Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR177C (MPC54)6.69ON46446423750.0
Skud_15.3446.69ON46546518870.0
Suva_8.2336.69ON46546518830.0
Smik_15.3626.69ON46546518600.0
TPHA0K011506.69ON3243001061e-04
Kpol_1008.29singletonON538150880.029
ZYRO0E04708gsingletonON611136880.038
SAKL0A08206g6.69ON645165800.31
Smik_10.233na 1ON224145741.2
NDAI0G035308.125ON539111741.8
KLLA0E18041g2.658ON8553671.9
YER157W (COG3)8.210ON801144723.0
YJL037W (IRC18)na 2ON224100703.4
Skud_5.2958.210ON799142714.1
SAKL0C13134g3.30ON333148695.2
KLLA0D03058g4.291ON1401140698.0
Smik_12.4914.269ON35245688.3
KLLA0E02377g5.443ON122032689.0
NOTE: 5 genes in the same pillar as YOR177C were not hit in these BLAST results
LIST: KLTH0G15334g AGR274C Kwal_56.23256 TDEL0G04560 Ecym_3119

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR177C
         (464 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...   919   0.0  
Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {...   731   0.0  
Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON...   729   0.0  
Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {...   721   0.0  
TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.6...    45   1e-04
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    39   0.029
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    39   0.038
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    35   0.31 
Smik_10.233 Chr10 (373211..373885) [675 bp, 224 aa] {ON} YJL037W...    33   1.2  
NDAI0G03530 Chr7 (849660..851279) [1620 bp, 539 aa] {ON} Anc_8.125     33   1.8  
KLLA0E18041g Chr5 complement(1607729..1607980,1608097..1608102) ...    30   1.9  
YER157W Chr5 (484788..487193) [2406 bp, 801 aa] {ON}  COG3Essent...    32   3.0  
YJL037W Chr10 (376662..377336) [675 bp, 224 aa] {ON}  IRC18Putat...    32   3.4  
Skud_5.295 Chr5 (475738..478137) [2400 bp, 799 aa] {ON} YER157W ...    32   4.1  
SAKL0C13134g Chr3 (1164301..1165302) [1002 bp, 333 aa] {ON} simi...    31   5.2  
KLLA0D03058g Chr4 (257433..261638) [4206 bp, 1401 aa] {ON} simil...    31   8.0  
Smik_12.491 Chr12 (868562..869620) [1059 bp, 352 aa] {ON} YLR405...    31   8.3  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    31   9.0  

>YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON}
           MPC54Component of the meiotic outer plaque, a
           membrane-organizing center which is assembled on the
           cytoplasmic face of the spindle pole body during meiosis
           II and triggers the formation of the prospore membrane;
           potential Cdc28p substrate
          Length = 464

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/464 (97%), Positives = 452/464 (97%)

Query: 1   MPEDTSYSNSFEDYYNNSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEINK 60
           MPEDTSYSNSFEDYYNNSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEINK
Sbjct: 1   MPEDTSYSNSFEDYYNNSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEINK 60

Query: 61  NNTVKRXXXXXXXXXXXXNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRCY 120
           NNTVKR            NKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRCY
Sbjct: 61  NNTVKRSIPSSISTTITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRCY 120

Query: 121 ALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKEL 180
           ALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKEL
Sbjct: 121 ALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKEL 180

Query: 181 NEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQLL 240
           NEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQLL
Sbjct: 181 NEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQLL 240

Query: 241 EEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMND 300
           EEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMND
Sbjct: 241 EEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMND 300

Query: 301 NLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLER 360
           NLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLER
Sbjct: 301 NLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLER 360

Query: 361 SLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALDN 420
           SLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALDN
Sbjct: 361 SLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALDN 420

Query: 421 VLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464
           VLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN
Sbjct: 421 VLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464

>Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/465 (76%), Positives = 405/465 (87%), Gaps = 1/465 (0%)

Query: 1   MPEDTSYSNSFEDYYNN-SHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 59
           MPED SY+  FE++ NN SH ISP+KDS++K+MTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 60  KNNTVKRXXXXXXXXXXXXNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRC 119
           KN++++R            NKSSLKSP+    S   FD E + E++++T KEVNDAVNRC
Sbjct: 61  KNSSIRRGIPPSININNTPNKSSLKSPKSNNLSDCGFDYERRFETRDDTFKEVNDAVNRC 120

Query: 120 YALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 179
           YALCNIPTKH+SI+SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 121 YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180

Query: 180 LNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQL 239
           LNEKSLQMAIDHLLKVTKQN RQ D  +KL+ETE LKSFI+EIEEV+DNKISINSL+QQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240

Query: 240 LEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMN 299
           LEEKTANNILRRDYYKLQERG+RLCHEFQ+LQDDYSK+MKQKEYEVQKLKNE+K L NMN
Sbjct: 241 LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300

Query: 300 DNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLE 359
            NLKA+K  +SQKEKQY QKY YIEKYM+HVK+EYN+KEDEC +L F++DK+MKKI+HLE
Sbjct: 301 TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360

Query: 360 RSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALD 419
           RSLQ Q  AQNSFS   +Q+E  KDAHL+DRYHKVKEFMEQKLQTSK NDPSCSEAEALD
Sbjct: 361 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420

Query: 420 NVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464
           NVL LIE++MKTL+ NSK Y   TKKC+KYVT S RLKENEH+TN
Sbjct: 421 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465

>Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/465 (78%), Positives = 402/465 (86%), Gaps = 1/465 (0%)

Query: 1   MPEDTSYSNSF-EDYYNNSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 59
           MPED  YS+S+ E+  +N + +SPYKDSF+KE+TPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 60  KNNTVKRXXXXXXXXXXXXNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRC 119
           K++ +K+            NKSSLKSPR    SK  FD   +LES +ET K+VNDAVNRC
Sbjct: 61  KSSYIKKSIPLSTNTNSTPNKSSLKSPRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120

Query: 120 YALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 179
           YALCNIPTKHVSI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE
Sbjct: 121 YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 180 LNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQL 239
           LNEKSLQMAIDHLLKVTKQNLRQADD NKLKETE LKSF EEIEEVDDNKISIN+L+QQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240

Query: 240 LEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMN 299
           LEEK ANNILRRDYYKLQERGRRLCHEFQ+LQ+DY++Q+K KEYE+QKLKNEIK LLNMN
Sbjct: 241 LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300

Query: 300 DNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLE 359
           +NLKA+K  +SQ EKQYFQKYTYIEKYM HVKEEYN+KEDEC KL FIID ++KKI+HLE
Sbjct: 301 NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360

Query: 360 RSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALD 419
           R+LQ+Q   QNSFSTA IQEE P DAHL+DRY KVKEFMEQKLQTSKI+DP  SE EALD
Sbjct: 361 RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420

Query: 420 NVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464
           NVL LIE++MKTLD+NSK  P  TKKCIKYV  S RLKENEH+TN
Sbjct: 421 NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465

>Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/465 (80%), Positives = 407/465 (87%), Gaps = 1/465 (0%)

Query: 1   MPEDTSYSNSFEDYYN-NSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 59
           MP+D +YS+SFE++ N N+ A+SPYKD F+KEMTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 60  KNNTVKRXXXXXXXXXXXXNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRC 119
           KN+++KR            NKSSLKSP+ K+ SK+ F+   K E++ ET K+VNDAVNRC
Sbjct: 61  KNSSIKRTFQTSTSTTTTPNKSSLKSPKSKKTSKDIFNYGNKSETREETFKDVNDAVNRC 120

Query: 120 YALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 179
           YALCNIPTKH+SI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE
Sbjct: 121 YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 180 LNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQL 239
           LNEKSLQMAIDHLLKVTKQNLRQADD NKLK+TE LKSFIEEIEEVDDNKISINSL+QQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240

Query: 240 LEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMN 299
            EEKTANNILRRDYYKLQERGRRLCH+FQ+LQDDYSKQMKQKEYEVQKLKNEIK LL MN
Sbjct: 241 FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300

Query: 300 DNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLE 359
           DNLKA++   SQKEKQYFQK TYIEKYMNHVKEEYNRKE+EC KL +IIDKSMK+IEHLE
Sbjct: 301 DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360

Query: 360 RSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALD 419
           RSLQ+Q T QNSFSTA I EEG KD  L+DRYHKVKEFMEQKLQTSKI+D SCSE EALD
Sbjct: 361 RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420

Query: 420 NVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464
           NVL LIE++MK LDKN+K  P   KKCIKYVT S R  ENEH+TN
Sbjct: 421 NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465

>TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.69
           YOR177C
          Length = 324

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 138/300 (46%), Gaps = 52/300 (17%)

Query: 39  VRFGDDDVNIFDQRKKVNEINKNNTVKRXXXXXXXXXXXXNKSSLKSPRGKRASKNSFDN 98
           V+FG ++V +FD R+ ++  NKN                 N+ +LK P  K   K S DN
Sbjct: 50  VQFGKEEVKMFDSREDIS--NKN---------IQPFKTNSNRGALK-PIIKAVEKISMDN 97

Query: 99  ETKLESKNETLKEVNDAVNRCYALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAE 158
                  NE L EV + +  C++LC++  +  +  SIS   +    L + I         
Sbjct: 98  NV-----NEEL-EVKECLAACFSLCSVDEEKFTDLSIS---KKLRRLYISIG-------- 140

Query: 159 CERSKNAIDSLYYHEQLEKKELNEKSLQMAIDHL-LKVTKQNLRQADDGNKLKETEAL-- 215
              S   +  L+++    + E NE   Q++   L +K+ KQNL    D  K +  E L  
Sbjct: 141 ---SAFKVKELFFYWVRMRIE-NELQKQISDQELQIKLLKQNLTDITDSEKTRTLELLNF 196

Query: 216 -----KSFIEEIEEVDDNK---ISINSLQQQLLEEKTANNILRRDYYKLQERGRRLCHEF 267
                K+ +E+ E  D  K   +S+++L+++LL   T + I   + +K Q   ++L  E 
Sbjct: 197 QNKYNKTILEKTELEDKVKMLDVSVDTLKKELL--GTEDTISDLENFKEQCIIKKL--EV 252

Query: 268 QELQDDYSKQMKQKEYEVQKLKNEIKVLLNMNDNLKAEKAHYSQKEKQYFQKYTYIEKYM 327
            EL D   K++  K  E +K  NE K+ L+  D   AE      K+++   K+ +++KYM
Sbjct: 253 AEL-DTEVKRLNNKNMEWRKKSNEYKLDLSRRD---AEVKEAQMKQQELLIKFEHLKKYM 308

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 68/150 (45%), Gaps = 31/150 (20%)

Query: 37  PNVRFGDDDVNIFDQRKKVNEINKNNTVKRXXXXXXXXXXXXNKSSLKSPRGKRASKNSF 96
           P +RF  + + IFDQ K   E++K+   K             + SS KS   KR      
Sbjct: 72  PKIRFDCNRILIFDQDK---EVSKSGIQK---------ILTKSSSSQKSILKKRED---- 115

Query: 97  DNETKLESKNETLKEVNDAVNRCYALCNIPTKHVSINSISDLAQTFETLAVGITHETNRK 156
           D E KL  +++   E+   V R + LC +  KH  I  IS   +  E L+V IT+  N K
Sbjct: 116 DIEDKLYPQDD---EITQIVKRMFTLCGVNLKH--IEGIS-FKEQLERLSVSITNAFNTK 169

Query: 157 AECERSKNAIDSLYYHEQLEKKELNEKSLQ 186
             C +        Y  ++LE  +LN+K L+
Sbjct: 170 EMCSK--------YIKQKLE-SQLNDKILE 190

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 24/136 (17%)

Query: 29  YKEMTPSKPNVRFGDDDVNIFDQRKKVNEINKNNTVKRXXXXXXXXXXXXNKSSLKSPRG 88
           + ++   K NV+FGD ++ IF++ +++    K N+               +   L  P  
Sbjct: 68  FSKLQAPKGNVKFGDKEIVIFNEDERIGHSMKANS-------------SVDNVILPLPIL 114

Query: 89  KRASKNSFD-----NETKLESKNETLKEVNDAVNRCYALCNIPTKHVSINSISDLAQTFE 143
           K + K + D      + K+ ++ E L EV     RCY LCN+P      N   +  ++ +
Sbjct: 115 KISQKGASDIKYMEPDNKMATQQERLFEV---FRRCYTLCNLPMSQFDEN---NPFKSLK 168

Query: 144 TLAVGITHETNRKAEC 159
            L  GI      K EC
Sbjct: 169 KLCEGIKKSFKAKDEC 184

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 67/165 (40%), Gaps = 34/165 (20%)

Query: 8   SNSF-EDYYNNSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIF------------DQRKK 54
           SN F ED    + AI P       E+T   P +RFG++ V +F            +  +K
Sbjct: 116 SNPFLEDAI--ASAICPL------EVTNHTPKIRFGENSVKMFYSDSLIGNGLEENPPRK 167

Query: 55  VNEINKNNTVKRXXXXXXXXXXXXNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVND 114
            N   K+++VK             N   LKS     A +   D E  +  +N    E   
Sbjct: 168 PNGNLKHDSVK----SVLVEKNSDNACPLKSKDSDTADQ---DWEVNVPIENTVALE--- 217

Query: 115 AVNRCYALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAEC 159
           A+ RC+ LCN+P + +  +   DL  + + L+ GI      +  C
Sbjct: 218 AITRCFNLCNVPLEDLDED---DLVMSLQRLSFGIVSAFKTQEMC 259

>Smik_10.233 Chr10 (373211..373885) [675 bp, 224 aa] {ON} YJL037W
           (REAL)
          Length = 224

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 60/145 (41%), Gaps = 21/145 (14%)

Query: 255 KLQERGRRLCHEFQELQDDYSKQMKQKEYE--VQKLKNEIKVLLNMNDNLKAEKAHYSQK 312
           K+Q   R L  +F  L    +      E+E    KL N ++VL           A +SQ 
Sbjct: 2   KVQIIERILLFQFCLLTAVLAGNRAMLEFESTGTKLVNSLRVL-----------ATHSQN 50

Query: 313 EKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLERSLQTQFTAQNSF 372
                +K + IE+ +  VK+ Y+      K LN I++    K+  L R +Q +    N+F
Sbjct: 51  SVCADEKISGIERQIGEVKDMYSNHSLILKGLNSILN---NKVNILAREIQMETVGNNTF 107

Query: 373 STAMIQEEGPKDAHLKDRYHKVKEF 397
            T    E G     L DR  K+  F
Sbjct: 108 ET----ETGKVTKGL-DRAIKISPF 127

>NDAI0G03530 Chr7 (849660..851279) [1620 bp, 539 aa] {ON} Anc_8.125
          Length = 539

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 24/111 (21%)

Query: 189 IDHLLK---VTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKIS----INSLQQQLLE 241
           I +LLK   +T Q+L Q      LK+       I  I+E+ DN +S       L QQLL 
Sbjct: 378 ISYLLKTELLTNQSLSQ-----DLKQ-------ISSIKELTDNNLSDTQLFTILFQQLLT 425

Query: 242 EKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEI 292
             +   I   D  K  +R     H FQ   DDYS+ +   E  +  +  +I
Sbjct: 426 PGS--KISSLDLEKFYQR---KIHSFQNKLDDYSRVLSDIESAISGINGDI 471

>KLLA0E18041g Chr5 complement(1607729..1607980,1608097..1608102)
           [258 bp, 85 aa] {ON} weakly similar to YKL018c-a,
           Hypothetical ORF
          Length = 85

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 283 YEVQKLKNEIKVLLNMNDNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYN 335
           YE+  LKN IK  L+  + L  + A+ +++   YF+K T  +K+++H++ + N
Sbjct: 33  YEMSDLKNYIKRYLDWGEYLFDKLANMAERSA-YFRKQTPFDKFLDHMERKRN 84

>YER157W Chr5 (484788..487193) [2406 bp, 801 aa] {ON}  COG3Essential
           component of the conserved oligomeric Golgi complex
           (Cog1p through Cog8p), a cytosolic tethering complex
           that functions in protein trafficking to mediate fusion
           of transport vesicles to Golgi compartments
          Length = 801

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 66/144 (45%), Gaps = 23/144 (15%)

Query: 319 KYTYIEKYMNHVK---EEYNRKEDECKKLNFIIDKSMKKIEHLERS-------LQTQFTA 368
           KY Y   Y++ +    +EY    D+ +++N  +D S+KK   + +         +T +  
Sbjct: 79  KYLYYTTYLDQLNIKIDEYKVVLDQTRQVNDQLDSSIKKFRKISQDTGAFIEETKTIYEK 138

Query: 369 QNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALDNVLCLIESS 428
           Q+  S   + E  PK  H    Y +V + + ++L  +    P+  +  +   +L  I+ S
Sbjct: 139 QSKLSN--LTESIPKALH----YFEVLDPIMRRLNHA--TSPAIVKKSSFTTMLATIDES 190

Query: 429 MKTLDKNS-----KCYPIATKKCI 447
           ++ LD+NS       Y I  K+C+
Sbjct: 191 LRFLDENSDLKDAAAYRIKFKQCL 214

>YJL037W Chr10 (376662..377336) [675 bp, 224 aa] {ON}  IRC18Putative
           protein of unknown function; expression induced in
           respiratory-deficient cells and in carbon-limited
           chemostat cultures; similar to adjacent ORF, YJL038C;
           null mutant displays increased levels of spontaneous
           Rad52p foci
          Length = 224

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 14/100 (14%)

Query: 275 SKQMKQKEYEVQKLKNEIKVLLNMNDNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEY 334
           S+ + + E    KL N ++VL           A YSQ      +K + IE+ +  VK+ Y
Sbjct: 24  SRAVVEFESTGTKLVNSLRVL-----------AAYSQSSVCVDEKISGIERQIEEVKDMY 72

Query: 335 NRKEDECKKLNFIIDKSMKKIEHLERSLQTQFTAQNSFST 374
                  K LN I++    K+  L R +Q +    N+F T
Sbjct: 73  GNHSFILKGLNGILN---NKVNMLTREIQMETVGNNTFET 109

>Skud_5.295 Chr5 (475738..478137) [2400 bp, 799 aa] {ON} YER157W
           (REAL)
          Length = 799

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 68/142 (47%), Gaps = 19/142 (13%)

Query: 319 KYTYIEKYMNHVK---EEYNRKEDECKKLNFIIDKSMKKIEHLERSL-----QTQFTAQN 370
           KY+Y   Y++ +    +EY    D+ +++N  ++ S++K   + +       +T+   + 
Sbjct: 80  KYSYYNTYLDQLNTKIDEYKVVLDQTRQINDQLNGSIEKFHDISQDTKVFIDETKTIYEK 139

Query: 371 SFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALDNVLCLIESSMK 430
            +    + E  P+  H    Y +V + + ++L  +  N P+  +  +   +L  I+ S+K
Sbjct: 140 QYKLRNLTESIPRTLH----YFEVLDPIMRRLNHA--NSPAIVKKGSFATMLTTIDESLK 193

Query: 431 TLDKNSK-----CYPIATKKCI 447
            LD+NS+      Y I  K+C+
Sbjct: 194 FLDENSEFKDAGAYRIKFKQCL 215

>SAKL0C13134g Chr3 (1164301..1165302) [1002 bp, 333 aa] {ON} similar
           to uniprot|P32453 Saccharomyces cerevisiae YNL315C ATP11
           Molecular chaperone required for the assembly of alpha
           and beta subunits into the F1 sector of mitochondrial
           F1F0 ATP synthase
          Length = 333

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 66/148 (44%), Gaps = 30/148 (20%)

Query: 318 QKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLERSLQTQFTAQNSFSTAMI 377
           Q +  IE+  +H+KEE NRK+ E  K++      +K++E  E+ ++    +QN  + A  
Sbjct: 69  QGFNSIEELKDHLKEEINRKKKELSKID-----PLKELEDYEQRIK---MSQN--NAAAT 118

Query: 378 QEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEAL--------DNVLCLI--ES 427
           +   P D        K  +F    L+  KI D S  E E L        +N L  +   S
Sbjct: 119 KPRDPIDPKSPKVPFKTLDFF---LKVEKIKDLSKQEVEFLWRARWANKENTLSAVVPNS 175

Query: 428 SMKTLDKNSKCYPIATKKCIKYVTDSPR 455
             + L+KN+K  P+       +V   PR
Sbjct: 176 IFEKLNKNAKENPV-------FVLPLPR 196

>KLLA0D03058g Chr4 (257433..261638) [4206 bp, 1401 aa] {ON} similar
           to uniprot|Q06698 Saccharomyces cerevisiae YLR419W
           Hypothetical ORF
          Length = 1401

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 58/140 (41%), Gaps = 29/140 (20%)

Query: 208 KLKETEALKSFIEEIEEVDDNKI--SINSLQQQLLE--------------EKTANNILRR 251
           KL   E L  F+EE + + D  +   ++ LQQ L E              E T+NN+++ 
Sbjct: 483 KLTILEKLLHFLEESQLIGDMCVYHIVDWLQQNLSEIIENPGPLLTKERIEITSNNLIKS 542

Query: 252 DYYK--LQERGRRLC-HEFQELQDDYSKQMKQKEY----------EVQKLKNEIKVLLNM 298
              K     R  +L   E  EL+D+Y K+ K  E+             K++N I  L+N 
Sbjct: 543 TNKKRRFNARTSKLSNQEVSELEDEYRKRQKSNEFHTMREQRSKLPAWKIQNSIVELINS 602

Query: 299 NDNLKAEKAHYSQKEKQYFQ 318
           ND +       S K  Q  Q
Sbjct: 603 NDVVLITGETGSGKSTQVVQ 622

>Smik_12.491 Chr12 (868562..869620) [1059 bp, 352 aa] {ON} YLR405W
           (REAL)
          Length = 352

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 90  RASKNSFDNETKLESKNETLKEVNDAVNRCYALCNIPTKHVSINS 134
           RA K  + ++ ++E+K    +E+N+ VN C  LC      ++I+ 
Sbjct: 154 RAVKGKYGDKLRIETKIRIHEELNETVNLCRELCEAGVDWITIHG 198

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 15  YNNSHAISPYKDSFYKEMTPSKPNVRFGDDDV 46
           + NS  ++P K+  Y    PS   V FGDD V
Sbjct: 777 HTNSRCVTPTKELVYLAFAPSNVEVEFGDDTV 808

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,115,004
Number of extensions: 2512240
Number of successful extensions: 15343
Number of sequences better than 10.0: 1241
Number of HSP's gapped: 15259
Number of HSP's successfully gapped: 1820
Length of query: 464
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 351
Effective length of database: 40,524,141
Effective search space: 14223973491
Effective search space used: 14223973491
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)