60

Query: 68  LCKNYIELVRKSLINFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLENSGPDVP 127
           LC++Y+ELVRKSL+N+PQEQQ+NG  S  T DLL+AL+EEGHLDPE P+KLL+NSGPD+P
Sbjct: 61  LCQSYVELVRKSLVNYPQEQQENGGASVKTHDLLSALVEEGHLDPETPEKLLQNSGPDLP 120

Query: 128 FSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLHSAVGL 187
           FSPKLN+LL  WK QSGI +++LRNED+ LIVDEI+KRRSQQDG PQITTKQLLHSA+GL
Sbjct: 121 FSPKLNQLLEGWKRQSGISEDSLRNEDMTLIVDEILKRRSQQDGVPQITTKQLLHSAMGL 180

Query: 188 CNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKF 247
           C TYL S EQ ERYLSNIP ETRNRI++ VQ++R+YDIE+FDD+KNL YQFLEMDCFPKF
Sbjct: 181 CTTYLASSEQRERYLSNIPTETRNRIVKDVQVKRRYDIEVFDDVKNLAYQFLEMDCFPKF 240

Query: 248 LSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXXXXXX 307
           LSRVALHNIHDEISDWRFHSVG TNEK+ R RGQTHISRSPFSNHTSISR          
Sbjct: 241 LSRVALHNIHDEISDWRFHSVGATNEKNKRVRGQTHISRSPFSNHTSISRIGFGLLWLGI 300

Query: 308 XXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAG 367
                YVLIFLAYSRAIRVVTVVPF LGCYCIVCGMYQVDIVYSWFGVTQRLLHRHK+  
Sbjct: 301 GFWIGYVLIFLAYSRAIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKDGS 360

Query: 368 NDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATAAFTVIF 427
           ++E D+S D DHVP IL     + RLT ++HPF RQ            VVGATAAFTVIF
Sbjct: 361 DNEDDSSEDFDHVPAIL-----KSRLTCVQHPFIRQLLRKRGLWCLLLVVGATAAFTVIF 415

Query: 428 SCVPGRRV 435
           SCVPGRRV
Sbjct: 416 SCVPGRRV 423

>Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W
           (REAL)
          Length = 467

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/394 (75%), Positives = 340/394 (86%), Gaps = 7/394 (1%)

Query: 8   VSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTR 67
           ++++++FE IQ ERLPTLYEVLIQRTS+PVDLWTFYTFLSQFPYAINYLDFWVDLM HTR
Sbjct: 1   MNNVEDFEKIQYERLPTLYEVLIQRTSRPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTR 60

Query: 68  LCKNYIELVRKSLINFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLENSGPDVP 127
           LC++Y+++VRKSL NFPQE QQ G  S  TF+LL+ALIEEGHL+ ++P+ LL+N   DVP
Sbjct: 61  LCQSYVKMVRKSLANFPQEHQQKGDGSATTFNLLDALIEEGHLNLQSPENLLQNEPSDVP 120

Query: 128 FSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLHSAVGL 187
           FSPKLNE+LG+WKH SGI Q+AL+NED+ALI+DEI+KRRSQQDG PQITTKQLLHSA+GL
Sbjct: 121 FSPKLNEMLGNWKHHSGISQDALQNEDMALILDEILKRRSQQDGVPQITTKQLLHSAMGL 180

Query: 188 CNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKF 247
           C TYLVSPEQSERYLSNIP ETR RI+E +Q++RKYD+ IFDD+K LTYQFLEMDCFPKF
Sbjct: 181 CTTYLVSPEQSERYLSNIPAETRTRILEDIQVDRKYDVAIFDDVKALTYQFLEMDCFPKF 240

Query: 248 LSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXXXXXX 307
           LSRVALHNIHDEISDWRFHS      K++RSRGQTHISRSPFSNHTSISR          
Sbjct: 241 LSRVALHNIHDEISDWRFHS------KNSRSRGQTHISRSPFSNHTSISRIGLGLLWLGI 294

Query: 308 XXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAG 367
                YVLIFLAY RAIRVVTVVPF LGCYC+VCGMYQVDIVYSWFGVTQRLLHRHKN+ 
Sbjct: 295 GFWIGYVLIFLAYGRAIRVVTVVPFALGCYCVVCGMYQVDIVYSWFGVTQRLLHRHKNS- 353

Query: 368 NDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFT 401
           ND+  A++D DHVP +LAVFGG+ RLT ++HPFT
Sbjct: 354 NDDAGAATDADHVPGVLAVFGGKSRLTSVQHPFT 387

>KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.774
           YOR301W
          Length = 443

 Score =  443 bits (1139), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 234/445 (52%), Positives = 301/445 (67%), Gaps = 27/445 (6%)

Query: 13  NFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNY 72
           +F  IQ ERLPTLYEVLIQ+TS PVDLW+FYT+LSQFPYAINYLDFW+DLM H RL K+Y
Sbjct: 4   DFAKIQEERLPTLYEVLIQKTSVPVDLWSFYTYLSQFPYAINYLDFWIDLMAHLRLSKDY 63

Query: 73  IELVRKSLI---NF--------PQEQQQNGS--TSTATFDLLNALIEEGHLDPEAPDKLL 119
           I  +R SL+   NF         QE Q + S   S  T  LLNAL+EEGHLD E PD++ 
Sbjct: 64  INGIRGSLLEESNFNELENQQSSQEDQNSNSENVSVTTSVLLNALMEEGHLDFENPDRVS 123

Query: 120 ENSGPDVPFSPKLNELLGDWKHQSGI----GQEALRNEDVALIVDEIMKRRSQQDGKPQI 175
           +       +SPKL++LL  WK  SGI        + N ++  ++DE++K +S+++   QI
Sbjct: 124 KFLQGKADYSPKLSQLLDGWKRHSGIYDANNNLNIDNGNLPTLLDEMLKNKSKRNETSQI 183

Query: 176 TTKQLLHSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLT 235
           TTKQLL++A+ +CNTYL S E+S +YLSNI  ETR ++++SV  + +YD E+F++LK  T
Sbjct: 184 TTKQLLNNALQICNTYLYSTEKSAKYLSNISEETRMKVLDSVVNQNRYDPEVFEELKATT 243

Query: 236 YQFLEMDCFPKFLSRVALHNIHDEISDWRFHS-VGVTNEKSNRSRGQTHISRSPFSNHTS 294
           YQ LE DCFPKFLS VALHNIHDE+SDWRFHS  G  +  + R RG    SRSPFSNHT+
Sbjct: 244 YQLLETDCFPKFLSTVALHNIHDELSDWRFHSEKGAIDNTTLRYRG----SRSPFSNHTT 299

Query: 295 ISRXXXXXXXXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFG 354
           +SR               YVLIFL YSRAIRVVTVVPF +GCY I+CGMYQVDI+YSWFG
Sbjct: 300 LSRLIFGLVWLGIGFWIGYVLIFLKYSRAIRVVTVVPFAIGCYLIICGMYQVDIIYSWFG 359

Query: 355 VTQRLLHRHKNA----GNDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXX 410
           VTQ L ++  ++     NDE + ++  + VP ++A+ GG +R  +IEH F ++       
Sbjct: 360 VTQVLTYKDSDSKILRSNDE-EHTTTKEKVPFLIALLGGGKRTVKIEHTFIKKLLQRRGL 418

Query: 411 XXXXXVVGATAAFTVIFSCVPGRRV 435
                VV +TA FTVIFSCVPG R+
Sbjct: 419 WCLLLVVISTAIFTVIFSCVPGFRI 443

>NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.774
           YOR301W
          Length = 472

 Score =  431 bits (1108), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 226/464 (48%), Positives = 290/464 (62%), Gaps = 41/464 (8%)

Query: 13  NFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNY 72
           +FE IQ ERLPTLYEVL+Q+T  PVDLW+FYTFLSQFPYAINYLDFW+DLMTH RLCK+Y
Sbjct: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68

Query: 73  IELVRKSLI------------NFPQEQQ----QNGSTSTATFDLLNALIEEGHLDPEAPD 116
           ++ +R+SL+            N    QQ     + S S  T  LLNAL+EEGH D   P 
Sbjct: 69  VDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPA 128

Query: 117 KLLENSGPDVPFSPKLNELLGDW-KHQSGIGQEALRNEDVAL----------IVDEIMKR 165
            + +     V  SPKL +L+ DW +H   +                      I+D+I+KR
Sbjct: 129 GVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDSNRNRSSNNNSNSNNNNLSSILDDILKR 188

Query: 166 RSQQDGKPQITTKQLLHSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDI 225
           +SQ + KP++TTKQLL+SA+ +C+ YL+SPEQSERYL+NIP E R + +  +Q   ++D 
Sbjct: 189 QSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSRHDP 248

Query: 226 EIFDDLKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRF--HSVGVTNEKSNRS----- 278
           E+FD+LK+++YQFLE+DCFPKFLS VALHNIHDEISDWRF  HS G    KS  S     
Sbjct: 249 EVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLTEKD 308

Query: 279 -RGQTHISRSPFSNHTSISRXXXXXXXXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCY 337
                HIS+SPFS +T++SR               Y LIFL Y R IRVVT+VPF +G Y
Sbjct: 309 LESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSY 368

Query: 338 CIVCGMYQVDIVYSWFGVTQRLLHRHKNA------GNDEGDASSDTDHVPMILAVFGGRR 391
            +VCG+YQVDI+YSWFG+TQRLL++ +        GN   D     D +P I  + GGR 
Sbjct: 369 FVVCGLYQVDILYSWFGITQRLLYKDRKVTEDGYDGNVPVDVKESKDKIPFIFGILGGRN 428

Query: 392 RLTRIEHPFTRQXXXXXXXXXXXXVVGATAAFTVIFSCVPGRRV 435
           RL  ++HPF R+            V+ +T  FTV+FSCVPG RV
Sbjct: 429 RLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472

>NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {ON}
           Anc_8.774 YOR301W
          Length = 490

 Score =  423 bits (1088), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 229/489 (46%), Positives = 303/489 (61%), Gaps = 68/489 (13%)

Query: 13  NFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNY 72
           +++ IQ ERLPTLYEVLIQ+T  PVDLW+FYTFLSQFPYAINYLDFW+DLM H RLCK+Y
Sbjct: 4   DYKKIQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAINYLDFWIDLMAHLRLCKDY 63

Query: 73  IELVRKSLINFPQEQQQNG--------------------------------------STS 94
           I  +R+S I + Q + +N                                       + S
Sbjct: 64  ISGIRES-ITYNQNEARNSRIRHHLQYTSEESIQHETQSIQHHDDPEGGDEDDDDDDNIS 122

Query: 95  TATFDLLNALIEEGHLDPEAPDKLLENSGPDVPFSPKLNELLGDWKHQSGIGQEALR--- 151
             T  LLNAL++EGHLD E P+++ +    +  +SPKL++LL DWK  S    ++ R   
Sbjct: 123 VTTSVLLNALLDEGHLDFENPERVSQFLQGNTEYSPKLSQLLEDWKRHSIANNDSNRKGS 182

Query: 152 ----NEDV--------AL--IVDEIMKRRSQQDGKPQITTKQLLHSAVGLCNTYLVSPEQ 197
               N +V        AL  +VD+I++++SQQ+ + +ITTKQLL++A+ +C+ YL SPE+
Sbjct: 183 LNRNNSNVRSRETNGAALPDVVDDILRKQSQQEERAKITTKQLLNNALKICSIYLQSPER 242

Query: 198 SERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSRVALHNIH 257
           SERYL+N+P + R + +  VQ ER++D ++F++LK++ +QFLEMDCFPKFLS VALHNIH
Sbjct: 243 SERYLTNLPDDIRLKALNLVQNERRHDPQVFEELKSIAFQFLEMDCFPKFLSTVALHNIH 302

Query: 258 DEISDWRFHSVG----VTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXXXXXXXXXXXY 313
           DEISDWRFHS      +T    +  +   HIS+SPFS +T +SR               Y
Sbjct: 303 DEISDWRFHSNARSHNLTRVDKSLIKNHDHISKSPFSTYTLLSRTIFGLLWLGIGFWIGY 362

Query: 314 VLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDEGDA 373
            LIFL Y R IRVVT+VPF +G Y I+CGMY+VDI+YSWFGVTQRLL++H N  N + D 
Sbjct: 363 TLIFLKYDRGIRVVTIVPFAIGNYFIICGMYRVDIIYSWFGVTQRLLYKH-NEKNRDADR 421

Query: 374 SSDTD-------HVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATAAFTVI 426
               D       HV  ILA+ GGR RL RIEHPF +             V+ +T  FTVI
Sbjct: 422 EVQMDEKNGKNHHVSGILALLGGRSRLIRIEHPFIKNILMKRGLWCLFLVLLSTGIFTVI 481

Query: 427 FSCVPGRRV 435
           FSCVPG R+
Sbjct: 482 FSCVPGYRI 490

>CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301w RAX1
          Length = 476

 Score =  418 bits (1074), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 291/476 (61%), Gaps = 51/476 (10%)

Query: 9   SSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRL 68
           S+  +F+ IQ +RLPTLYEV I +T  PVDLW+FYT+LSQFPYAINYLDFW+DLM H RL
Sbjct: 3   STAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRL 62

Query: 69  CKNYIELVRKSLI---------------NFPQEQQQNGSTSTATFDLLNALIEEGHLDPE 113
           CK+Y+  VR+S++               N  +    +   S  T  L+N L+ EG+LD E
Sbjct: 63  CKDYVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFE 122

Query: 114 APDKLLENSGPDVPFSPKLNELLGDWK----------------HQSGIG---QEALRNED 154
            P+K+ +    +   SP +  ++ DWK                 Q+GI    +E++  + 
Sbjct: 123 NPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESM--QS 180

Query: 155 VALIVDEIMKRRSQQDGKPQITTKQLLHSAVGLCNTYLVSPEQSERYLSNIPMETRNRII 214
           V+ IVDE +KR+SQ   K  ITTKQL ++A  +CNTYL+S + S RYL+NIP + +N++I
Sbjct: 181 VSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVI 240

Query: 215 ESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSVGVTNEK 274
            + +  R++D E+F +LK +TYQFLE DCFPKFL  VALHNIHDE+SDWRFH       +
Sbjct: 241 HNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHR 300

Query: 275 SNRSRG------------QTHISRSPFSNHTSISRXXXXXXXXXXXXXXXYVLIFLAYSR 322
           ++   G            Q HIS SPFS +TS+SR               YVLIFL YSR
Sbjct: 301 TSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSR 360

Query: 323 AIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDEGD---ASSDTDH 379
           AIRV TVVPF LGCY IVCG+YQVDI+YSWFG+TQRL++ HK    +EG     ++  D 
Sbjct: 361 AIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDD 420

Query: 380 VPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATAAFTVIFSCVPGRRV 435
           VP+I  + GG+ RL  IEHPF ++            VV  TA FTVIF CVPGRR+
Sbjct: 421 VPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476

>KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.774
           YOR301W
          Length = 463

 Score =  406 bits (1043), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 219/461 (47%), Positives = 286/461 (62%), Gaps = 37/461 (8%)

Query: 12  QNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKN 71
           +NF  IQ+ERLPTLYEVLIQ++  P+DLW+FYT+LSQFP+AINYLDFW+DLM H RLCK+
Sbjct: 3   RNFAQIQKERLPTLYEVLIQKSGAPLDLWSFYTYLSQFPFAINYLDFWIDLMAHIRLCKD 62

Query: 72  YIELVRKSLINFPQ--EQQQNG-----STSTATFDLLNALIEEGHLDPEAPDK------- 117
           +I+ VR+S+    +  E+QQ G     + S  T  L+  ++EE  LD   PD        
Sbjct: 63  FIKGVRRSIGEAAERNEEQQGGGGADDTASVTTSVLMQTIMEEAQLDLNRPDDVYSFFRN 122

Query: 118 ------LLENSGPDVPFSPKLNELLGDWKHQSG---IGQEA-LRNEDVALIVDEIMKRRS 167
                 L +N      +S +++++L +W  ++     G    + N ++  ++DE +   S
Sbjct: 123 SHQQDGLGDNLRASSRYSARVSQMLDEWNGRTSHRYTGHSVDISNGNLTTLMDEFLNEHS 182

Query: 168 QQ--DGKPQITTKQLLHSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDI 225
           +   DG   ITTKQLLH+A  +C TYL+S E+SERYL+NIP E R  I+  V   +KYD 
Sbjct: 183 KTRGDGGAYITTKQLLHNATHMCRTYLISREESERYLTNIPTEIREYILVGVLDAKKYDP 242

Query: 226 EIFDDLKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSV---------GVTNEKSN 276
            IFDDLK LTYQFLE+DCFPKFLS+VALHN+HDEIS+WRF+ +         G       
Sbjct: 243 GIFDDLKTLTYQFLEIDCFPKFLSQVALHNLHDEISNWRFNKLDSTKYSGGGGALTGDPE 302

Query: 277 RSRGQTHISRSPFSNHTSISRXXXXXXXXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGC 336
           +       + +PFSN+T++SR               Y LIFL YSRAIRVVTVVPF LGC
Sbjct: 303 KDAVGYRGAHTPFSNYTTLSRILFGLLWLGIGFWIGYTLIFLKYSRAIRVVTVVPFALGC 362

Query: 337 YCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDEGDASSD--TDHVPMILAVFGGRRRLT 394
           Y  +CG+YQVDI+YS FGVTQRLL R   A  ++    +D  T  VP +L +FGGR RL 
Sbjct: 363 YYCICGLYQVDIIYSIFGVTQRLLQRETAAAGEDPPTHTDATTAKVPSLLVLFGGRGRLL 422

Query: 395 RIEHPFTRQXXXXXXXXXXXXVVGATAAFTVIFSCVPGRRV 435
           +IEH FTR+            V  +TAAFTVIFSCVPG RV
Sbjct: 423 KIEHEFTRRLLLRRGLWCLLLVTFSTAAFTVIFSCVPGYRV 463

>ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 426

 Score =  398 bits (1023), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 195/425 (45%), Positives = 281/425 (66%), Gaps = 4/425 (0%)

Query: 13  NFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNY 72
           +F  I+ +RLPTLYEVL+++TS PVDLW+FYTFLSQFPYAI++LDFW+DLM H RLC++Y
Sbjct: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63

Query: 73  IELVRKSLINFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLENSGPDVPFSPKL 132
           +  V++S+     E   + + S  +  LL+AL+ EG+LD +   ++ +    +V  S ++
Sbjct: 64  VRGVKESIEARNSELIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEESMRI 123

Query: 133 NELLGDWKHQSGIGQEALRNED--VALIVDEIMKRRSQQDGKPQITTKQLLHSAVGLCNT 190
           + LL  +K    +  ++ R  D  +A +VD+++K++  +D +P++T KQL+++A  +C  
Sbjct: 124 SRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQICRQ 183

Query: 191 YLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSR 250
           YL+SP++S RYL N+P E R + + +VQ ER++D E+F+DL+NL+Y FLEMDCFPKFL+R
Sbjct: 184 YLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNR 243

Query: 251 VALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXXXXXXXXX 310
           VALHN+HD++SDWRF +     +     RGQ   S SP S ++ + R             
Sbjct: 244 VALHNLHDQLSDWRFQTTAAIGKSKGDIRGQR--SASPLSTYSGLGRIALGLCWLGIGFW 301

Query: 311 XXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDE 370
             YVLIFL YSRAIRV T+VPF +GCY  VCG+YQVDI+YSWFGVTQRL++  K   + E
Sbjct: 302 IGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPSDRE 361

Query: 371 GDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATAAFTVIFSCV 430
            D       VP I A+ GGR RL  + HPF ++            VV +TA  TV+FSCV
Sbjct: 362 EDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCFLLVVVSTAVLTVLFSCV 421

Query: 431 PGRRV 435
           PG+R+
Sbjct: 422 PGKRI 426

>TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {ON}
           Anc_8.774 YOR301W
          Length = 426

 Score =  393 bits (1010), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 197/432 (45%), Positives = 282/432 (65%), Gaps = 20/432 (4%)

Query: 12  QNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKN 71
           Q++E IQRERLPTLYEVLIQ T  PVD W FYT+LSQFPYAI+YLDFW+DLM H RLCK+
Sbjct: 7   QDYEQIQRERLPTLYEVLIQVTKAPVDSWEFYTYLSQFPYAIDYLDFWIDLMAHIRLCKD 66

Query: 72  YIELVRKSL--------INFPQEQQQNGSTSTATFDLLNALIEEGHLDPEAPDKLLENSG 123
           Y++ VR+S+         N  +   ++ + S ++  LL+AL+ EG+LD +   ++ +   
Sbjct: 67  YVKGVRESVEFNETIASRNRDEVNIEDDNESVSSSVLLDALLNEGYLDFQNTKRVSQFLQ 126

Query: 124 PDVPFSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLHS 183
            D   SP+++ L+  WK QSGI     +N  +AL+VDE++++ +++  +P+IT KQL+++
Sbjct: 127 GDTNDSPRVSRLVDGWKRQSGIADG--QNHPLALMVDEMLRKETRKLKQPKITRKQLVNN 184

Query: 184 AVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDC 243
           A+ +CN YL+   +  +YL N+P   +N+++  VQ E+++D  +F+ LK + YQFLE+DC
Sbjct: 185 ALQICNIYLLKSAEDNKYLINVPERVKNQVLYDVQQEQRHDPAVFEPLKTVAYQFLEIDC 244

Query: 244 FPKFLSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXX 303
           FPKFLS VALHNIHD+IS+WR+ S G+          + H S+SPFSN+T +SR      
Sbjct: 245 FPKFLSTVALHNIHDQISNWRYQSPGL----------RRHRSKSPFSNYTVLSRVLIGLI 294

Query: 304 XXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRH 363
                    Y LIFL YSRAIRVVT+VPF LG Y IVCG+YQVDI+Y++FG+TQ L+++ 
Sbjct: 295 WLGIGFWIGYTLIFLHYSRAIRVVTIVPFALGSYSIVCGLYQVDILYAFFGLTQALMYQE 354

Query: 364 KNAGNDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATAAF 423
           K+    +   S D   +P I  + GGR RL +I+H F ++               ATA  
Sbjct: 355 KDGSQTDRKHSHDYSEIPTIFKLLGGRSRLIKIQHDFIKKLLWKRALWCGFLTTLATAIL 414

Query: 424 TVIFSCVPGRRV 435
           TVIFSCVPG R+
Sbjct: 415 TVIFSCVPGYRL 426

>Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {ON}
           complement(27385..28884) [1500 nt, 500 aa]
          Length = 499

 Score =  394 bits (1011), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 211/500 (42%), Positives = 296/500 (59%), Gaps = 73/500 (14%)

Query: 8   VSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTR 67
           ++ + +F+ IQ+ERLPTLYEVLIQ+T  PVDLW+FYTFLSQFP+A+NYL+FW+DLM+H R
Sbjct: 1   MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIR 60

Query: 68  LCKNYIELVRKSLINFPQEQ-----------------------------QQNG---STST 95
           LCK+YI  +R+S++  P E+                             + NG   + S 
Sbjct: 61  LCKDYIRGIRESVL-IPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISV 119

Query: 96  ATFDLLNALIEEGHLDPEAPDKLLENSGPDVPFSPKLNELLGDWKHQSGI--------GQ 147
            +  L++AL++EG+LD + P K+      D+ +SP+L++LL DWK  SG           
Sbjct: 120 TSSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYA 179

Query: 148 EALRNEDVALIVDEIMKRRSQ-QDGKPQITTKQLLHSAVGLCNTYLVSPEQSERYLSNIP 206
            + ++  +   VD +++  ++    +PQ+T K LL +A  +C+ YL+SPE+SE+YL N+P
Sbjct: 180 SSGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVP 239

Query: 207 METRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH 266
              RN  ++ V+I  ++D E+F+ +++L YQFLE+DCF KFL+RVALHNIHD+ISDW++H
Sbjct: 240 EHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYH 299

Query: 267 SV----------------------------GVTNEKSNRSRGQTHISRSPFSNHTSISRX 298
            V                               +E  N      H SRSPFSN+T+ISR 
Sbjct: 300 PVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRI 359

Query: 299 XXXXXXXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQR 358
                         YVLIFL Y+R IRVVT+VPF +G Y IVCG+YQVD+VYSWFGVTQ 
Sbjct: 360 CFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQE 419

Query: 359 LLHRHKNAGNDEG---DASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXX 415
           L+ RHK++  + G   +   +   VP IL V GG+ RL RI+H F R             
Sbjct: 420 LMFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAI 479

Query: 416 VVGATAAFTVIFSCVPGRRV 435
           +  +TA FTVIFSCVPGRRV
Sbjct: 480 ITISTAIFTVIFSCVPGRRV 499

>TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {ON}
           Anc_8.774 YOR301W
          Length = 494

 Score =  388 bits (997), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 206/493 (41%), Positives = 295/493 (59%), Gaps = 72/493 (14%)

Query: 13  NFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNY 72
           +FE +Q ERLPTLYEVLI +T +PVDLW+FYTFLSQFP+AINYL+FW+DLM H RLCK+Y
Sbjct: 4   DFEKLQEERLPTLYEVLILKTEKPVDLWSFYTFLSQFPHAINYLEFWIDLMAHIRLCKDY 63

Query: 73  IELVRKSLINFPQEQQ----------------------------------QNGSTSTATF 98
           +E +R S+I    E +                                   + S S  + 
Sbjct: 64  LENIRSSVIEVVDESRVSDEYGNLTTAGDHRKHKEESSSDRYGPGGNDGDADDSASVTSS 123

Query: 99  DLLNALIEEGHLDPEAPDKLLENSGPDVPFSPKLNELLGDWKHQSGIGQEALRNEDV-AL 157
            L+NAL+ EG+LD + PD++      D+ +SP+L++LL +W+  SGI  +  RN+DV   
Sbjct: 124 LLINALMNEGYLDFQDPDQVNRFLQGDIEYSPQLSQLLAEWRRHSGIPGK--RNDDVNES 181

Query: 158 IVDEIMKRRSQQDG---------------------------KPQITTKQLLHSAVGLCNT 190
            +DE    +  Q G                           KPQITTKQL H+A  +C  
Sbjct: 182 EIDENTGEKKNQVGYENKILSAIDDLLKNHVSGQNNAGETIKPQITTKQLHHNAAQICTL 241

Query: 191 YLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSR 250
           YL+SPE+S++YL NIP   R   ++++Q +++YD ++F++LKN++YQFLE+DCF KFL R
Sbjct: 242 YLLSPERSDKYLINIPEHVREDTLKAIQNDKRYDPDVFEELKNISYQFLEIDCFTKFLGR 301

Query: 251 VALHNIHDEISDWRFHSVG---VTNEKSNRSRGQT-HISRSPFSNHTSISRXXXXXXXXX 306
           VALHN+HD+ISDWRFH+     + NE+++  + Q  H SRS FS++T++SR         
Sbjct: 302 VALHNLHDQISDWRFHNSSTRFLPNEETHEKKKQLRHHSRSLFSSYTTLSRVMLGLFFMG 361

Query: 307 XXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNA 366
                 Y LIFL Y+R IRVVT+VPF +G Y IVCG+YQ+DI Y+ FG+TQ L+++HK +
Sbjct: 362 IGFWIGYALIFLNYARGIRVVTIVPFIIGSYFIVCGIYQIDIAYACFGITQELMYKHKRS 421

Query: 367 GNDEGDASSDTD----HVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATAA 422
            ++E + S + +     +  +  + GG+ RL +I+HPF R             V+ +T  
Sbjct: 422 PDEETNHSDNLEAKDGEISGLFKILGGQTRLIKIKHPFIRNLIYKRGLWCLLWVLISTGV 481

Query: 423 FTVIFSCVPGRRV 435
           FTVIF+CVP RRV
Sbjct: 482 FTVIFACVPSRRV 494

>SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 432

 Score =  345 bits (884), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 182/436 (41%), Positives = 273/436 (62%), Gaps = 28/436 (6%)

Query: 17  IQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNYIELV 76
           +Q +RLPTLYEVL Q+T+ PVDLW+FYT+LSQFP+AINYLDFW+D+M H RLCK+Y++ +
Sbjct: 8   LQSDRLPTLYEVLNQQTTTPVDLWSFYTYLSQFPHAINYLDFWIDIMAHLRLCKDYVKGI 67

Query: 77  RKSLINFPQEQQ------------QNGSTSTATFDLLNALIEEGHLDPEAPDKLLENSGP 124
           R+S++ + +  +             N  +S +T  LL AL+ +G LD +   ++ +    
Sbjct: 68  RESVLVWEEANRPPRIPKHDSGVSDNYRSSVSTSLLLEALMNDGVLDFQDSKRVSQFLQG 127

Query: 125 DVPFSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLHSA 184
               SP+L++L+ +WK QS +      N+ +  ++D+ +K+  ++  +P+ITTKQLL++A
Sbjct: 128 QTD-SPRLSQLMENWKRQSALED----NDRLTEVLDDFLKQEMKESQQPRITTKQLLNNA 182

Query: 185 VGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCF 244
           + + N YL SP+QS ++L N+P + R   I +VQ+++++D ++F+ LK++ +QFLEMDCF
Sbjct: 183 LQIVNMYLSSPQQSPKFLVNVPEKIRLDAIHTVQVQQRHDPDVFESLKSVAFQFLEMDCF 242

Query: 245 PKFLSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXXX 304
           PKFL  VALHN+HD+++D   HS  +  + +   R   H   S FS +T +SR       
Sbjct: 243 PKFLGCVALHNLHDDMTD---HSSPLGGKTATTQR---HRKSSLFSTYTILSRVFLGLLL 296

Query: 305 XXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHK 364
                   YVLIFL YSR IRVVT+VPF LG Y +VCG+YQ+D+VY+ FGVTQ L+    
Sbjct: 297 LGIGFWIGYVLIFLDYSRGIRVVTIVPFFLGFYYVVCGIYQLDVVYALFGVTQNLVTNKD 356

Query: 365 NAGNDEG-----DASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGA 419
               + G       SS+   +P+I  V GGR RL ++ HPF  +            ++  
Sbjct: 357 KRDLELGYQRNSSKSSNVRRLPVIFRVLGGRGRLVKVRHPFVDRILKRRSVWCWFLILLG 416

Query: 420 TAAFTVIFSCVPGRRV 435
           TA FTVIFSCVPG R+
Sbjct: 417 TAIFTVIFSCVPGHRL 432

>KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]
           {ON} similar to uniprot|Q08760 Saccharomyces cerevisiae
           YOR301W RAX1 Protein involved in bud site selection
           during bipolar budding localization requires Rax2p
          Length = 424

 Score =  320 bits (821), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/441 (40%), Positives = 261/441 (59%), Gaps = 33/441 (7%)

Query: 11  MQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCK 70
           M+     QR RLPTLYEVL Q+T+ P+DLW+FYT+LSQ+P+AI YLDFW D+M + RLCK
Sbjct: 1   MEKLPNSQRARLPTLYEVLNQQTAAPLDLWSFYTYLSQYPHAIVYLDFWTDVMAYLRLCK 60

Query: 71  NYIELVRKSLINFPQE------QQQNGS---TSTATFDLLNALIEEGHLDPEAPDKLLEN 121
           +Y++ +R+S+++  +       Q+ NG     S ++  LL AL+ +G+LD     ++ + 
Sbjct: 61  DYVKGIRESVLDVNKLETPTVLQEGNGDDKRESVSSAMLLEALMNDGYLDYNDSQRVSQF 120

Query: 122 SGPDVPFSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLL 181
              +   SP+L++LL DWK    +  + +   D +  VD ++K    +D KP++TTKQL+
Sbjct: 121 LKGETD-SPRLSQLLQDWKQ---VNNDQI---DFSDFVDGLVKSNVTKDHKPKLTTKQLI 173

Query: 182 HSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEM 241
            SA  + +TYL+S EQS+R+L  IP   RN  I  +  E+++D E+F+ +K + YQFLE+
Sbjct: 174 SSAQDIVSTYLLSQEQSDRFLFEIPAYLRNDTIRLIMEEKRHDPEVFEPIKEIVYQFLEV 233

Query: 242 DCFPKFLSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXX 301
           DCFP+FL  VALHN+HDEI         +   K N+S      S SPFS  ++ SR    
Sbjct: 234 DCFPRFLGCVALHNLHDEIV--------LQRPKKNKSYNSR--SNSPFSQWSTASRLTIG 283

Query: 302 XXXXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLH 361
                      Y LIF+ YS+ IRVV +VPF LG Y I+CG+Y VDI+Y++ GVTQ L+ 
Sbjct: 284 LAWWLVGLWIGYTLIFMNYSKGIRVVCIVPFFLGSYYIICGIYLVDIIYAFSGVTQTLVS 343

Query: 362 RHK-------NAGNDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXX 414
           + K       +  N   ++   ++ VP  L +FGGR RL +++HPF              
Sbjct: 344 KRKLDDLELRSMNNHRSNSLHSSNEVPWWLTIFGGRSRLCKVKHPFVNSIMIRRALWCLL 403

Query: 415 XVVGATAAFTVIFSCVPGRRV 435
            V+  TA  T IF+ VPGRR+
Sbjct: 404 LVLIMTAILTAIFAAVPGRRI 424

>KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 438

 Score =  311 bits (798), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/434 (39%), Positives = 254/434 (58%), Gaps = 24/434 (5%)

Query: 20  ERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNYIELVRKS 79
           +RLPTLYEVL ++T  PVDLW+FYTFLSQ+PYAIN+LDFW+D M H RLCK+Y++ VR+S
Sbjct: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70

Query: 80  LINFPQEQQQNGSTSTA-----------TFDLLNALIEEGHLDPEAPDKLLENSGPDVPF 128
            + +   Q+++G+   +           +  LL AL+ +G LD E   ++          
Sbjct: 71  FVEWEDSQERSGANRDSRDSHDNRDSLSSSLLLEALMNDGFLDYEDSKRVSRFLQGQTD- 129

Query: 129 SPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLHSAVGLC 188
           SP+L +LL +W+ Q+    +A     +  +VDE +K ++Q   K +IT+K+LL++A  + 
Sbjct: 130 SPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNARNIV 189

Query: 189 NTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFL 248
           +TYL++PE+S RYL N+P   R   +  V  E+++D ++F+ LK +++QFLEMDCFPKFL
Sbjct: 190 HTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFL 249

Query: 249 SRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXXXXXXX 308
           S VALHN+HD+I+     S  +++  +          RS F+ +T++SR           
Sbjct: 250 SCVALHNLHDDIT-----SSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIFLWMG 304

Query: 309 XXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGN 368
               Y L+FL YSR IRV T+VPF LG Y I CG+Y++DI+Y+  GVTQ L+     +  
Sbjct: 305 LWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSK 364

Query: 369 D-EGDASSDTDH------VPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATA 421
           D E   + +  H         +  VFGG  RL  I+ PF               V+  TA
Sbjct: 365 DLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTA 424

Query: 422 AFTVIFSCVPGRRV 435
            FTVIFSCVPG R+
Sbjct: 425 IFTVIFSCVPGHRL 438

>Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {ON}
           YOR301W (RAX1) - Similar to B-chains of the
           insulin-related hormone superfamily. [contig 272] FULL
          Length = 432

 Score =  310 bits (795), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/430 (40%), Positives = 255/430 (59%), Gaps = 23/430 (5%)

Query: 21  RLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNYIELVRKSL 80
           RLPTL+EVL ++++ PVDLW+FY FLSQ+PYAIN+LDFW+D+M H RLCK+Y++ +R+S+
Sbjct: 11  RLPTLFEVLNRQSAAPVDLWSFYIFLSQYPYAINFLDFWIDVMAHLRLCKDYVKGIRESV 70

Query: 81  INFPQEQQQNGSTSTATFDLL-----NALIEEGHLDPEAPDKL--LENSGPDVPFSPKLN 133
           I +    +++G+   +   L       AL+ +G+LD E   ++        D   SP+L 
Sbjct: 71  IEWEDSLERSGANRDSRDSLSSSLLLEALMNDGYLDYEDSKRVSRFLQGHTD---SPRLT 127

Query: 134 ELLGDW-KHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLHSAVGLCNTYL 192
            LL +W KH       A     +  +VD+ +K ++    K +IT+K+LL++A  + NTYL
Sbjct: 128 RLLDNWQKHADQDSAGAPFKSPLTGLVDDFLKTQAHDFHKARITSKELLNNAQNIVNTYL 187

Query: 193 VSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSRVA 252
           +SPE S RYL N+P   R   +  V+ E+++D E+F+ LK+L +QFLEMDCFPKFL+ VA
Sbjct: 188 LSPETSVRYLINLPDHMRENTLRMVRDEKRHDPELFEQLKSLAFQFLEMDCFPKFLTSVA 247

Query: 253 LHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXXXXXXXXXXXXXX 312
           LHN+HD+I+     +      + + +R       SPF++HT++SR               
Sbjct: 248 LHNLHDDITTPPLTAPQTPAHEPSFTR-----RHSPFAHHTTLSRVALGMLFLWMGLWLG 302

Query: 313 YVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDE-- 370
           Y LIFL YSR IRV T+VPF LG Y I CG+Y++DI+Y+  GVTQ L+   + +  D   
Sbjct: 303 YTLIFLDYSRGIRVTTIVPFFLGFYFICCGIYRIDILYALAGVTQTLVSNEQVSLKDLEI 362

Query: 371 GDASSDTDH-----VPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXVVGATAAFTV 425
           G   +  +H      P +  + GG  RL RI+HPF  +            V+  T  FTV
Sbjct: 363 GLNRNSVNHRMSHNAPFVFRILGGTGRLVRIKHPFINKLLKKRGYWCLLLVLTLTGVFTV 422

Query: 426 IFSCVPGRRV 435
           IFSCVPGRR+
Sbjct: 423 IFSCVPGRRL 432

>TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.774
           YOR301W
          Length = 577

 Score =  314 bits (804), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 204/576 (35%), Positives = 283/576 (49%), Gaps = 155/576 (26%)

Query: 13  NFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNY 72
           +++ IQ ERLPTLYEVLIQ++S P DLW+FYT+LSQFPYAINYL+FW+DLM H RLC++ 
Sbjct: 4   DYKQIQHERLPTLYEVLIQKSSAPADLWSFYTYLSQFPYAINYLEFWIDLMNHNRLCRHL 63

Query: 73  IELVRKSLI----NFPQEQQ-----------------------QNGSTSTATFD------ 99
           I  ++ SLI    N P   +                       Q  ST  A FD      
Sbjct: 64  INEIKNSLIQNNKNNPHLNEEDLQKIIDKYSNNDILPPSMPLPQAVSTPPADFDTIDEVE 123

Query: 100 ---------------------------LLNALIEEGHLDPEAPDKLLE----NSGPDVPF 128
                                      LLN L+ EG+L+P+   ++ +    N G    +
Sbjct: 124 RESLSNMPIPEQDEDIDNDNDSITSSILLNVLMNEGYLNPDDHYRMSKFFQGNIGGSNDY 183

Query: 129 SPKLNELLGDWK-----------HQSGIGQ-------------EALRNEDVALIVDEIMK 164
             ++++L+ +W+            Q+  G+                  E  A +VDE+++
Sbjct: 184 --RMSQLMQNWQRHNDNSNSNNTRQTNTGETNNAGNNSNSNSYTNNTTERFAAMVDELLQ 241

Query: 165 RR----------------SQQDGKPQITTKQLLH---------SAVGLCNTYLVSPEQSE 199
                              +Q+ +   ++   L+         +A  +CN YL+SPE+S+
Sbjct: 242 NNRIPMPSPILPNTQENIQEQEDQANASSSSFLNGLTTRDLIKNARNICNLYLISPEKSK 301

Query: 200 RYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSRVALHNIHDE 259
           +YL NIP   +  II+ ++ E ++D  IFDDL+NLTY FLE+DCFPKFLS++ALHNIHD+
Sbjct: 302 KYLINIPETIKFDIIKKIKFENRFDPLIFDDLQNLTYNFLEVDCFPKFLSKIALHNIHDQ 361

Query: 260 ISDWRFHS---VGVTNEKSNRSRGQ----------------------------THISRSP 288
           ISDWRFHS   +   N KSNR   +                             HISRSP
Sbjct: 362 ISDWRFHSSFKLTSQNRKSNRGLSENDNSSSTDNEKNYQSDNDDNDSMIYNIDNHISRSP 421

Query: 289 FSNHTSISRXXXXXXXXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDI 348
           FSN+T ISR               Y LIFL YSR IRV T+ PF  GCY I+CG+YQ+DI
Sbjct: 422 FSNYTIISRLFVGFIWLGIGFWIGYTLIFLNYSRGIRVTTLPPFLFGCYYIICGLYQLDI 481

Query: 349 VYSWFGVTQRLLHRHKNA---GNDEGDASSDTD------HVPMILAVFGGRRRLTRIEHP 399
            YS FGVTQ L+ + K      N + D ++  +       +P    +FGG++RL +I+HP
Sbjct: 482 FYSLFGVTQDLMFQPKRNLLHANKKIDKTTKKNLKHLKRGIPFFFNLFGGKKRLIKIDHP 541

Query: 400 FTRQXXXXXXXXXXXXVVGATAAFTVIFSCVPGRRV 435
           + R             V  +TA  TVIFS VPG RV
Sbjct: 542 YIRNLLFKRGIWCAILVALSTAGLTVIFSVVPGWRV 577

>AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR301W (RAX1)
          Length = 422

 Score =  286 bits (733), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 168/439 (38%), Positives = 252/439 (57%), Gaps = 44/439 (10%)

Query: 17  IQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNYIELV 76
           +Q ERLPTL+EVL  +T+ PVD W+FYTFL Q+P A+NY+DFWVD+M H RLCK+Y++ +
Sbjct: 8   LQSERLPTLFEVLNNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLCKDYVKGI 67

Query: 77  RKSLINFPQEQQQN-------GST----STATFDLLNALIEEGHL---DPEAPDKLLENS 122
           R+S++    E+QQ        GST    S ++  LL+AL+ +G+L   D     + L+  
Sbjct: 68  RESMMLLEVEEQQGRSRGRPAGSTEKRQSLSSSVLLDALLNDGYLDYHDNRRISQFLKGD 127

Query: 123 GPDVPFSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLH 182
           G     S +L++L       S   +       ++L++DE + R+ ++  +P++TTKQL+ 
Sbjct: 128 GE----SARLSQLFEGRGGDSSGEKAPTEEPHLSLMLDEFLVRQMKESQRPKLTTKQLVA 183

Query: 183 SAVGLCNTYLVSPE--QSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLE 240
           SA  + + YLVS +  +SER L+ +P   R  +I  V+ E++YD ++F+ LK +++QFLE
Sbjct: 184 SANTIVDRYLVSKDSMRSERLLTTVPEHMRLEVINLVKGEQRYDPDVFEPLKIISFQFLE 243

Query: 241 MDCFPKFLSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRXXX 300
           + CFPKFLS VALHN+H +IS          ++K+         SRSP+S  T+++R   
Sbjct: 244 IYCFPKFLSSVALHNLHYDIS---------LSQKA---------SRSPYSQCTTLARVAT 285

Query: 301 XXXXXXXXXXXXYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLL 360
                       Y LIFL Y R +R VT+VPF +G Y IVCG+Y +DI+Y+  GVTQ L+
Sbjct: 286 GFFFWAVGFWVGYSLIFLDYPRRVRTVTLVPFLIGSYYIVCGVYHLDIIYAVCGVTQTLI 345

Query: 361 ----HRHKNAGNDEGDASSDTDHVPMILAVFGGRRRLTRIEHPFTRQXXXXXXXXXXXXV 416
               +     G D+   S+    VP      GGR+RLT++ HPF               V
Sbjct: 346 SPRRYEEPELGLDQKQNSA--TKVPFFFTFLGGRKRLTKVRHPFVLNIMRKRALWCLFLV 403

Query: 417 VGATAAFTVIFSCVPGRRV 435
           +  TA  TVIF+ VP  R+
Sbjct: 404 IVTTAVLTVIFTAVPSVRL 422

>Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar to
          Ashbya gossypii AFR532W
          Length = 453

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 40/65 (61%), Positives = 53/65 (81%)

Query: 17 IQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNYIELV 76
           Q ERLPTLYEVL  +T+ PVD W+FYTFL Q+P A+NY+DFWVD+M H RLCK+Y+  +
Sbjct: 8  FQSERLPTLYEVLTNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLCKDYVRGI 67

Query: 77 RKSLI 81
          R+S++
Sbjct: 68 RESML 72

>Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR249W
           (REAL)
          Length = 1044

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 100 LLNALIEEGHLDPEA-PDKLLENSGPDVPFSPKLNELLGDWKHQSGIGQEALRNEDVALI 158
           +L+ + E G    EA  DKL+E    D   S  ++ L G WK +  + +  LRN D+ L+
Sbjct: 508 VLDFVFESGVGTKEAIKDKLIEFGFTDEMISMPISALSGGWKMKLALARAVLRNADI-LL 566

Query: 159 VDE 161
           +DE
Sbjct: 567 LDE 569

>KLLA0F26455g Chr6 (2450871..2453462) [2592 bp, 863 aa] {ON} similar
           to uniprot|P36016 Saccharomyces cerevisiae YKL073W LHS1
           Molecular chaperone of the endoplasmic reticulum lumen
           involved in polypeptide translocation and folding member
           of the Hsp70 family localizes to the lumen of the ER
           regulated by the unfolded protein response pathway
          Length = 863

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 128 FSPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKP 173
           FS +    L D  + +GIGQ  L N+ +A+ +D   K++S   GKP
Sbjct: 176 FSQEQRAALLDATYLAGIGQTYLCNDAIAVAIDYASKQKSFPAGKP 221

>TBLA0J01040 Chr10 (238108..240345) [2238 bp, 745 aa] {ON} Anc_1.170
           YJL168C
          Length = 745

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 182 HSAVGLCNTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDI-EIFDDLKNLTYQFLE 240
           H+ + L  T L+        L+N+P  TRN II S  ++R  DI E   +L N+  Q +E
Sbjct: 366 HNEINLIETVLI-------ILNNLPKTTRNGIINSNLVDRINDIEEKIPELSNICNQLIE 418

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,694,615
Number of extensions: 1788681
Number of successful extensions: 5383
Number of sequences better than 10.0: 36
Number of HSP's gapped: 5478
Number of HSP's successfully gapped: 39
Length of query: 435
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 322
Effective length of database: 40,524,141
Effective search space: 13048773402
Effective search space used: 13048773402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)