Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR174W (MED4)6.65ON28425312541e-175
Smik_15.3526.65ON28826110361e-142
Suva_8.2276.65ON2872529901e-135
Skud_15.3366.65ON2862499861e-135
NCAS0F003306.65ON2811997253e-95
ZYRO0D14190g6.65ON2952057063e-92
Kpol_1042.116.65ON2922546639e-86
CAGL0L04620g6.65ON2642376601e-85
KNAG0M010206.65ON2791976541e-84
NDAI0J013206.65ON3342116322e-80
SAKL0A08426g6.65ON2991756022e-76
TBLA0G005506.65ON3181975937e-75
KAFR0G025006.65ON2892105908e-75
AGR270W6.65ON2941755742e-72
Kwal_56.232426.65ON2562345643e-71
KLTH0G15444g6.65ON2632205558e-70
TPHA0F025906.65ON3062435562e-69
Ecym_31246.65ON2742295167e-64
KLLA0F20185g6.65ON2851855055e-62
TDEL0G040606.65ON2201644971e-61
Skud_7.1686.150ON64883693.6
Kpol_1045.68.779ON47854675.6
Ecym_61794.129ON122686676.9
TPHA0H008402.56ON81553668.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR174W
         (284 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   487   e-175
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   403   e-142
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   385   e-135
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   384   e-135
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   283   3e-95
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   276   3e-92
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   259   9e-86
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   258   1e-85
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   256   1e-84
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   248   2e-80
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   236   2e-76
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   233   7e-75
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   231   8e-75
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   225   2e-72
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   221   3e-71
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   218   8e-70
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   218   2e-69
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   203   7e-64
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   199   5e-62
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   196   1e-61
Skud_7.168 Chr7 complement(308721..310667) [1947 bp, 648 aa] {ON...    31   3.6  
Kpol_1045.6 s1045 (8627..10063) [1437 bp, 478 aa] {ON} (8627..10...    30   5.6  
Ecym_6179 Chr6 complement(330143..333823) [3681 bp, 1226 aa] {ON...    30   6.9  
TPHA0H00840 Chr8 (170246..172693) [2448 bp, 815 aa] {ON} Anc_2.5...    30   8.8  

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  487 bits (1254), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 240/253 (94%), Positives = 240/253 (94%)

Query: 1   MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60
           MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV
Sbjct: 1   MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60

Query: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120
           DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE
Sbjct: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120

Query: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180
           CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF
Sbjct: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXXXXXXSQSEEQKGQMAKKEGTPKT 240
           IWPAEDALRRGMLAMASLHSKELTRIPG             SQSEEQKGQMAKKEGTPKT
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPPSQSEEQKGQMAKKEGTPKT 240

Query: 241 DSFIFDGTAKEVG 253
           DSFIFDGTAKEVG
Sbjct: 241 DSFIFDGTAKEVG 253

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  403 bits (1036), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 219/261 (83%), Gaps = 8/261 (3%)

Query: 1   MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60
           MSVQDTKAV+FSMGH++SSSVSLV EATSN NSEDKLSKVQLYEDLCRYEDTL KLVESV
Sbjct: 1   MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV 60

Query: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120
           DRFKP++D+A+DLI+ DE+LF NV LL+EYDNI RNL+KIDKDSEELDSKT++ILEI+NE
Sbjct: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120

Query: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180
           CHDEL ALPMLEQVEFEKNTILQQRSKINST LLDYATKLSKFT+IPPTFDKG++GPNNF
Sbjct: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXXXXXXSQSEEQKG----QMAKKEG 236
           IWPAEDALRRGMLAMASLHSKELTR+PG               S  Q G        KE 
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEEAEEAAETEEVLVSSPSQNGLDNEHKTAKEE 240

Query: 237 TPKTDSFIFDGTA----KEVG 253
            P TDSFIF+GTA    +EVG
Sbjct: 241 VPSTDSFIFNGTANKNSEEVG 261

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  385 bits (990), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 208/252 (82%), Gaps = 3/252 (1%)

Query: 1   MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60
           MSVQDTKAVEF M  IRSSSVSLVAEATS+ NSE K SKVQLYEDLCRYED L KLVESV
Sbjct: 1   MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV 60

Query: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120
           DRFKPNL+IAKDLI+TDE+LF NVKLLA+YD I  NL+KIDKDSEELDSKTRKILEILNE
Sbjct: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120

Query: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180
           CHDEL ALPMLEQVEFEK TILQQRSKINST LLDYATKLSKFT+IPPTFDKG VGPNNF
Sbjct: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXX---XXXXXXSQSEEQKGQMAKKEGT 237
           IWPAEDALRRGMLAMASLHSKELTRIPG                 Q E+++      + +
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQNS 240

Query: 238 PKTDSFIFDGTA 249
           P  DSFIF+G A
Sbjct: 241 PTKDSFIFNGIA 252

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  384 bits (986), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 210/249 (84%), Gaps = 1/249 (0%)

Query: 1   MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60
           MSVQ+TKAVEF MGHI+SSSVSLVAEA SN NSEDKLSKVQLYEDLCRYE  LSKLVESV
Sbjct: 1   MSVQNTKAVEFPMGHIKSSSVSLVAEAASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESV 60

Query: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120
           DRFKP+LD+A+DLI  DE+LF NVKLLA+YDNI RNLQKIDKDSEELDSK+RKILEILNE
Sbjct: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120

Query: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180
           CHDEL  LP LEQVEFEKNTILQQRSKINST LLDYATKLSKFTKIPPTFDKG VGPNNF
Sbjct: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXXXXXX-SQSEEQKGQMAKKEGTPK 239
           IWPAEDALRRGMLAMASLHSKELTR+PG              SQ  +Q+ Q A+ E    
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQNEDISD 240

Query: 240 TDSFIFDGT 248
            D+FIF GT
Sbjct: 241 KDTFIFKGT 249

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  283 bits (725), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 135/199 (67%), Positives = 164/199 (82%), Gaps = 2/199 (1%)

Query: 12  SMGHIRSSSVSLVAEATSNT--NSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDI 69
           SMGHIRSSSVSL+AE   N+  N ED +SKVQ+Y DLC YE  L+ LV SVD+FKP+++ 
Sbjct: 14  SMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNA 73

Query: 70  AKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALP 129
           A++LI  D  LF+ +    EYD I  +L+K++ +S ELD++T++IL ILNECHDEL ALP
Sbjct: 74  ARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALP 133

Query: 130 MLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALR 189
           ML+QVEFE  TILQQRSKINS+ LLDYATKLSKFTKIPPTFDKG++GPNNFIWPAEDALR
Sbjct: 134 MLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALR 193

Query: 190 RGMLAMASLHSKELTRIPG 208
           RGMLA+ASLH+ ELT+ PG
Sbjct: 194 RGMLALASLHADELTKAPG 212

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  276 bits (706), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 169/205 (82%), Gaps = 1/205 (0%)

Query: 5   DTKAVEFSMGHIRSSSVSLVAEA-TSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRF 63
           DT A   S GH+RSSS SL+++A +S  N++D+LSKVQ+Y DL +YE+ L+ LVESVD F
Sbjct: 10  DTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNF 69

Query: 64  KPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHD 123
           KP++ I  +LI  D++L++++   AEYD I   L ++DK+S ELD KT+++LE L+EC++
Sbjct: 70  KPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYE 129

Query: 124 ELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWP 183
            L  LPMLEQVEFEK +IL+QRSK+NS+ LL+YATKLSKFTKIPPTFDKG +GPNNF+WP
Sbjct: 130 MLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWP 189

Query: 184 AEDALRRGMLAMASLHSKELTRIPG 208
           AEDALRRGMLA+ASLHSKE+TRIPG
Sbjct: 190 AEDALRRGMLAIASLHSKEMTRIPG 214

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  259 bits (663), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 136/254 (53%), Positives = 175/254 (68%), Gaps = 16/254 (6%)

Query: 13  MGHIRS-SSVSLVAEATSN-----------TNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60
           MGH++S SSVSL+ + T++            N  + LSKVQ+Y D+  YE+TL KLVESV
Sbjct: 6   MGHVKSISSVSLMTDNTNSISTNSLNMIDYNNESNDLSKVQIYNDISEYENTLFKLVESV 65

Query: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120
           D+FKP++ +A  LI  DE LF+++    EYD I   L++ DK++ ELD+KT++IL  LNE
Sbjct: 66  DKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLNE 125

Query: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180
           CH  L +LPMLEQVEFEK+ IL+QRSKINS  LLDYATKLSKFTKIPPTF+KG++GPNNF
Sbjct: 126 CHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNNF 185

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXX----XXXXXXXSQSEEQKGQMAKKEG 236
           IWPAEDALRRGMLAMASLHSKELT++P                  ++  E++      EG
Sbjct: 186 IWPAEDALRRGMLAMASLHSKELTKLPNEPEEASEPDKSTEPDKSTEPIEEEKITVDNEG 245

Query: 237 TPKTDSFIFDGTAK 250
                S ++DG+ K
Sbjct: 246 DISMGSIVYDGSHK 259

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  258 bits (660), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 169/237 (71%), Gaps = 6/237 (2%)

Query: 21  VSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEAL 80
           +SLVAE+ S T SE +L KVQLY DLC YE+ L+KLV+SVD FKP L+I K LI  D+ L
Sbjct: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60

Query: 81  FENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNT 140
           +  + LL +YD+++  L+ +D +  ++D +T+ IL ILNECHD+L ALP+LE+VEFEK  
Sbjct: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120

Query: 141 ILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHS 200
           IL+QR KI S  LL+YATKL+KFTKIPPTFDKG +GPNNFIWPAEDALR+GMLAMASLH 
Sbjct: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180

Query: 201 KELTRIPGXXXXXXXXXXXXXSQ-----SEEQKGQMAKKEGTPKTDSFIFDGTAKEV 252
           KELT++PG              +     +E  +G++ +++   + DSF+F   A + 
Sbjct: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEI-RQDDKKEDDSFVFGANANDA 236

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  256 bits (654), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 152/197 (77%)

Query: 12  SMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAK 71
           S GH R+SSVSL+ E T      + L KV++Y  +  YEDTL+ LVESVD +KP++ +A+
Sbjct: 15  SAGHKRASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQ 74

Query: 72  DLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPML 131
            L+  D+ LF ++    EYD I   L ++   S  LD+KTR ILE LNECHDEL  LP L
Sbjct: 75  RLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYL 134

Query: 132 EQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRG 191
           EQV+FE +TIL+QR KINS+ELLDYATKLSKFT+IPPTFDKG++GPNNFIWPAEDALR+G
Sbjct: 135 EQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKG 194

Query: 192 MLAMASLHSKELTRIPG 208
           MLA+A+LHS+ELTRIPG
Sbjct: 195 MLAIAALHSRELTRIPG 211

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  248 bits (632), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 160/211 (75%), Gaps = 14/211 (6%)

Query: 12  SMGHIRSSSVSLVAEATSNT--------------NSEDKLSKVQLYEDLCRYEDTLSKLV 57
           S  H+R+SSVSL+AEA +N               +S+D LS+V++Y+D+  YE  LS+L+
Sbjct: 37  SANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLI 96

Query: 58  ESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEI 117
           +SVD+FKPNL+IA++LI+ D++LF+ +    +YD I  +L+ ++  + ++D  T+  L+ 
Sbjct: 97  DSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQT 156

Query: 118 LNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGP 177
           LNECHD+L  LP L Q+EFE NTIL QR+KINST LLDYATKLSKFTKIPPTFDKG++GP
Sbjct: 157 LNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGP 216

Query: 178 NNFIWPAEDALRRGMLAMASLHSKELTRIPG 208
           NNFIWPAED+LRRGMLAMASL + +LT IPG
Sbjct: 217 NNFIWPAEDSLRRGMLAMASLKADQLTYIPG 247

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  236 bits (602), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 110/175 (62%), Positives = 141/175 (80%)

Query: 34  EDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNI 93
           +D LS+V++Y D+C YE+TL KLV SVD+FKP+L +A++LI TD+ LF+ ++   +YD I
Sbjct: 41  QDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKI 100

Query: 94  YRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTEL 153
              L  ++K S+E+D KT KILE+LN CH +L +LP LEQV  E++T+L+QR KI S  L
Sbjct: 101 DGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVL 160

Query: 154 LDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208
           LDYA KL+KFT++PPTFDKG VGPNNFIWPAEDA+RRGMLAMASL SKELTRIPG
Sbjct: 161 LDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  233 bits (593), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 114/197 (57%), Positives = 147/197 (74%), Gaps = 2/197 (1%)

Query: 14  GHIR--SSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAK 71
           GH +  S+S+S       N +  D+LSK+Q Y DL +YE+TLSKL  SVD++KP+L  A 
Sbjct: 12  GHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAY 71

Query: 72  DLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPML 131
           DLI  D  L+  +    +YD I   L+K++ D++ LD KT+ +L+ LN+CH+ L  LPML
Sbjct: 72  DLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPML 131

Query: 132 EQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRG 191
           EQVEFEKNT+L+QR KINS  LLDYATKL+KFTKIPPTF+K  +GPNNFIWPAEDALRRG
Sbjct: 132 EQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRG 191

Query: 192 MLAMASLHSKELTRIPG 208
           MLA+AS H++ELT +PG
Sbjct: 192 MLAVASAHTEELTALPG 208

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  231 bits (590), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 113/210 (53%), Positives = 155/210 (73%), Gaps = 11/210 (5%)

Query: 10  EFSMGHIRSSSVSLVAE--ATSNTNSED---------KLSKVQLYEDLCRYEDTLSKLVE 58
           + ++GH +SSS+SL+ E  +TS TNS +          ++KV +Y DL +YE+TLS+L++
Sbjct: 3   DLTLGHRKSSSLSLLGEPPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQ 62

Query: 59  SVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEIL 118
           S+D +KP+  IA++LI  D  LF ++    +YD I   L+  +K  +E   KT++ILE L
Sbjct: 63  SIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETL 122

Query: 119 NECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPN 178
           NECH+ L  LP ++QV FE NT+L+QR KINS+ LLDYATKLSKFTKIPPTFDKG++GPN
Sbjct: 123 NECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPN 182

Query: 179 NFIWPAEDALRRGMLAMASLHSKELTRIPG 208
           NF+WPAEDALRRGMLA+A+ H+ ELT+I G
Sbjct: 183 NFVWPAEDALRRGMLALAASHTDELTKIAG 212

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  225 bits (574), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 101/175 (57%), Positives = 143/175 (81%)

Query: 34  EDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNI 93
           ++KL  V +YEDLC+YE++L +LV SVD+F+P+L+ A++LI  D  L+ N+  L +YD I
Sbjct: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103

Query: 94  YRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTEL 153
              L+K++++S+++D +T KIL IL EC+++L +LPM+EQVEFE  T+ +Q+ K+NS+ L
Sbjct: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163

Query: 154 LDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208
           L+YA KLSKFT++PPTF+K A+GPNNFIWPAEDA+RRGMLAMASL SKELT +PG
Sbjct: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG 218

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  221 bits (564), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 151/234 (64%), Gaps = 3/234 (1%)

Query: 16  IRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIR 75
           + +SSV    E    TN+E +LSK Q+Y D+C +E+TL KLV SVD+F P+L IA+ LI 
Sbjct: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60

Query: 76  TDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVE 135
            D+ L + ++ L  YD I    +++D+   E D +  +ILE L EC  +L ALPMLEQVE
Sbjct: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120

Query: 136 FEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAM 195
           FE+ T+L+QR K+ +  LLDYA KL+KFT +PPTFDKGAVGPNNF+WPAEDA+RRGMLA+
Sbjct: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180

Query: 196 ASLHSKELTRIPGXXXXXXXXXXXXXSQSEEQKGQMAKKEGTPKTDSFIFDGTA 249
           ASL + E  + P               QS     Q+  +E   + DSF F+GT 
Sbjct: 181 ASLQASEDAKKPETGAAQTAEETTKQPQS---SPQLKVEEPMQRRDSFEFNGTG 231

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  218 bits (555), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 148/220 (67%), Gaps = 4/220 (1%)

Query: 34  EDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNI 93
           E+ LSK+Q+Y D+C +EDTL KLV SVDRF P+L++A+ LI  D+ L+++++ L +YD I
Sbjct: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78

Query: 94  YRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTEL 153
               + +D++  + D KT +ILE L EC  +L ALPMLEQVEFE+ T+L+QR K+ +  L
Sbjct: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138

Query: 154 LDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPGXXXXX 213
           LDYA KL+KFT +PPTFDKG VGPNNF+WPAEDA+RRGMLA+ASL + E           
Sbjct: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASEGANAQEQQASS 198

Query: 214 XXXXXXXXSQSEEQKGQM----AKKEGTPKTDSFIFDGTA 249
                   S++EE +  +     K+E   +  SF FDG+ 
Sbjct: 199 EQKTSEKSSENEEAQTDIRSPDTKEEPVARRPSFGFDGSG 238

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  218 bits (556), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 162/243 (66%), Gaps = 18/243 (7%)

Query: 18  SSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTD 77
           ++++S    +  NT + D L+ V +Y D+  YEDTL KLV S+D F+P++++AK LI  D
Sbjct: 38  ANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVD 97

Query: 78  EALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFE 137
           + L++N+    EYD I   + KI  DSE+LD +T+ IL+ILN+  + L +LPMLE++ FE
Sbjct: 98  KRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFE 157

Query: 138 KNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMAS 197
           ++ + +++ KINS  LLDYATK+SKFTKIPPTF+KG++GPNNFIWPAEDALRRGMLA+AS
Sbjct: 158 RDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVAS 217

Query: 198 LHSKELTRIPGXXXXXXXXXXXXXSQSEEQKGQMAKKEGTPKT----------DSFIFDG 247
           +H  ELT++P              S  E ++ Q  ++ GT  T          +SF+FDG
Sbjct: 218 IHRSELTKLPN--------DTSYDSDKELEEQQEQEQHGTENTREADVEQEQEESFVFDG 269

Query: 248 TAK 250
             K
Sbjct: 270 KHK 272

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  203 bits (516), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 112/229 (48%), Positives = 154/229 (67%), Gaps = 7/229 (3%)

Query: 29  SNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLA 88
           SN +  + + +V LY+DLC++E+ L KLV SVD+F P+L  A+DLI +D  L+  ++ L 
Sbjct: 14  SNNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLP 73

Query: 89  EYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKI 148
            YD+I   L+++D +S+E+D +T KIL IL++C++ L  LPM+EQVEFE   + +Q+ KI
Sbjct: 74  LYDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKI 133

Query: 149 NSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208
            S  LL+YA KL+KFT++PPTF+K A+GPNNFIWPAEDA+RRGMLAMASL S+ELTRIP 
Sbjct: 134 KSGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPV 193

Query: 209 XXXXXXXXXXXXXSQS-EEQKGQMAKKEGTP------KTDSFIFDGTAK 250
                         QS EE +        TP      K++SF F G AK
Sbjct: 194 ELNSEEPQEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKAK 242

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  199 bits (505), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 94/185 (50%), Positives = 133/185 (71%)

Query: 19  SSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDE 78
           +++   A+  +     ++L  V +Y+DL RYE+T+ +L +SVD FKP+L +   +I  D+
Sbjct: 14  ATLPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDK 73

Query: 79  ALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEK 138
            L+E ++   EY  I   L ++DK+ + +D+KTR+ILE LN C++ L  LPMLEQVEFE+
Sbjct: 74  KLYETLEEFDEYYKIEEELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQ 133

Query: 139 NTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASL 198
             +L+QR KI+S  +LDYA KL+KFT+ PPTFDK  +GPNNFIWPAED+LR+GMLAMASL
Sbjct: 134 KVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASL 193

Query: 199 HSKEL 203
             KEL
Sbjct: 194 KKKEL 198

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  196 bits (497), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 90/164 (54%), Positives = 124/164 (75%), Gaps = 3/164 (1%)

Query: 41  QLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKI 100
           Q+Y DL RYE+ L +LVESVD+F+P+L  A++L+  D AL +++     YD + + LQ++
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 101 DKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKL 160
           D++SE L+  T + LE L+EC+  L ALPMLEQV+FE+  +L+QR ++NS  LL+YATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 161 SKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELT 204
           SKFTK P      AVGPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>Skud_7.168 Chr7 complement(308721..310667) [1947 bp, 648 aa] {ON}
           YGL107C (REAL)
          Length = 648

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%)

Query: 27  ATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKL 86
           AT NT + + L  ++  +   ++ED +   ++ + R+ P     K + R      E+  +
Sbjct: 558 ATDNTKTPEALEPLKEDDSTSKFEDRIELYLKVLKRYTPYFRAPKQVFRYTAGCAESYPI 617

Query: 87  LAEYDNIYRNLQKIDKDSEELDS 109
           L EY   Y NL   D    +L S
Sbjct: 618 LNEYLGSYSNLSVEDIPVPQLHS 640

>Kpol_1045.6 s1045 (8627..10063) [1437 bp, 478 aa] {ON}
           (8627..10063) [1437 nt, 479 aa]
          Length = 478

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query: 33  SEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKL 86
           S ++L K++L++DL RYEDT  +     D  KP   I KD+   D     N K 
Sbjct: 111 SLEELKKIKLFDDLARYEDTYKE-----DDIKP---ILKDITEKDVESLSNAKF 156

>Ecym_6179 Chr6 complement(330143..333823) [3681 bp, 1226 aa] {ON}
           similar to Ashbya gossypii AFR002C
          Length = 1226

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 18/86 (20%)

Query: 63  FKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQ------KIDKDSEELDSKTRKILE 116
           + PN +I + ++   ++ FE+V       ++Y++L       K+  +S+EL   ++ ILE
Sbjct: 793 YMPN-NIGEFIVYLKDSKFEHVLF-----SVYKSLPLPAEYLKLRLESDELRDSSKSILE 846

Query: 117 ILNECHDELKALPMLEQVEFEKNTIL 142
           IL EC      L +LE   FE+  +L
Sbjct: 847 ILKEC------LKLLENKPFERERVL 866

>TPHA0H00840 Chr8 (170246..172693) [2448 bp, 815 aa] {ON} Anc_2.56
           YDL220C
          Length = 815

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 108 DSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKL 160
           ++K  ++  IL  C DE  +   L   +F KNT++QQ+  I+   L+DY  K+
Sbjct: 409 ETKYFQLYCILLACSDESHSFLKLTVTDFTKNTMIQQKYLIDKF-LIDYNNKI 460

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,741,872
Number of extensions: 1048540
Number of successful extensions: 4795
Number of sequences better than 10.0: 260
Number of HSP's gapped: 5008
Number of HSP's successfully gapped: 276
Length of query: 284
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 176
Effective length of database: 41,097,471
Effective search space: 7233154896
Effective search space used: 7233154896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)