Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR141C (ARP8)5.477ON88188142290.0
Smik_15.3205.477ON87388238540.0
Skud_15.3045.477ON88388637470.0
Suva_8.1925.477ON87988137400.0
TDEL0A034105.477ON83776225060.0
ZYRO0D11308g5.477ON86876224700.0
NCAS0H022905.477ON86375822430.0
TBLA0A025305.477ON85476122230.0
Kpol_543.105.477ON87675822110.0
KAFR0E025305.477ON84278922050.0
CAGL0I07161g5.477ON83776921340.0
TPHA0J027905.477ON88276320280.0
SAKL0G03608g5.477ON79477620090.0
KNAG0B040205.477ON93479920030.0
Kwal_55.212505.477ON77576119060.0
NDAI0C013705.477ON97466519240.0
AFR135W5.477ON79176418990.0
Ecym_23115.477ON77575918700.0
KLTH0F14960g5.477ON77576318660.0
KLLA0E03213g5.477ON78879316590.0
KNAG0K01130na 1ON3931281030.001
NCAS0B071302.117ON3811291030.001
NCAS0A147207.448ON485911010.002
Ecym_52373.161ON3911131000.002
Kwal_33.141773.161ON33787980.003
KLTH0F06490g3.161ON39187990.003
TDEL0D046103.161ON39194990.004
Kpol_479.253.161ON39187980.004
SAKL0C07370g3.161ON39187980.004
Skud_4.2223.161ON39187980.004
YDL029W (ARP2)3.161ON39187980.004
Smik_4.2063.161ON39187980.004
ZYRO0B04928g3.161ON39187970.005
Suva_4.2203.161ON39187970.005
NDAI0A013007.448ON56587980.005
CAGL0K01595g3.161ON39187970.005
TBLA0F008703.161ON39187970.006
Ecym_23062.593ON40784970.006
TPHA0A009203.161ON39187970.006
KAFR0C01040na 1ON33787960.006
NDAI0G029003.161ON39187960.007
Kpol_181.22.593ON46372950.010
ADR316W3.161ON39187950.010
TPHA0N014302.593ON472104950.011
TDEL0C031207.448ON43869940.013
KLLA0C03850g3.161ON39187930.016
Kpol_520.117.448ON488143930.020
ZYRO0F01122g2.593ON46292920.021
Ecym_63301.287ON480321920.027
TBLA0H028002.593ON48479910.031
AFR105C1.287ON479329900.041
NDAI0B044602.117ON381129880.069
KNAG0H036502.117ON38781860.10
NDAI0G030408.23ON37549850.17
ZYRO0F02772g8.23ON37549850.17
Skud_6.318.23ON36049840.17
TDEL0C004708.23ON37549840.17
CAGL0K12694g8.23ON37549840.17
Suva_6.188.23ON37549840.17
Smik_6.398.23ON37549840.17
YFL039C (ACT1)8.23ON37549840.17
SAKL0B00968g8.23ON37549840.17
Kpol_1058.158.23ON37549840.17
KNAG0L002508.23ON37549840.17
KAFR0D009408.23ON37549840.17
TPHA0D002508.23ON37549840.17
NCAS0C037008.23ON37549840.17
ABR222W8.23ON37649840.17
TBLA0C004408.23ON37549840.18
Smik_6.1404.196ON927149850.18
Ecym_15208.23ON37649840.19
TDEL0B048102.117ON373226830.23
TBLA0B010702.117ON383105830.26
ABR084W2.593ON46478830.29
ACR184C7.448ON40182820.38
Suva_13.2022.593ON467149820.40
KLTH0G18832g8.23ON37549810.40
KLLA0D05357g8.23ON37549810.40
Kwal_14.11098.23ON36049810.41
Skud_8.1902.117ON38471810.45
NDAI0C005802.593ON50195810.49
Suva_15.3262.117ON38481810.50
Smik_8.2102.117ON38471800.54
YDL206W8.458ON762154810.59
KAFR0I002507.21ON777102810.60
CAGL0K05335g7.448ON52969800.62
TDEL0B068602.593ON46181790.78
KAFR0F005902.117ON386138790.85
KLTH0D08624g2.593ON43281790.94
YHR129C (ARP1)2.117ON38471781.00
SAKL0B11220g2.593ON46690781.1
KAFR0K021507.448ON49091771.4
TDEL0D015501.287ON480320771.5
Skud_4.2603.192ON22553751.8
CAGL0H09042g2.117ON387104762.1
KLTH0C05324g7.448ON39978762.1
TPHA0L011808.458ON67697762.2
TBLA0E001503.574ON265117742.7
SAKL0F13772g7.448ON42282743.1
Suva_16.3647.448ON48077743.1
TBLA0C049203.522ON1390152753.2
Ecym_35058.251ON305112733.4
ZYRO0G17182g7.448ON46593733.9
YPR034W (ARP7)7.448ON47769734.0
CAGL0M03201g1.287ON49352734.3
TBLA0F004507.448ON482124734.7
Skud_13.1892.593ON46796725.6
YMR033W (ARP9)2.593ON467171725.9
Kwal_27.105527.448ON35182716.9
Ecym_63852.117ON377136709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR141C
         (881 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...  1633   0.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...  1489   0.0  
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...  1447   0.0  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...  1445   0.0  
TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {O...   969   0.0  
ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...   956   0.0  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...   868   0.0  
TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.4...   860   0.0  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...   856   0.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...   853   0.0  
CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...   826   0.0  
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...   785   0.0  
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...   778   0.0  
KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...   776   0.0  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...   738   0.0  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...   745   0.0  
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...   736   0.0  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...   724   0.0  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...   723   0.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...   643   0.0  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    44   0.001
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    44   0.001
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    44   0.002
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    43   0.002
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    42   0.003
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    43   0.003
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    43   0.004
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    42   0.004
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    42   0.004
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    42   0.004
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    42   0.004
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    42   0.004
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    42   0.005
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    42   0.005
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    42   0.005
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    42   0.005
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    42   0.006
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    42   0.006
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    42   0.006
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    42   0.006
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    42   0.007
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    41   0.010
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    41   0.010
TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2....    41   0.011
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    41   0.013
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    40   0.016
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    40   0.020
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    40   0.021
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    40   0.027
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    40   0.031
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    39   0.041
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    39   0.069
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    38   0.10 
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    37   0.17 
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    37   0.17 
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    37   0.17 
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    37   0.17 
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    37   0.17 
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    37   0.17 
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    37   0.17 
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    37   0.17 
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    37   0.17 
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    37   0.17 
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    37   0.17 
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    37   0.17 
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    37   0.17 
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    37   0.17 
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    37   0.17 
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    37   0.18 
Smik_6.140 Chr6 (227599..230382) [2784 bp, 927 aa] {ON} YGR056W ...    37   0.18 
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    37   0.19 
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    37   0.23 
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    37   0.26 
ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {...    37   0.29 
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    36   0.38 
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    36   0.40 
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    36   0.40 
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    36   0.40 
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    36   0.41 
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    36   0.45 
NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {O...    36   0.49 
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    36   0.50 
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    35   0.54 
YDL206W Chr4 (90176..92464) [2289 bp, 762 aa] {ON} Putative prot...    36   0.59 
KAFR0I00250 Chr9 complement(53495..55828) [2334 bp, 777 aa] {ON}...    36   0.60 
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    35   0.62 
TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 4...    35   0.78 
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    35   0.85 
KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} simila...    35   0.94 
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    35   1.00 
SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 ...    35   1.1  
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    34   1.4  
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    34   1.5  
Skud_4.260 Chr4 (453509..454183) [675 bp, 225 aa] {ON} YDR007W (...    33   1.8  
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    34   2.1  
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    34   2.1  
TPHA0L01180 Chr12 complement(244127..246157) [2031 bp, 676 aa] {...    34   2.2  
TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574 ...    33   2.7  
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    33   3.1  
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    33   3.1  
TBLA0C04920 Chr3 (1195902..1200074) [4173 bp, 1390 aa] {ON} Anc_...    33   3.2  
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    33   3.4  
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    33   3.9  
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    33   4.0  
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    33   4.3  
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    33   4.7  
Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 ...    32   5.6  
YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa] ...    32   5.9  
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    32   6.9  
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    32   9.6  

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score = 1633 bits (4229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 808/881 (91%), Positives = 808/881 (91%)

Query: 1   MSQEEAESSIIYXXXXXXXXXXXXXXXXXXXXNSVPLSSQADQENAENESDDSVDNVVGS 60
           MSQEEAESSIIY                    NSVPLSSQADQENAENESDDSVDNVVGS
Sbjct: 1   MSQEEAESSIIYEEPIDIPLEDDDDEDELEEENSVPLSSQADQENAENESDDSVDNVVGS 60

Query: 61  ETPRSVTGLSVDPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGSSR 120
           ETPRSVTGLSVDPR                                         LGSSR
Sbjct: 61  ETPRSVTGLSVDPRDVADEEDEDEEGEDEDEDEDDNDVDNEDENDNDNANENENELGSSR 120

Query: 121 DKRAPPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE 180
           DKRAPPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE
Sbjct: 121 DKRAPPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE 180

Query: 181 KVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDV 240
           KVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLR            PDV
Sbjct: 181 KVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTSQISSTNTPDV 240

Query: 241 IDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKK 300
           IDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKK
Sbjct: 241 IDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKK 300

Query: 301 WLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENS 360
           WLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENS
Sbjct: 301 WLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENS 360

Query: 361 KPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAE 420
           KPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAE
Sbjct: 361 KPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAE 420

Query: 421 LISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVA 480
           LISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVA
Sbjct: 421 LISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVA 480

Query: 481 IIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALF 540
           IIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALF
Sbjct: 481 IIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALF 540

Query: 541 LLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKL 600
           LLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKL
Sbjct: 541 LLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKL 600

Query: 601 FDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGN 660
           FDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGN
Sbjct: 601 FDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGN 660

Query: 661 LYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADV 720
           LYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADV
Sbjct: 661 LYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADV 720

Query: 721 TRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGH 780
           TRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGH
Sbjct: 721 TRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGH 780

Query: 781 YVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPAL 840
           YVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPAL
Sbjct: 781 YVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPAL 840

Query: 841 IIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           IIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY
Sbjct: 841 IIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score = 1489 bits (3854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 732/882 (82%), Positives = 778/882 (88%), Gaps = 10/882 (1%)

Query: 1   MSQEEAESSIIYXXXXXX-XXXXXXXXXXXXXXNSVPLSSQADQENAENESDDSVDNVVG 59
           MSQEEAESSI+Y                     N+VPLSSQADQE  +N+SDDSV+N +G
Sbjct: 1   MSQEEAESSIVYEEPIDIPLDDDDDGDEMEEEENNVPLSSQADQEVEDNDSDDSVNNEIG 60

Query: 60  SETPRSVTGLSVDPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGSS 119
           SETPRSVTGLS DPR                                            S
Sbjct: 61  SETPRSVTGLSADPRDVAEEEEEEDEEGEEEEEDEEEEDNDDENENELE---------DS 111

Query: 120 RDKRAPPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGI 179
           RDKRA P  QTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGI
Sbjct: 112 RDKRAQPTAQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGI 171

Query: 180 EKVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPD 239
           EKVE TTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLR            PD
Sbjct: 172 EKVEATTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPD 231

Query: 240 VIDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPK 299
           VIDLK+LPHSEA+ A LN+EIDLND TATIVIHPGSNS+KIGFPKD+HPV+VPNCVAVPK
Sbjct: 232 VIDLKNLPHSEANTASLNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPNCVAVPK 291

Query: 300 KWLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNEN 359
           KWL+LE+SE+ E   LQREQSE+F++IKS+MEKNFRERMRYYKRKVPGNAHEQV+SFNEN
Sbjct: 292 KWLNLESSENDEIFSLQREQSEKFHSIKSDMEKNFRERMRYYKRKVPGNAHEQVISFNEN 351

Query: 360 SKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLA 419
           SKPEIISEKNDPSPI+WIFDDSKLYYGSDALRCVDEKF+IRKPF+GGSFN+ SPYYKSLA
Sbjct: 352 SKPEIISEKNDPSPIKWIFDDSKLYYGSDALRCVDEKFIIRKPFKGGSFNINSPYYKSLA 411

Query: 420 ELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAV 479
           ELISDVTKLLE+AL SETLNVKP KFNQYKVVLVIPDIFKKSH+ETFIRVLLTELQFQAV
Sbjct: 412 ELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFIRVLLTELQFQAV 471

Query: 480 AIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFAL 539
           AIIQESLATCYGAGISTSTCVVNIGA+ETRIACVDEGTVLEHSAITLDYGGDDITRLF L
Sbjct: 472 AIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLDYGGDDITRLFGL 531

Query: 540 FLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFK 599
           FLLQSDFPLQDWKI+S+HGWLLAE+LKKNFTTFQDADVAVQLYNF+NRSPNQPTEKYEFK
Sbjct: 532 FLLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADVAVQLYNFINRSPNQPTEKYEFK 591

Query: 600 LFDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEG 659
           LFDEVMLAPLALFFPQIFKLIRTSS KNSSLEFQLPESRDLFTNELNDWNSLSQFESKEG
Sbjct: 592 LFDEVMLAPLALFFPQIFKLIRTSSDKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEG 651

Query: 660 NLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITAD 719
           NLYC+L+DDL+IL +IL AHN+IDQLQDKPENYGN  KENFAPLEKAI+QSIANASITAD
Sbjct: 652 NLYCNLDDDLEILKKILQAHNMIDQLQDKPENYGNISKENFAPLEKAIIQSIANASITAD 711

Query: 720 VTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEG 779
           VTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE 
Sbjct: 712 VTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLES 771

Query: 780 HYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPA 839
           H+VNAPDKTE+ENK +LQ QIKEK+VEEL+EQHQNIE+QNGNEH+FP+SIIPPPRDMNPA
Sbjct: 772 HFVNAPDKTEEENKLVLQRQIKEKVVEELDEQHQNIENQNGNEHVFPISIIPPPRDMNPA 831

Query: 840 LIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           LIIWKGASVLAQIKLVEELFITN+DWDVHGSRILQYKCIFTY
Sbjct: 832 LIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 873

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score = 1447 bits (3747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/886 (80%), Positives = 773/886 (87%), Gaps = 8/886 (0%)

Query: 1   MSQEEAESSIIYXX-----XXXXXXXXXXXXXXXXXXNSVPLSSQADQENAENESDDSVD 55
           MSQEEAESS++Y                         N+VPLSSQADQ+N  ++S D+  
Sbjct: 1   MSQEEAESSVVYEEPIDIPLEDDDDDDDDEDEMEEEENNVPLSSQADQDNDSDDSADNG- 59

Query: 56  NVVGSETPRSVTGLSVDPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 115
             +GSETP SV GLS DPR                                         
Sbjct: 60  --IGSETPGSVMGLSADPRDVAEEEDDEEEGEDEEEEEEDNDDDEENDNDNADGNDNENE 117

Query: 116 LGSSRDKRAPPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLK 175
           LGSS+ +R  P VQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLK
Sbjct: 118 LGSSKSERGEPGVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLK 177

Query: 176 KIGIEKVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXX 235
           KIGIEKVE TTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLR          
Sbjct: 178 KIGIEKVEATTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSST 237

Query: 236 XXPDVIDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCV 295
             PDV+DLK+L H+E S APLNDEIDLNDPTATIVIHPGSNSIKIGFPKD+HP++VPNCV
Sbjct: 238 NTPDVVDLKNLSHTEPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIIVPNCV 297

Query: 296 AVPKKWLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVS 355
           AVPKKWL+L N  + +N+ LQREQS+EF NIKSEMEKNFRERMRYYKRKVPGNAHEQVVS
Sbjct: 298 AVPKKWLNLGNGPNEDNISLQREQSDEFENIKSEMEKNFRERMRYYKRKVPGNAHEQVVS 357

Query: 356 FNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYY 415
           FNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFV+RKPF+GGSFN+ SPYY
Sbjct: 358 FNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVVRKPFQGGSFNINSPYY 417

Query: 416 KSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQ 475
           +SLAELISDVTKLLE+AL SETLNVK TKFNQYKVVLVIPD+FKK+HVETFIRVLLTELQ
Sbjct: 418 ESLAELISDVTKLLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFIRVLLTELQ 477

Query: 476 FQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITR 535
           FQAVA+IQESLATCYGAGISTSTCVVNIGA ETRIACVDEGTVLEHSA+TL+YGGDDITR
Sbjct: 478 FQAVAVIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLNYGGDDITR 537

Query: 536 LFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEK 595
           LFAL LLQSDFPLQDWKID+KHGWLLAE+LKKNFTTFQDAD+AVQLYNF+NRSPNQP+EK
Sbjct: 538 LFALLLLQSDFPLQDWKIDTKHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNQPSEK 597

Query: 596 YEFKLFDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFE 655
           YEFKLFDEVMLAPLALFFPQIFKLIR+SS KNS+LEFQLPESRDLFTNELNDWNSLSQFE
Sbjct: 598 YEFKLFDEVMLAPLALFFPQIFKLIRSSSGKNSNLEFQLPESRDLFTNELNDWNSLSQFE 657

Query: 656 SKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANAS 715
           SKEG+LY +LNDDLKILN+IL+AH IIDQ+QDKPENYG+T KENFAPLEKAI+QSIANAS
Sbjct: 658 SKEGDLYSNLNDDLKILNKILEAHTIIDQIQDKPENYGDTSKENFAPLEKAIIQSIANAS 717

Query: 716 ITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIK 775
           ITADVTRMNSFYSNILIVGG+SKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIK
Sbjct: 718 ITADVTRMNSFYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIK 777

Query: 776 DLEGHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRD 835
           DLE H+VNAPDKTE+ENKQ++Q+QIK+K+V EL+EQHQNIE+QNGNEH+FPVSIIPPPRD
Sbjct: 778 DLESHFVNAPDKTEEENKQVMQSQIKDKVVAELDEQHQNIENQNGNEHLFPVSIIPPPRD 837

Query: 836 MNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           MNPALIIWKGASVLAQIKLVEELFITN+DWDVHGSRILQYKCIFTY
Sbjct: 838 MNPALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 883

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score = 1445 bits (3740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/881 (81%), Positives = 767/881 (87%), Gaps = 2/881 (0%)

Query: 1   MSQEEAESSIIYXXXXXXXXXXXXXXXXXXXXNSVPLSSQADQENAENESDDSVDNVVGS 60
           MSQEEAESS++Y                    N+V LSSQADQEN +N+SDDSVDN VGS
Sbjct: 1   MSQEEAESSVVYEEPIDIPLEDDDEDEMEEEENNVRLSSQADQENGDNDSDDSVDNGVGS 60

Query: 61  ETPRSVTGLSVDPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGSSR 120
           ETPRSVTGLS DPR                                             +
Sbjct: 61  ETPRSVTGLSADPRDAAEEEEEEEEEEEEEEDDNDGDNDNDNDNDDDNDNDNDGE--GLK 118

Query: 121 DKRAPPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE 180
           DKRA P  QTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE
Sbjct: 119 DKRAQPTAQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE 178

Query: 181 KVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDV 240
           KVE TTLPATGLFQPL+LINQKNYSSDYLKKDDQIFALRDRKFLR            PDV
Sbjct: 179 KVEATTLPATGLFQPLLLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDV 238

Query: 241 IDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKK 300
           +D+KSLP+SE S APLNDEIDLNDPTATIVIHPGSNSIKIGFPKD+HP+VVPNCVAVPKK
Sbjct: 239 VDMKSLPNSEPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPNCVAVPKK 298

Query: 301 WLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENS 360
           WL+L N ++  N+ LQR+QSEEF +IKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNE+S
Sbjct: 299 WLNLANDQNEGNISLQRKQSEEFESIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNESS 358

Query: 361 KPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAE 420
           KPE++S KNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF+GG FN+ SPYYKSLAE
Sbjct: 359 KPEVVSVKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFKGGCFNIDSPYYKSLAE 418

Query: 421 LISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVA 480
           LISDV KLLE+AL+SETLNVKPTKFNQYKVVLVIPD+FKKSHVETFIRVLLTELQFQAVA
Sbjct: 419 LISDVIKLLEYALDSETLNVKPTKFNQYKVVLVIPDVFKKSHVETFIRVLLTELQFQAVA 478

Query: 481 IIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALF 540
           IIQESLATCYGAGISTSTCVVNIGA ETRIACVDEGTVLE+SA+TLDYGGDDITRLFAL 
Sbjct: 479 IIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLENSAVTLDYGGDDITRLFALL 538

Query: 541 LLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKL 600
           LLQSDFPLQDWKI+S+HGWLLAE+LKKNFTTFQDAD+AVQLYNF+NRSPN+PTEKYEFKL
Sbjct: 539 LLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNKPTEKYEFKL 598

Query: 601 FDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGN 660
           FDEVMLAPLALFFPQIFKLIR  S KNSSLEFQLPESRDLFTNELNDWNSLSQFESKEG+
Sbjct: 599 FDEVMLAPLALFFPQIFKLIRAPSGKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGD 658

Query: 661 LYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADV 720
           LYC+LNDDLKILN+ LDAH +IDQLQDKPE YG+T KEN  PLEKAI+QSI NAS+TADV
Sbjct: 659 LYCNLNDDLKILNKTLDAHTMIDQLQDKPEKYGSTSKENLTPLEKAIIQSITNASVTADV 718

Query: 721 TRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGH 780
           TRM+SFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSS SFPQFYKKLTKEIKDLE H
Sbjct: 719 TRMSSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYKKLTKEIKDLESH 778

Query: 781 YVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPAL 840
           +V+AP+KTE+ENKQ+LQ QI EK+V EL+EQHQ+IEHQNGNEH+FP+SIIPPPRDMNPAL
Sbjct: 779 FVSAPEKTEEENKQVLQLQINEKVVAELDEQHQSIEHQNGNEHLFPISIIPPPRDMNPAL 838

Query: 841 IIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           IIWKGASVLAQIKLVEELFITN+DWDVHGSRILQYKCIFTY
Sbjct: 839 IIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 879

>TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {ON}
           Anc_5.477 YOR141C
          Length = 837

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/762 (62%), Positives = 596/762 (78%), Gaps = 21/762 (2%)

Query: 128 VQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTL 187
            ++ +R KK+P+LDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEK+E+TTL
Sbjct: 89  AKSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTL 148

Query: 188 PATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKS-- 245
           PATGLFQP++LINQKNYSSDYLKKD+QIFALR+RK LR            PDVID+K+  
Sbjct: 149 PATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNT-PDVIDIKNTN 207

Query: 246 --LPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLD 303
             +P   A+A   +++IDL+D   T+VIHPGS  ++IGF KD+ P+VVP+CVA+PK  L+
Sbjct: 208 TEVPDYIAAA---DEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELN 264

Query: 304 LENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPE 363
            E  E      L+REQ EEF  +KS ++ +FRERMRYYKRKVP NAHEQVVS+N+NSKP+
Sbjct: 265 DEFQE----APLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQ 320

Query: 364 IISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAELI 422
           +I ++NDP  I WI   SK YYGS+AL+C  E F IR PF +GGSFNV SP Y SL +LI
Sbjct: 321 MIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLI 380

Query: 423 SDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAII 482
           +DV  LLEHAL++E LN++  +F+QYKVVLVIPD+F KSHVETFIR LLTE+QFQAVAII
Sbjct: 381 NDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAII 440

Query: 483 QESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLL 542
           QESLA CYGAG S+STCVVNIGA  T IAC+DEGTVLE+S ++LDYGGDD+T+LFALFLL
Sbjct: 441 QESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLL 500

Query: 543 QSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFD 602
           QS+FP QDW I+S HGW+LAE LKK +TTFQDA+VAVQLYNF+ R P+Q +E+YEFK+FD
Sbjct: 501 QSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFD 560

Query: 603 EVMLAPLALFFPQIFKLIRTSSHK---NSSLEFQLPESRDLFTNELNDWNSLSQFESKEG 659
           EV LAPLALF+P+I   + + S +   NS++E QLP SRD+FTN +NDW SLSQ E  +G
Sbjct: 561 EVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDG 620

Query: 660 NLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITAD 719
           +LY   N++  I++++LD     D  Q KP    ++ ++N+ PLEKAI+QSI NAS   D
Sbjct: 621 DLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADS-RKNYTPLEKAIIQSITNASTPID 679

Query: 720 VTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEG 779
           V +M+SFYSNIL+VGG SKIPALDFILTDRINIWRP LLS  SFP FYKKL K+ KD++ 
Sbjct: 680 VAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKT 739

Query: 780 HYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPA 839
                  + ED++ +    +I E I  EL+    +IE QNG+EH+ PV+++PPPRDM+ A
Sbjct: 740 AGKTGESEEEDQSSK----KINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAA 795

Query: 840 LIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
            + WKGA VLAQIKLVEEL++T++DWD+HGSRILQYKC+FTY
Sbjct: 796 ELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/762 (61%), Positives = 585/762 (76%), Gaps = 20/762 (2%)

Query: 133 RYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGL 192
           ++KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFA+ LKKIGIEKVET TLP TGL
Sbjct: 114 KFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGL 173

Query: 193 FQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLK--SLPHSE 250
           FQP++LINQKNYSSDYLKKD+Q+FALRDRK LR            PDV DLK  +   +E
Sbjct: 174 FQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANT-PDVADLKRENGNTTE 232

Query: 251 ASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENS--- 307
            + A  +++IDL+D   T+VIHPGSNS+K+GF KD+ P V+P+CVA+PK   +L N    
Sbjct: 233 LNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKS--ELHNQIPM 290

Query: 308 EHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISE 367
           +     C  R+Q  EF  IK+EM+ +FRERMR+YKRKV  NAHEQV++FN+ SKPE+I +
Sbjct: 291 DQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIED 350

Query: 368 KNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAELISDVT 426
           KND + I WI    + YYG+DALRC  + FVIR P  +GGSFN+ SP Y+SL +L+ D T
Sbjct: 351 KNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFT 410

Query: 427 KLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESL 486
            LLEH L S    +K ++F QYKVVLVIPD+F+KSHVET IR L+TE+QFQAVAI+QESL
Sbjct: 411 GLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESL 470

Query: 487 ATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDF 546
           ATCYGAGISTSTCVVNIGA +TRIACVDEGTVL+ S ITLDYG DDIT+LFALFLLQS+F
Sbjct: 471 ATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEF 530

Query: 547 PLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFDEVML 606
           P QDW I++ HGW LAE LKKN+TTFQDA+V VQLYNF+ R P Q  EK++FK+FDEV+L
Sbjct: 531 PYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVIL 590

Query: 607 APLALFFPQIFKLIRTS---SHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYC 663
           APL+LF+P I   +R       +N  LE +LP SRD+FT+ L+DW SLSQ E  +  LYC
Sbjct: 591 APLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYC 650

Query: 664 DLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADVTRM 723
              D+ ++L ++LDA + +D+LQ +       +++N+APLEKAIVQSI NA ++ DV++M
Sbjct: 651 GNQDEFQMLCKLLDAPSRLDELQAE-NRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKM 709

Query: 724 NSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHYVN 783
           +SFYSNIL+ GG S +PA DFILTDRINIWRP +LS  SFP  YKKL+K+IKD++    N
Sbjct: 710 SSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKN 769

Query: 784 APDKT----EDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPA 839
              K+    EDE    L+ +++E I +ELE  H+ IE QN  +H  PVS++PPPRD++PA
Sbjct: 770 GEGKSNGPQEDEQ---LKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPA 826

Query: 840 LIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           ++IWKGASVLAQIKLVEEL++T +DWD+HGSRILQYKCIFTY
Sbjct: 827 ILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/758 (56%), Positives = 558/758 (73%), Gaps = 19/758 (2%)

Query: 135 KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQ 194
           KK  K++P K P GKKVPLHLLEKRRLGRIKAA+EFAK LK+IGIEKVE+  +P TG+FQ
Sbjct: 114 KKVQKVEPNKVPLGKKVPLHLLEKRRLGRIKAAKEFAKKLKEIGIEKVESVPVPMTGMFQ 173

Query: 195 PLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKSLPHSE--AS 252
           PL+LINQKNYSSDYL+KD+QIFALR+RK LR            P+V DL+S+  +    +
Sbjct: 174 PLLLINQKNYSSDYLRKDEQIFALRERKTLRSNTTQNISSSNTPEVTDLQSVRETSNFTT 233

Query: 253 AAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENSEHVEN 312
           A   NDEI LNDP  TIVIHPGS+ +K+GF  D+ P ++PNCVA+PK   +  N    + 
Sbjct: 234 ANGNNDEILLNDPNTTIVIHPGSSFLKVGFALDEVPELIPNCVALPKTDFNNTNIIKSKQ 293

Query: 313 VCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISEKNDPS 372
             +  E +E+F ++K+EME++F ERMRYYKR++  N H+QVVSFN  SKPE +  +NDP+
Sbjct: 294 TSVNIEDNEKFESLKAEMEESFEERMRYYKRRIQPNGHDQVVSFNRLSKPESLPVQNDPA 353

Query: 373 PIEWIFDDSKLYYGSDALRCVDEKFVIRKPFR-GGSFNVKSPYYKSLAELISDVTKLLEH 431
            I+WI D +K +YG DALRC DE F+ R PF+ GGSFN  S  YKSL +L+SDV  L+E 
Sbjct: 354 HIDWITDGTKRFYGDDALRCTDENFIKRYPFKKGGSFNTSSNSYKSLQDLLSDVVGLIEG 413

Query: 432 ALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYG 491
            L+S+  N+K ++F+QYKVVLVIPD F+KSHVE FIR+L+TELQFQAVAIIQESL+ CYG
Sbjct: 414 TLSSDKFNIKSSQFSQYKVVLVIPDSFEKSHVELFIRLLVTELQFQAVAIIQESLSVCYG 473

Query: 492 AGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDFPLQDW 551
           +G+  STCVVN+G+ ET +ACVDEG VL++S ITLDYG +D+T+LFA FLL  DFP ++W
Sbjct: 474 SGLGGSTCVVNVGSKETTVACVDEGIVLDNSLITLDYGSNDVTKLFAKFLLDCDFPYKNW 533

Query: 552 KIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPT-EKYEFKLFDEVMLAPLA 610
            ++S  GW LAE L K   TFQDAD+ VQL NF+ R+P   T EK +FK+F+EVMLAPLA
Sbjct: 534 DLNSTEGWRLAEELMKQCVTFQDADITVQLSNFIKRTPRGNTVEKLDFKVFEEVMLAPLA 593

Query: 611 LFFPQIFKLIRT--SSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYCDLNDD 668
           LF+P+IFKL+R+  S  +N+ LE+QLP SRD+FT+++NDW SLSQ +      +CD++D+
Sbjct: 594 LFYPEIFKLLRSKESEEQNAELEYQLPPSRDIFTDKINDWRSLSQNDCINHQTFCDIHDE 653

Query: 669 LKILNRILDAHNIIDQLQDK-PENYGNTLKENFAPLEKAIVQSIANASITADVTRMNSFY 727
            ++L + +D  N ++   D  PE   +T   NF PL+KAIV+SI  AS+  DV++M +FY
Sbjct: 654 YELLKKAVDCPNTLETFMDNPPEEKKSTF--NFTPLDKAIVESITTASLGLDVSKMATFY 711

Query: 728 SNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHYVNAPDK 787
           SNIL+VGG SKIP  D +L DR+NIWRP LLS  +F  FY++LTK++K+L+        K
Sbjct: 712 SNILVVGGGSKIPGFDLMLMDRVNIWRPRLLSLRAFTHFYRELTKQLKELQSL------K 765

Query: 788 TEDENKQILQAQIKEKIVE----ELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALIIW 843
           T D  ++I + ++ EKI E    EL +  + IE Q+GNEH  PV +IP P +++P  I W
Sbjct: 766 TGDGEEEIKEDELNEKISELIKTELTKYLEVIEQQSGNEHFLPVEVIPSPNEIDPGSIAW 825

Query: 844 KGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           KGASVLAQIKLVEELFITN DWDVHG+RILQYK I TY
Sbjct: 826 KGASVLAQIKLVEELFITNGDWDVHGNRILQYKSILTY 863

>TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.477
           YOR141C
          Length = 854

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/761 (55%), Positives = 563/761 (73%), Gaps = 15/761 (1%)

Query: 126 PAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETT 185
           P   T    KK PK+D +K    KK  LHLLEKRRLGR+KAAEEFAK LK+ GIEK+ET 
Sbjct: 104 PLADTKIPSKKNPKIDSSK---NKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETL 160

Query: 186 TLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKS 245
           T+  TGLFQP MLINQKNYSSDYLKKD QIFA+R+RK +R            PD  + + 
Sbjct: 161 TVNPTGLFQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRG 220

Query: 246 LPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLE 305
               EA+ A  +++I+L DP+ TIVIHPGS  +KIG+ +D +P+++P+CVAVPK      
Sbjct: 221 ----EANQAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDT 276

Query: 306 NSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEII 365
            SE  +N    ++QSE+F+  K+E+ K+F+ERMR+YKRKV  N HEQV+SFN+NSKPE +
Sbjct: 277 VSELNDNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDV 336

Query: 366 SEKNDPSPI-EWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAELIS 423
           +EKND   +  WI D  K Y+GSDA+RC  E F+IR PF  GGSFN+++PYY++L+EL+S
Sbjct: 337 TEKNDIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLS 396

Query: 424 DVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQ 483
           +V + L H L S+T  +K + F+ YK+VLVI DIF+KSH+E   R+LL E+QF AVAIIQ
Sbjct: 397 EVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQ 456

Query: 484 ESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQ 543
           ESLATCYGAG+ +STCVVN+GA +TRIACVDEG+++E S ++LDYGGDDIT+LF++ LLQ
Sbjct: 457 ESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQ 516

Query: 544 SDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFDE 603
           S FP  D  I++ H W+LAE+LKK+F TF DA+V VQLYNF+ R P Q  +KYEF+ F+E
Sbjct: 517 SGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEE 576

Query: 604 VMLAPLALFFPQIFKLIRT---SSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGN 660
           VMLAPL+LF+PQ+ KL+++   + +KN  ++ QLP SRD+FT+ELNDW S++Q +    N
Sbjct: 577 VMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKN 636

Query: 661 LYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADV 720
           LY + +D++ +L R L+ H  +++++D+ +        N+  LEKAI+QSIANAS + D+
Sbjct: 637 LYSETSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKAIIQSIANASASLDI 696

Query: 721 TRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGH 780
           +++NSFYSNIL+VGG +KIP+LDFIL DRI IWRP LLS  SFP FYKKLTK IK+L  +
Sbjct: 697 SKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNY 756

Query: 781 YVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPAL 840
                +KT +E + + +A I E I  E E     +E Q  N+  FPVSI+P PR+M+PA 
Sbjct: 757 --GKTNKTSEEEESLKKA-IDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAE 813

Query: 841 IIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           +IWKGASVLAQIKLVEELF+T +DWD+HGSRILQ+KCIFTY
Sbjct: 814 LIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/758 (55%), Positives = 561/758 (74%), Gaps = 29/758 (3%)

Query: 141 DPAKAPPG----KKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPL 196
           D   A P     KKVP HLLEKRRLGR+KAAE FA  LKK GIE+V+ + L  TGLF  +
Sbjct: 131 DSGNATPSTTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIERVDNSHLQQTGLFGQM 190

Query: 197 MLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKSLPHSEASAAPL 256
           +L+NQKN SSDYLKKDDQ+FALR+RK LR            PDV+DLK+L  +  S+A L
Sbjct: 191 LLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANT-PDVVDLKAL--NNGSSASL 247

Query: 257 --------NDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENSE 308
                   +D+ID NDPT TIVIHPGS  +KIGF KD+ P+VVP+CVA+PK  L    SE
Sbjct: 248 VDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSL---YSE 304

Query: 309 HVENVCLQR-EQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISE 367
           +V  + + + E SE    +K++++++FRERMRYYKRK+  N+HE+V +FNE +KPEI+ +
Sbjct: 305 NVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVED 364

Query: 368 KNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAELISDVT 426
           KND   IEWI +  K+Y+G +A RC  E F+IR PF +GGS N+ SPYY SL EL+SDVT
Sbjct: 365 KNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYSSLPELLSDVT 424

Query: 427 KLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESL 486
           +L E+AL     ++   +  Q KV+LVIPD+F+KSH+ET  R+LL E+QFQAVAI+QESL
Sbjct: 425 RLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESL 484

Query: 487 ATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDF 546
           A CYGAGIST++C+VNIGA +T IACVDEGTVLE+S I LDYGGDDITRLF LFLL+++F
Sbjct: 485 AACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNF 544

Query: 547 PLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFDEVML 606
           P QD  +DS HGW LAE+LKKN+ TF+DA++ VQLYNF+ R P + +EKYEFK+FDEV+L
Sbjct: 545 PFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVIL 604

Query: 607 APLALFFPQIFKLIRTSSHKNS-SLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYCDL 665
           APLALF+P IF+ ++    KN  +LE QLP SRDL+T+ +NDW S+SQ +  +G+LY   
Sbjct: 605 APLALFYPDIFQELKKLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGN 664

Query: 666 NDDLKILNRILDAHNIIDQLQ--DKPENYGNTLKENFAPLEKAIVQSIANASITADVTRM 723
            ++L I+ ++L+ ++  ++ +  +  E  G   +EN+ PLEKAI+QSI NA ++ DV++M
Sbjct: 665 TNELDIITKVLNINSSTEEYEGLETTEVDG---RENYVPLEKAIIQSITNACVSMDVSKM 721

Query: 724 NSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHYVN 783
           N FY+NI++VGG+S IP LDF+LTDRINIWRP  L + +FP F+K ++K++K+++    +
Sbjct: 722 NQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQS--TS 779

Query: 784 APDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALIIW 843
               T +E ++I Q+ IKE I  EL +   +IE Q   +H +PV+++PPPRDMNP ++ W
Sbjct: 780 KASTTPEEEEKIKQS-IKELIETELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNW 838

Query: 844 KGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           KGASVLAQIKL+EELF+TN+DWD+ GSRILQYKC+FTY
Sbjct: 839 KGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/789 (55%), Positives = 554/789 (70%), Gaps = 49/789 (6%)

Query: 127 AVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTT 186
           +V+T K   K  +L   K   G KVP HLLE+RR+GRIKAAE FAK LKKIGIEK+E  T
Sbjct: 69  SVKTVKIDGKDVQLSYGKTMAGTKVPKHLLERRRIGRIKAAEAFAKKLKKIGIEKIENIT 128

Query: 187 LPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPD-VIDLKS 245
           LP TGLFQPL LINQKNYSSDY++KDDQIFALR+RK LR            P  V+DLK+
Sbjct: 129 LPQTGLFQPLNLINQKNYSSDYIRKDDQIFALRERKTLRSSTNANNNNTSTPKAVVDLKT 188

Query: 246 LPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLE 305
                     ++DEIDLNDP +TI+I PGS ++KIGF  D+ P+++PN VA+PKK  D  
Sbjct: 189 --------GVMDDEIDLNDPNSTIIIQPGSETMKIGFALDETPLLIPNLVAIPKK--DDS 238

Query: 306 NSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEII 365
                E+  L  EQSEEF ++K+E+   F+ERMRYYKR++  N+HEQV SFN N++PE I
Sbjct: 239 KGPSTESK-LNTEQSEEFEDLKNELHSTFKERMRYYKRRIQPNSHEQVKSFNRNAQPETI 297

Query: 366 SEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF----RGGSFNVKSPYYKSLAEL 421
            + NDP+ I WI  + K+YYG+DAL C +  F  RKPF     G  FN+    Y S+ EL
Sbjct: 298 LDNNDPARIRWITQNDKVYYGNDALLCPESFFSHRKPFGTCRNGALFNLMGSSYSSVQEL 357

Query: 422 ISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAI 481
           + DV KL+E  LN + L  K    ++YK +LVIPD+F+KSHVE  IR+LLTEL F AVAI
Sbjct: 358 LGDVIKLIEFGLN-KLLEAKNK--DKYKAILVIPDLFEKSHVEEMIRLLLTELPFNAVAI 414

Query: 482 IQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFL 541
           IQESLATCYGAGISTSTCVVN+GA+ET ++C+DEG VLE+S I L+YGGDDITRLF++ L
Sbjct: 415 IQESLATCYGAGISTSTCVVNVGASETSVSCIDEGVVLENSLINLNYGGDDITRLFSVLL 474

Query: 542 LQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLF 601
             ++FP QDW ++S  GW +AE LKK   T QDADV VQL NFM R  N+PTEKYEFK F
Sbjct: 475 KMNNFPYQDWNVESIAGWNIAETLKKQIVTLQDADVTVQLSNFMKRVFNEPTEKYEFKTF 534

Query: 602 DEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNL 661
           DEVMLAPLALF P+IF  +R    KNS+L++QLPES+DLFT+ELNDW S++Q   K    
Sbjct: 535 DEVMLAPLALFAPRIFSYLRNEESKNSTLQYQLPESKDLFTHELNDWRSMTQEACKNNGS 594

Query: 662 YCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADVT 721
           YCD++D+L++L  +L+  + ++  Q +     +  K N  PL+KAI+QSI +A ++ D +
Sbjct: 595 YCDISDELQLLTALLEVDSKLEAFQSEATTTLDN-KRNMLPLDKAIIQSITDACLSLDPS 653

Query: 722 RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE--- 778
           +M+SFYSNIL+VGGSS IPA DF+LTDRINIWRP LLS +SFPQFYK L+KEIKDLE   
Sbjct: 654 KMDSFYSNILVVGGSSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDLEMES 713

Query: 779 ----------GHYV-----------NAPDKTE-----DENKQILQAQIKEKIVEELEEQH 812
                     G  V           NA +  E     +E  + L + I + I  +L++  
Sbjct: 714 QSTAKLQAQTGSVVPTTGSSTPLATNAGNDGETMADLNEVSKKLSSNINDLIKTKLQDYI 773

Query: 813 QNIEHQNGNEHIFPVSIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRI 872
            N+E QN NEH FPV ++PPPRDM+ A++ WKGASVLAQIKLVEELFITN DWD+HGSRI
Sbjct: 774 SNVESQNSNEHYFPVGVVPPPRDMSAAILSWKGASVLAQIKLVEELFITNLDWDMHGSRI 833

Query: 873 LQYKCIFTY 881
           LQ+KCIFTY
Sbjct: 834 LQHKCIFTY 842

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/769 (52%), Positives = 558/769 (72%), Gaps = 25/769 (3%)

Query: 132 KRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATG 191
           K+Y+KYP LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFA+ LK +GIE+VE   LP +G
Sbjct: 75  KKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSG 134

Query: 192 LFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDV----------- 240
           LF P+ LINQKNYSSDYL+KD+  FA+R+RK +R             ++           
Sbjct: 135 LFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGSGAQSASMAS 194

Query: 241 -IDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPK 299
              L +L  ++     + D ID NDP  TIVIHPGS+SIKIG   D+ PV +PN VAVP+
Sbjct: 195 SASLDALVDTDTKLQSVED-IDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPR 253

Query: 300 KWLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNEN 359
             +     E   NV L  E  ++F+ + ++++ NF+ERM+YYKRK+  NAHEQV SFN N
Sbjct: 254 SQVVNPVDETPVNV-LNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSN 312

Query: 360 SKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSL 418
           SKPE +S+KND   I+WI++  K YYG DA RC+ ++F++R+PF + G FN++S  Y S+
Sbjct: 313 SKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSI 372

Query: 419 AELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQA 478
            +L+ DV++L++ AL+S+  N+  +++  YK V+VIPD+FKKSH+ETFIR+LL E+ F++
Sbjct: 373 QDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRS 432

Query: 479 VAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFA 538
           VA++QESLATCYGAGIST TCVVNIGA + RIACVD+GT+++ SA+TLDYGG+D+T L A
Sbjct: 433 VALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLA 492

Query: 539 LFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEF 598
           + L QS FP ++W + + +GW  AE  KK F TFQDAD+AVQL+NF+ R P  P+EKY+F
Sbjct: 493 ILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDF 552

Query: 599 KLFDEVMLAPLALFFPQIFKLIR-----TSSHKNSSLEFQLPESRDLFTNELNDWNSLSQ 653
           K+FDEV+LAPL LF+P+IFK I+     T+    ++L  Q+  SRD++TN LNDW S++Q
Sbjct: 553 KVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQ 612

Query: 654 FESKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIAN 713
            + +E  +YCD  DDL+I+   LD +  I+ LQ K     NT K+ F PL+KAIVQSI N
Sbjct: 613 RDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSK-HIEENTDKKCFVPLDKAIVQSITN 671

Query: 714 ASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKE 773
           A+I  D+++++ FYSNI+IVGG + IPALDFIL+DRINIWRP++L  +SFP FYK LTK+
Sbjct: 672 AAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQ 731

Query: 774 IKDLE-GHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPP 832
           +KD++  +  N  DK++++  ++ +  I    V EL++   ++E  N  +H F V ++P 
Sbjct: 732 LKDIQTSNKSNTGDKSQEQ--EVAERSIALVKV-ELDKLVASLEIPNSGDHFFTVGVLPA 788

Query: 833 PRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           PR+++P+L+ WKGASVLAQIKL+EEL+I+ +DWDVHG+R+LQYKCIF Y
Sbjct: 789 PRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/763 (50%), Positives = 536/763 (70%), Gaps = 37/763 (4%)

Query: 146 PPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPLMLINQKNYS 205
           P   K+   +LE+RRLGR +AA  +A  L+K GIEK E   + +TGLF+P+ L+NQKN S
Sbjct: 130 PVSTKMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIPLVNQKNCS 189

Query: 206 SDYLKKDDQIFALRDRKFLRXXXXXXXXX------------XXXPDVIDLKSLPHSEASA 253
           SDYLK + QIFALR+RK LR                        P+V DLK++ +SE++ 
Sbjct: 190 SDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPEVSDLKNV-NSESNV 248

Query: 254 APLN--------DEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLE 305
           + ++        D I  +DPT TIVIHPGS  +KIGF KDD P+V+PNCVA PK  L   
Sbjct: 249 SLIDETILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCVAFPKNSL--- 305

Query: 306 NSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEII 365
            SE+VE   + +E+S+ F   K++++++FR+RMRYYKRK+  N+HE+V SFN  SKPE +
Sbjct: 306 YSENVEETIVSKEESDNFKTKKNQIQQSFRDRMRYYKRKIQNNSHERVRSFNIQSKPEKV 365

Query: 366 SEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAELISD 424
            +K + + +EWI +  K+YYG +A RC  + F+IR PF +GGSFN+ SPYY SL E+I D
Sbjct: 366 EDKTEYNRVEWITNPDKIYYGEEASRCSKDAFIIRYPFVKGGSFNITSPYYNSLPEIIGD 425

Query: 425 VTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQE 484
           ++ L E+AL+ +  N+KP+++++YK++LVIPDIF+KSH+ET  RVLL E++FQAVAI+QE
Sbjct: 426 ISNLFEYALSQDRFNLKPSEYSKYKIILVIPDIFEKSHLETMFRVLLKEMKFQAVAIMQE 485

Query: 485 SLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQS 544
           SLA  YGAGI  +TC+VNIGA +TR+AC+DEGTV EHS ITLDYGGDDIT+LF   LLQ+
Sbjct: 486 SLAASYGAGIGGATCIVNIGATQTRVACIDEGTVSEHSLITLDYGGDDITKLFLHLLLQN 545

Query: 545 DFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFDEV 604
           +FP QD  I+S HGW   E LKK F TF+DA++ VQLYNF+   P    EK EFK+FDEV
Sbjct: 546 EFPYQDLDINSSHGWRQIENLKKQFVTFEDANITVQLYNFIKNKPGAQAEKLEFKVFDEV 605

Query: 605 MLAPLALFFPQIFKLIRTSSHK---NSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNL 661
           + APL LF+P+IF+++   + K   N  L+ QLP S DL+T E +DW SLSQ +  + + 
Sbjct: 606 INAPLGLFYPEIFRIMAEENEKRRVNKKLQDQLPPSTDLYTEERDDWRSLSQVQCLDNDT 665

Query: 662 YCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADVT 721
           Y   ++DL ++ ++L+A+  +D + D   N  N  ++N+  L+KAI+QSI NA +T D +
Sbjct: 666 YSGNDNDLDVITKLLNANLNLDDM-DLINNDQNENEKNYTSLDKAIIQSITNAVVTMDTS 724

Query: 722 RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHY 781
           +M  FY+NI++VGGSS IP+LDFILTDRINIWRP +LSS  FP F++ L K++KD     
Sbjct: 725 KMTQFYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDF---- 780

Query: 782 VNAPDKTEDENKQILQAQ---IKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNP 838
            N  +K+ +  ++  + Q   I E I  EL++   N+E QN NEH+ PVS++PPP DM+P
Sbjct: 781 -NTANKSNNRPEEGEEEQKKGIAELIKTELKKYKDNLESQNANEHLLPVSVLPPPADMDP 839

Query: 839 ALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           +++ WKGASVL Q+KL+EEL++TN+DWD+ GSRILQYKC+F Y
Sbjct: 840 SVLNWKGASVLGQLKLIEELYVTNADWDMLGSRILQYKCLFPY 882

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/776 (53%), Positives = 532/776 (68%), Gaps = 46/776 (5%)

Query: 124 APPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVE 183
            PPA  TS + KK         PPGKKVP+HLLEKRRLGRIKAAEEFAK LK IGIEK +
Sbjct: 47  VPPA--TSGKVKK----PDTHIPPGKKVPMHLLEKRRLGRIKAAEEFAKKLKTIGIEKRD 100

Query: 184 TTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXX--------XXXX 235
            + L  TGLF+PL+LINQKNYSSDYLKKDDQIFA+R+RK LR                  
Sbjct: 101 NSALQQTGLFKPLLLINQKNYSSDYLKKDDQIFAMRERKSLRNPNSGNGNGNTGNNAVSN 160

Query: 236 XXPDVIDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCV 295
             P+VI  +        A   +D   LN    TIVIHPGS  +KIGF  D  P  VP+C+
Sbjct: 161 ATPEVIPEEEDNDDNDDAEGTDD---LN----TIVIHPGSKFLKIGFATDVLPQSVPSCI 213

Query: 296 AVPKKWLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVS 355
           A+P+   +   S  +      RE SE F+ +KS ++++F+ERMRYYKRKV  NAH+ V++
Sbjct: 214 AIPRATKNSVRSPQI------REPSE-FDGLKSAIQQDFKERMRYYKRKVIPNAHDAVIN 266

Query: 356 FNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYY 415
           FN   +PE+I E ND   +EWI + S  +YG +A RC+   F +R PF  GSFNV+SPYY
Sbjct: 267 FNSKVEPELIHEHNDLHRVEWIQNGSNQFYGEEATRCLPSHFTLRYPFARGSFNVESPYY 326

Query: 416 KSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQ 475
            S  EL+ DV  LLE+ L  E ++V   +F  YK+VLVIPD++ K++VETFI +LL ++ 
Sbjct: 327 MSFQELLGDVQSLLEYCLKQEKIDVTKQQFANYKIVLVIPDLYDKNYVETFIHLLLVQMG 386

Query: 476 FQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITR 535
           FQAVAIIQESLAT YGAGIS STCVV+IGA  T+IACVDEGTVL +SA+TLDYGGDDITR
Sbjct: 387 FQAVAIIQESLATTYGAGISNSTCVVDIGATSTKIACVDEGTVLGNSAVTLDYGGDDITR 446

Query: 536 LFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQP-TE 594
           LF+ FLLQS FP  DW + + HGW+LAE LKK FTTFQDA+VAVQLYNF+ R+P +   +
Sbjct: 447 LFSQFLLQSKFPYDDWDLSTPHGWMLAESLKKEFTTFQDANVAVQLYNFIKRTPGEANAQ 506

Query: 595 KYEFKLFDEVMLAPLALFFPQIFKLIR-TSSHKNSSLEFQLPESRDLFTNELNDWNSLSQ 653
           KYEFK+FDEVMLAP+A+FFP+I  L+    + +   +  Q P S+D++T   N+  S+SQ
Sbjct: 507 KYEFKVFDEVMLAPMAMFFPKILSLLNPQKTQQEHYVTNQFPRSKDIYTLRDNNPRSISQ 566

Query: 654 FESKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNT------LKENFAPLEKAI 707
            E  E   YCD+  DL IL +IL+       L D+ + Y N+        +N  PLEKAI
Sbjct: 567 RECHENKTYCDMTRDLDILQKILN-------LPDEIDEYSNSNLSKKHHHDNITPLEKAI 619

Query: 708 VQSIANASITAD--VTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQ 765
           V+SI NASI+ D  ++R+ +FYSN+L+VGG SK P+LDFILTDRINIWRP LLS  +   
Sbjct: 620 VESITNASISLDNNMSRLGNFYSNLLVVGGGSKFPSLDFILTDRINIWRPRLLSVNTIST 679

Query: 766 FYKKLTKEIKDLEGHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIF 825
           FYKK+T++IKD E       + T+ E    L+ ++ + +  EL+   ++++   GNE++F
Sbjct: 680 FYKKVTQQIKDFEQEN-KVSEVTDPEQLATLKKKLLKMVKLELQSYWESVDALGGNENVF 738

Query: 826 PVSIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           P++++PPPRDM+PA++ WKG SVLA+IKLVEEL+IT  DWDV GSRILQYKCIF Y
Sbjct: 739 PINVLPPPRDMDPAVLTWKGGSVLARIKLVEELYITAKDWDVLGSRILQYKCIFDY 794

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/799 (50%), Positives = 535/799 (66%), Gaps = 69/799 (8%)

Query: 143 AKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPLMLINQK 202
           +K+  GKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEKV++TTLP+TG  +PL++INQK
Sbjct: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204

Query: 203 NYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPD------VIDLKSLPHSEASAAP- 255
           NYSSDY++KDDQIFALR+RKFLR             +      V      P    S  P 
Sbjct: 205 NYSSDYIRKDDQIFALRERKFLRSAGTSNTTTTTTNNGSNTNGVGSASHTPEVATSTIPN 264

Query: 256 ----LNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENSEHVE 311
                +D+ID  D T TIVI PGS SIKIGF  D+ P+V+PNCVAVP           + 
Sbjct: 265 EFTLKSDDIDFTDATTTIVIQPGSESIKIGFATDETPLVIPNCVAVPHS-----GETPIG 319

Query: 312 NVC-LQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISEKND 370
           N   L R+Q ++F   K E++ +F+ERMR+YKR+V  ++++QV +FNE +KPEII ++ND
Sbjct: 320 NAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQND 379

Query: 371 PSPIEWIF-----DDSKLYYGSDALRCVDEKFVIRKPFRGGS-----FNVKSPYYKSLAE 420
           P+ I W       +   +Y G +AL C+ E ++ R+PF G S     FN+    Y SLA 
Sbjct: 380 PAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF-GCSEGKYLFNLDEKRYTSLAA 438

Query: 421 LISDVTKLLEHALNS--ETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQA 478
           L+ DV++LLEHA++   +  +    K  +YK VLVIPD+F+KSHVET IR+LL+EL F A
Sbjct: 439 LLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFNA 498

Query: 479 VAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFA 538
           VAI+QESLATCYG+GISTSTCVVN+GA  T++ACVDEG V+E+S I L+YGGDDI++LFA
Sbjct: 499 VAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLFA 558

Query: 539 LFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEF 598
           + LL S+FP Q+W IDS  G ++AE LKK   TFQDAD+  QL+NF+ R P  PTEK EF
Sbjct: 559 VLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEKIEF 618

Query: 599 KLFDEVMLAPLALFFPQIFKLIRTSSHKNSS---LEFQLPESRDLFTNELNDWNSLSQFE 655
           K FDEV+LAPLALF+P+IF L++ +  KN +   L++QLP+SRDLFTN+ N+W SLS+ +
Sbjct: 619 KTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEMD 678

Query: 656 SKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYG---NTLKENFAPLEKAIVQSIA 712
                LY D+  +  +L+ +L    I  + +  P++ G    T + N   L+K+++QSI 
Sbjct: 679 CATNTLYSDMVQESVLLDNLL---GINSRREGPPKDSGVGSETTELNLTALDKSVIQSIT 735

Query: 713 NASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTK 772
           NA+++ +  +M SFYSNILIVGGSS IP  D IL DRIN+WRP L++ ASFP FY +L K
Sbjct: 736 NATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVK 795

Query: 773 EIKDLE-------------GHYVNAP-----------------DKTEDENKQILQAQIKE 802
           EIKDLE             G     P                 + + D  +  L  +I++
Sbjct: 796 EIKDLETSAKTSSAAIVTGGTATATPAPVLNDDDAPKEVPEVKETSSDAKEYELNEKIQK 855

Query: 803 KIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALIIWKGASVLAQIKLVEELFITN 862
            I E LE+    IE QNGNEH  PVS+ P P +MNP+L+ W+GA VLAQIKL+EELF+TN
Sbjct: 856 LIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTN 915

Query: 863 SDWDVHGSRILQYKCIFTY 881
            DWDVHGSR+LQ+KCIFTY
Sbjct: 916 IDWDVHGSRVLQHKCIFTY 934

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/761 (49%), Positives = 518/761 (68%), Gaps = 32/761 (4%)

Query: 126 PAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETT 185
           PA+ +     K  K DP +     KVP HLLEKRRLGR KAAE++A+ +K IGIEK +  
Sbjct: 42  PALSSHSNASKVKKPDP-QVKQNTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNP 100

Query: 186 TLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKS 245
            L   GLF+PL LINQKNYSSDYLK+DDQIFA+R+RK LR            PD+ D   
Sbjct: 101 LLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNATASQST----PDMPDDDD 156

Query: 246 LPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLE 305
                       + +D +    TIVIHPGS S+KIGF  D  P  +P+CVAVPK+     
Sbjct: 157 -----------QESVDGDSELNTIVIHPGSKSLKIGFATDVLPQSIPSCVAVPKR----- 200

Query: 306 NSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEII 365
            S+ ++    Q   +EE+   K  ++++F+ERMRYYKRK+  N+H+ VV+FN    PEII
Sbjct: 201 -SQSLQGETKQPHDTEEYQETKDSIQQDFKERMRYYKRKIIPNSHDIVVNFNSRVSPEII 259

Query: 366 SEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAELISDV 425
            E ND   I+WI   S+ YYG +A RC+   F +R PF  G FN++SP Y SL EL++DV
Sbjct: 260 PEHNDLHRIDWIDQPSRPYYGKEATRCLPSHFTVRHPFWKGRFNIESPDYSSLQELLNDV 319

Query: 426 TKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQES 485
            +LL+ AL+   ++VKP++ + YKVV+V+PD++ K++VETFIR+LL +L FQAVAIIQES
Sbjct: 320 CELLKFALSQPKIDVKPSQISNYKVVIVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQES 379

Query: 486 LATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSD 545
           LA+CYGAGI  STCVV+IGA  T+IACVDEG V E+S I LDYGGDDITRLFA FLL+S+
Sbjct: 380 LASCYGAGIGESTCVVDIGATTTKIACVDEGLVNENSIINLDYGGDDITRLFARFLLESN 439

Query: 546 FPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQP-TEKYEFKLFDEV 604
           FP QD  +DS  GW L E+LK+ +TTFQDADV +QLYNF+ R P +P  EK+EFK+FDEV
Sbjct: 440 FPYQDLDLDSPQGWSLVEQLKEKYTTFQDADVTIQLYNFIKRIPGKPGAEKFEFKVFDEV 499

Query: 605 MLAPLALFFPQIFKLIRTSSH-KNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYC 663
           M AP+ LFFP +F L++  ++  N  ++ QLP S+D+FT + N+  S+SQ   ++ N YC
Sbjct: 500 MTAPMGLFFPHVFPLLKEQNNPTNEYVKSQLPRSKDMFTCKDNNLKSVSQLACQKKNTYC 559

Query: 664 DLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITAD--VT 721
           D+  DL IL ++L+  + I++ Q         ++  +  LEKAI++SI NA ++ D    
Sbjct: 560 DMGRDLDILQKLLNLPSEIEEYQSAA---SANVEPAYTALEKAIIESITNACVSLDNNHA 616

Query: 722 RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHY 781
           +   FYSNIL+VGGSSK P+LDFILTDRINIWRP LLS  + P F+ +++K++K+ E   
Sbjct: 617 KAAQFYSNILVVGGSSKFPSLDFILTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFEQ-- 674

Query: 782 VNAPDKTEDENKQILQAQIKEKIVE-ELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPAL 840
            N   + ++E + + Q +   K ++ EL+   + ++   GNE +FP++++P PR+M+PAL
Sbjct: 675 TNKLSEIKEEEELLSQKKKLAKTIKMELQSYWEGVDALGGNESVFPINVLPAPREMDPAL 734

Query: 841 IIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           + WKG SV A++KL+EEL+++ +DWDV  SRILQYKCIF Y
Sbjct: 735 LTWKGGSVFARLKLIEELYVSANDWDVLNSRILQYKCIFDY 775

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/665 (56%), Positives = 491/665 (73%), Gaps = 21/665 (3%)

Query: 134 YKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLF 193
           YKKYPK+DP K PPGKKVPLHLLEKRRLGRIKAAEEFAK LK+ GIEKVE+ T+P TGLF
Sbjct: 155 YKKYPKMDPKKVPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTVPPTGLF 214

Query: 194 QPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKSLPHSEASA 253
           QPL LINQKNYSS YLK DDQIF LRD K L+             ++++  +   +  S 
Sbjct: 215 QPLNLINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPNQTSTATPDNIVESVATGINNKST 274

Query: 254 APLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLD-----LENSE 308
               D+++LNDPT TI+IH GS+S+KIG   D++P++VPNCVA+PK+  +     +   +
Sbjct: 275 G---DQLNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPNCVAIPKQEYEGMTRNINTKD 331

Query: 309 HV-----ENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPE 363
            +      N+     QS+EFN++K E+E NF+ERM+YYKR++  N+ EQV SFN+ SKPE
Sbjct: 332 SIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKRRIQPNSCEQVKSFNKISKPE 391

Query: 364 IISEKNDPSPIEWIFDDS-KLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAEL 421
           I+   NDP  I+WI + + K YYGS+A RC D  F  RKPF   GSFN+ S  Y SL +L
Sbjct: 392 ILPISNDPQRIQWINESTNKRYYGSNAERCTDLHFKTRKPFSNNGSFNIASTDYISLQDL 451

Query: 422 ISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAI 481
           +SDVT L+EH+L S   ++KP++F ++KVVL+IPD F KSHVE FI +LLT L+FQAVAI
Sbjct: 452 LSDVTNLIEHSLTSSPFDLKPSQFKEHKVVLIIPDSFGKSHVELFITLLLTHLKFQAVAI 511

Query: 482 IQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFL 541
           IQESLATCYGAG S  TCVVN+GA++T +ACVDEGTVLE+S ++L+YGG+DIT +FA FL
Sbjct: 512 IQESLATCYGAGNSVPTCVVNLGASQTTVACVDEGTVLENSMVSLNYGGNDITNIFATFL 571

Query: 542 LQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPT-EKYEFKL 600
           LQ+DFP  +W ++S  GW LAE LK+ + TFQD DV VQL+NF+ R P   T EKY+FK+
Sbjct: 572 LQNDFPYHNWNLNSIEGWKLAEELKEKYITFQDMDVTVQLFNFIKRLPGMDTIEKYDFKV 631

Query: 601 FDEVMLAPLALFFPQIFKLIRTS--SHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKE 658
           FD+VMLAPL LFFP+I KL++     ++N  L+ QLP+SRD++T ++NDW S++Q E  E
Sbjct: 632 FDDVMLAPLTLFFPKILKLMKEQQPQNRNKFLQSQLPDSRDIYTTKINDWRSITQEECLE 691

Query: 659 GNLYCDLNDDLKILNRILDAHNIIDQLQ-DKPENYGNTLKENFAPLEKAIVQSIANASIT 717
             L+  ++++L++L R L+   +++  Q + P+N  + L  N+ PL+ AI+QSI NAS  
Sbjct: 692 SKLFSYIDNELELLKRTLEVPILLENFQNNSPDNKNDKL--NYTPLDVAIIQSIMNASTN 749

Query: 718 ADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDL 777
            D+++M+SFYSNIL+VGG SKIPALDFILTDRINIWRP LLS  SFP FYK+L+K+IKDL
Sbjct: 750 IDMSKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKELSKDIKDL 809

Query: 778 EGHYV 782
           + HY+
Sbjct: 810 QNHYL 814

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 84/112 (75%), Gaps = 1/112 (0%)

Query: 771 TKEIKDLEGHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEH-QNGNEHIFPVSI 829
           + +I +  G   N  ++  ++ K+ +  +I E + E+LEE  + +E  QNGN+H  PVS+
Sbjct: 863 STKIDNTPGAETNEVEEAVNKLKREMDDKINELLKEKLEEYLETVEKAQNGNDHYLPVSV 922

Query: 830 IPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           +P PRD++PALI+WKGASVLAQ+K++EEL++TN+DWDVHGSRILQYK IF Y
Sbjct: 923 VPAPRDIDPALILWKGASVLAQLKIIEELYMTNADWDVHGSRILQYKSIFPY 974

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/764 (48%), Positives = 530/764 (69%), Gaps = 39/764 (5%)

Query: 138 PKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPLM 197
           P+   A A  GKKVP HLLEKRRLGRIKAAEEFA+ LKKIGIEK +   +  TGLF+PL 
Sbjct: 47  PETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQTGLFRPLP 106

Query: 198 LINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKSLPHSEASAAPLN 257
           LINQKNYSSDYL+KDDQIF++R+RK LR            P ++       +EA    L 
Sbjct: 107 LINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSSQPPTLL-------AEAGEDDLK 159

Query: 258 -----DEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENSEHVEN 312
                D ID  +   TIVIHPGS S+KIG   D  P+ VP+CVAV ++      S+ +E 
Sbjct: 160 LNGDEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPSCVAVARR-----ASQRLEP 214

Query: 313 VCLQR-EQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISEKNDP 371
              QR ++ E+F     +++ +F+ERMRYYKRK+  N+HEQV+S+N  ++PE I E ND 
Sbjct: 215 Q--QRYDKDEDFMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSRAQPEKIPEHNDL 272

Query: 372 SPIEWIFD--DSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAELISDVTKLL 429
             IEWI D  +  +YYG  A RC+ E FVIR PF  G+FNV+ P Y SL EL++DVTKL+
Sbjct: 273 HRIEWIKDAPEGTIYYGEGAERCLPENFVIRYPFSNGAFNVECPDYSSLQELLNDVTKLI 332

Query: 430 EHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATC 489
             AL+   L +  ++F  YKV+L+IPD+F+K++VE  IR+LL+E+ FQAVA+IQESLATC
Sbjct: 333 TFALSETKLGISRSQFPNYKVILIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQESLATC 392

Query: 490 YGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDFPLQ 549
           YGAG+S STCV++IGA+ET+I+CVDEG V+++S I L YGGDDITRLF   LLQS+FP  
Sbjct: 393 YGAGLSNSTCVIDIGASETKISCVDEGQVIQNSCIRLSYGGDDITRLFVELLLQSNFPYP 452

Query: 550 DWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQP-TEKYEFKLFDEVMLAP 608
           DW ++++ GW+LAE+LKK   TFQDADVAVQL+NF  R P+ P  EK+EFKLF+EVM++P
Sbjct: 453 DWNLNTRQGWILAEQLKKTHITFQDADVAVQLFNFFKREPSVPGAEKFEFKLFNEVMISP 512

Query: 609 LALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYCDLNDD 668
           +A F+PQI   ++ ++  N  +  QLPESRD +T + ++  S++Q  +  G +Y D+N D
Sbjct: 513 MAYFYPQILSFLKPATSYNKYMAQQLPESRDPYTYKPDNPKSIAQESAFTGKVYTDINKD 572

Query: 669 LKILNRILDAHNIIDQLQDKP--ENYGNTLK------ENFAPLEKAIVQSIANASITA-- 718
           L I+ +++  ++ ++ L   P     G+T+K       N+ PL+KAI++S+  AS+    
Sbjct: 573 LDIIRKLVSVNDEVEALTSGPSERTSGDTIKTNTRRASNYTPLDKAIIESVTTASVLLGD 632

Query: 719 DVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLE 778
           +++++ +FYSN+L++GGSSK+P LD ILTDRINIWRP LLS ++ P  YKK+++ +K +E
Sbjct: 633 NMSKLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVYKKVSEMVKQVE 692

Query: 779 GHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNI-EHQNGNEHIFPVSIIPPPRDMN 837
                   ++E+E      AQ ++K+++ ++ + +N  E  +  EH++P++++PPPR+M+
Sbjct: 693 NEIKKNNPESEEE-----IAQSRKKLIKSIKIELENYWESVDPYEHVYPIAVLPPPREMD 747

Query: 838 PALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           P+++ WKG SV  +IKL EEL+IT  DW++ GSRIL+YKCIF Y
Sbjct: 748 PSMLTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY 791

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/759 (49%), Positives = 516/759 (67%), Gaps = 27/759 (3%)

Query: 138 PKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPLM 197
           P+     +   KKVP HLLEKRRLGRIKAAEEFA+ LKKIGIEK +   +  TGLF+   
Sbjct: 29  PETGGVASTQSKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNIHISQTGLFRVHS 88

Query: 198 LINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKSLPHSEASAAPLN 257
           LINQKNYSSDYL+KDDQIF++R+RK LR            P +I L  +   E       
Sbjct: 89  LINQKNYSSDYLRKDDQIFSMRERKNLRSGNVNSITNSSQP-LIALPDVQDDEVKTNGDE 147

Query: 258 DEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENSEHVENVCLQR 317
           D +D    T TIVIHPGS S+KIG   D  P+ +P+CVA+ +       SE VE     R
Sbjct: 148 DGLDDTADTNTIVIHPGSRSLKIGLSTDVFPLSIPSCVAIAR-------SEQVEVPSQPR 200

Query: 318 -EQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISEKNDPSPIEW 376
            +  EEF     +++ +F+ERMRYYKRK+  N+HEQV+S+N   +PE I E ND   IEW
Sbjct: 201 YDNDEEFMGNLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSKCQPEKIPEHNDLHRIEW 260

Query: 377 IFDD---SKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAELISDVTKLLEHAL 433
           I      +K+YYG  A RC+ E F++R PF  GSFNVKSP Y SL EL++DV  L+  AL
Sbjct: 261 IKKSDASTKVYYGEYAERCLPEGFLLRYPFANGSFNVKSPNYNSLQELLNDVVNLITFAL 320

Query: 434 NSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAG 493
           +   LN+  ++F+ Y VVL+IPD+F+KS+VE  IR+L++E+ FQAVA+IQESLA+CYGAG
Sbjct: 321 SETKLNISKSQFSSYNVVLIIPDLFEKSYVEQMIRLLISEMDFQAVALIQESLASCYGAG 380

Query: 494 ISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDFPLQDWKI 553
           +S STCV++IG +ET+I+CVDEG V+++S I L YGGDDIT+LFA  LLQS+FP +DW +
Sbjct: 381 LSNSTCVIDIGGSETKISCVDEGQVIQNSCIKLSYGGDDITKLFAELLLQSNFPYEDWNL 440

Query: 554 DSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPN-QPTEKYEFKLFDEVMLAPLALF 612
           +++ GWLLAE+LKKN  TFQDADVAVQL+NF  R+PN    EKYEFKLF+EVM++P+A F
Sbjct: 441 NTRQGWLLAEQLKKNHITFQDADVAVQLFNFFKRNPNISGAEKYEFKLFNEVMVSPMAYF 500

Query: 613 FPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYCDLNDDLKIL 672
           +PQI  L++     N  ++ QLP SRD +T + +D  S+S   S  G  Y +++ DL I+
Sbjct: 501 YPQILALLKPPVEVNKYVQQQLPPSRDPYTCKPDDPQSVSNLGSLSGKWYTEMSKDLDIV 560

Query: 673 NRILDAHNIIDQLQDKPEN--YGNTLKE------NFAPLEKAIVQSIANASITA--DVTR 722
            +++   + ++ L     +    +T+ E      N+ PL+KAI++S+ NA++    ++++
Sbjct: 561 RKLISITDKVEALSANSSDGTASDTIVENTEEVSNYMPLDKAIIESVTNAAVLLGDNMSK 620

Query: 723 MNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHYV 782
           + +FYSN+LIVGGSSK+P LD ILTDRINIWRP LLS ++ P  YKK++  +K +E    
Sbjct: 621 LTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVIYKKISDMVKQVESEIK 680

Query: 783 NAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALII 842
               ++E+E +Q  +  IK  I  ELE   ++++     EH++P++++PPPR+M+P+++ 
Sbjct: 681 KNNVESEEEIQQSRKKLIK-SIKIELENYWESVDPY---EHVYPITVLPPPREMDPSMLT 736

Query: 843 WKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           WKG SV  +IKL EEL+IT  DW++ GSRIL+YKCIF Y
Sbjct: 737 WKGGSVFGRIKLCEELYITEMDWEMLGSRILKYKCIFDY 775

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 516/763 (67%), Gaps = 36/763 (4%)

Query: 126 PAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETT 185
           PA+ ++    K  K DP  A    KVP HLLEKRRLGR KAAE++A+ +K IGIEK +  
Sbjct: 42  PALSSNPNASKVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNP 100

Query: 186 TLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXXXPDVIDLKS 245
            L   GLF+PL LINQKNYSSDYLK+DDQIFA+R+RK LR            PD      
Sbjct: 101 LLHQLGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNANANQAT----PD------ 150

Query: 246 LPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLE 305
           +P  +       + +D      TIVIHPGS ++KIG   +  P  +P CVAVPK+    +
Sbjct: 151 MPEDDD-----QESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSD 205

Query: 306 NSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEII 365
           ++         +   EE+ + K  ++++F+ERMRYYKRKV  N+H+  V+FN    PE I
Sbjct: 206 STPE------PQVDEEEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAI 259

Query: 366 SEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAELISDV 425
            E ND   ++WI D SK YYG DA RC+   F +R PF  G FN++SP Y SL EL+ DV
Sbjct: 260 PEHNDLHRVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKGRFNIESPDYGSLQELLVDV 319

Query: 426 TKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQES 485
           ++LL+ AL+   ++V+P++   YKVV+V+PD F K++VETFIR+L+T+L+FQAVA+IQES
Sbjct: 320 SELLKFALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQES 379

Query: 486 LATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSD 545
           LA+CYGAGI  STCVV+IGA  T+IACVDEG V+++S ITLDYGGDDIT+LFA FLL+S+
Sbjct: 380 LASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESN 439

Query: 546 FPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQP-TEKYEFKLFDEV 604
           FP QD  ++S  GW L E+LK+ + TFQDADV +QLYNF+ R PN+P  EK+EFK+FDEV
Sbjct: 440 FPYQDLDLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEV 499

Query: 605 MLAPLALFFPQIFKLIRTSSHK-NSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYC 663
           M AP+ LFFP I +L++  +   N  +  QLP S+D+FT + N+  S+SQ   ++   YC
Sbjct: 500 MTAPMGLFFPHILRLLKDKNVPVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYC 559

Query: 664 DLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITAD--VT 721
           D++ DL IL ++L   N+  ++++   +    L+  + PLEKAIV+SI NA ++ D   +
Sbjct: 560 DMHRDLDILQKLL---NLPSEIEEYQSSTCANLEPAYTPLEKAIVESITNACVSLDNNHS 616

Query: 722 RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHY 781
           +  +FYSNIL+VGGSSK  +LDFILTDRINIWRP LLS  + P F  +++K++K+ E   
Sbjct: 617 KAANFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQ 676

Query: 782 VNAPDKTEDENKQILQAQIK---EKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNP 838
             +  K E+E    L AQ K   + I  EL+   + ++   GNE +FP +++P PR+M+P
Sbjct: 677 KLSEIKDEEE----LAAQKKKLAKTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDP 732

Query: 839 ALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881
           AL+ WKG SV A++KL+EEL+++ SDWD+ GSRILQYKCIF Y
Sbjct: 733 ALLTWKGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/793 (44%), Positives = 498/793 (62%), Gaps = 45/793 (5%)

Query: 121 DKRAPPAVQTSKRYKKYPKLDP----AKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKK 176
           D    P+ + SK   K P L      +K  P KKVP HLLEKRRLGRIKAAEEFAK LK 
Sbjct: 6   DPTESPSKEPSKEPSKEPLLGSDGKISKDIPSKKVPQHLLEKRRLGRIKAAEEFAKKLKI 65

Query: 177 IGIEKVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRXXXXXXXXXXX 236
           IGIE+ E   +      +P+ +INQKNYSS+YLK DDQIF +R+RK LR           
Sbjct: 66  IGIERQENEHIAQPITLKPVSVINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGSSSA 125

Query: 237 XPDVIDLKSLPHSEA--SAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNC 294
               I   +L       S A  +DE+D      +I+IHPGS+ IKIG   D  P  VPN 
Sbjct: 126 PAAGIGTPALDDDNMADSNAIEDDELD------SIIIHPGSSFIKIGPNYDIFPQQVPNL 179

Query: 295 VAVPKKWLDLEN-SEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQV 353
           VAVP     + +  E + N       +E F  +K +++ +F+ERMRYYKR++  N+ EQ 
Sbjct: 180 VAVPTHGGTVPSPQEDISN-------NEIFQQLKDDIQFDFKERMRYYKRRIMPNSTEQA 232

Query: 354 VSFNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSP 413
            +FN  S PE++ + ND   IEWI D SK YYG DA +C+   F +R PF  GSFN+  P
Sbjct: 233 AAFNAKSDPELVPDLNDFGRIEWIKDRSKSYYGHDATQCLPSDFKLRSPFLNGSFNLNEP 292

Query: 414 YYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTE 473
            Y S  E++ DV +L+  +L  E + ++  +F+ Y+VVL++PD+F K+ VE+ I +LL E
Sbjct: 293 NYNSFQEILFDVEQLIVQSLAMEKIGIERNQFSNYRVVLIVPDLFDKTFVESMIHLLLIE 352

Query: 474 LQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDI 533
           L FQ++A+IQESLA+CYGAG+S STCV++IGA +T+IACVD+G V+++SA+ L+YGGDDI
Sbjct: 353 LDFQSIALIQESLASCYGAGLSNSTCVIDIGAKQTKIACVDDGVVVKNSALRLNYGGDDI 412

Query: 534 TRLFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSP---- 589
           TRLFA  LLQ+ FP  DW I+  +GW LAE LKK   TFQDAD+A+QLY+F+ R P    
Sbjct: 413 TRLFAHMLLQNKFPYADWNINEPNGWTLAETLKKQCITFQDADIAIQLYSFIKRDPYARK 472

Query: 590 NQPTEKYEFKLFDEVMLAPLALFFPQIFKLIRTSSHK-NSSLEFQLPESRDLFTNELNDW 648
              + KYE+KLFDEVM AP+ +FFP IF++I+   HK N  +  Q P S+D++T + ND 
Sbjct: 473 YTQSHKYEYKLFDEVMCAPMGIFFPDIFEVIKPKQHKPNEYVIRQCPRSKDIYTLKPNDT 532

Query: 649 NSLSQFESKE--GNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENF------ 700
            SL+Q    +     Y +L+ D+ I+ ++L+        Q+  E+ G+  +         
Sbjct: 533 KSLTQMLCIQEPTKWYSNLSRDIDIVQKLLNLDTDDLDEQNDDESAGSKEETQINDEIED 592

Query: 701 ----------APLEKAIVQSIANASITA--DVTRMNSFYSNILIVGGSSKIPALDFILTD 748
                      PLEKAI++SI NAS+    +++++N  YSNILIVGGSSKIPALDFILTD
Sbjct: 593 INLRQYNNLSMPLEKAIIESITNASMLLGDNMSKLNVLYSNILIVGGSSKIPALDFILTD 652

Query: 749 RINIWRPSLLSSASFPQFYKKLTKEIKDLEGHYVNAPDKTEDENKQILQAQIKEKIVEEL 808
           RINIWRP LLS ++     +K+ + IK  E       + T+ +     + ++ + I  E+
Sbjct: 653 RINIWRPKLLSISALSTLMEKIGEVIKSYETDNKLDLEPTDPQAAIAYKKKLSKLIKAEI 712

Query: 809 EEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVH 868
           E    +++  + ++ + P++I+PPP DM+P+++ WKG SV ++IKL+EEL IT  DW++ 
Sbjct: 713 EAYWDSLQTLHSDDDLLPINILPPPHDMDPSMLTWKGGSVFSKIKLLEELNITKQDWNML 772

Query: 869 GSRILQYKCIFTY 881
           G+RILQYKCIF Y
Sbjct: 773 GNRILQYKCIFEY 785

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 4/128 (3%)

Query: 408 FNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFI 467
             +  P    + +  +D+  L +HA   E + +  T     K++L  P +    + E   
Sbjct: 69  LQISYPMENGIIKHWTDMELLWDHAF-FEKMKLPSTSGG--KILLTEPPMNPLKNREMMC 125

Query: 468 RVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLD 527
           +V+  +  F  V +  +++   Y  G+S S  VV+ G   T I  V E  VL H    LD
Sbjct: 126 QVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVTHIVPVYESVVLNHLTRRLD 184

Query: 528 YGGDDITR 535
             G D+TR
Sbjct: 185 VAGRDVTR 192

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 55/129 (42%), Gaps = 4/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P  + + E   D+  L  H  N     +K   F+++ +++    +  + + + 
Sbjct: 69  GLLRLRHPMNRGIVENWDDMETLWSHTFNDI---LKINDFDEHPLLITEAPLNPEKNRDK 125

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
              V   +  F AV I   S  + Y +G  T+ CV++ G        + EG  L  S   
Sbjct: 126 MCEVFFEKFDFAAVYIANPSTLSLYASG-RTTGCVLDCGDGYCSSVPIYEGFALPSSIRR 184

Query: 526 LDYGGDDIT 534
           +D GG D+T
Sbjct: 185 IDVGGRDVT 193

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 8/91 (8%)

Query: 446 NQYKVVLVIPDIFKKSHVETFIRVLLTELQFQA-----VAIIQESLATCYGAGISTSTCV 500
           ++Y +V+ IP   K   V+  I     EL F+      + II E LA     G S+S  V
Sbjct: 104 DEYPLVITIPSANK--DVDEIILKKYFELAFETFNVPVLQIIIEPLAVALSLGKSSS-LV 160

Query: 501 VNIGAAETRIACVDEGTVLEHSAITLDYGGD 531
           VN+GA+   +  + +GTV++H+ +   YGGD
Sbjct: 161 VNLGASGCNVTPIVDGTVIKHAVMKSKYGGD 191

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 423 SDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAII 482
           +D+ +L ++A   +   +K      +KV+L  P +    + E    V+  +  F  V + 
Sbjct: 82  ADMEQLWDYAFYDQ---MKIPSTAGHKVLLTEPPMNPLKNREQMCEVMFEKYDFGGVYVA 138

Query: 483 QESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITR 535
            +++   Y  G+S S  VV+ G   T I  V E  VL H    LD  G D+TR
Sbjct: 139 IQAVLALYAQGLS-SGVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTR 190

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 51  KVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 109

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 110 HIVPVYESVVLNHLTRRLDVAGRDVTR 136

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 442 PTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVV 501
           PT  N  K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV
Sbjct: 99  PTTSNG-KILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVV 156

Query: 502 NIGAAETRIACVDEGTVLEHSAITLDYGGDDITR 535
           + G   T I  V E  VL H    LD  G D+TR
Sbjct: 157 DSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTR 190

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KVLLTEPPMNPLKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLSHLTKRLDVAGRDVTR 190

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLSHLTRRLDVAGRDVTR 190

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLSHLTRRLDVAGRDVTR 190

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLSHLTRRLDVAGRDVTR 190

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KILLTEPPMNPLKNRELMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 447 QYKVVLVIPDIFKK---SHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNI 503
           +Y +V+ IP + K+     +E +  ++    +F    II E LA     G S S  V+++
Sbjct: 105 EYPLVITIPSMKKEIDGEVLEKYFSLVFERFKFPVFQIILEPLAITLSLGKS-SGLVIDM 163

Query: 504 GAAETRIACVDEGTVLEHSAITLDYGG 530
           G++  R+  + +GTV++++ ++  YGG
Sbjct: 164 GSSGCRVTPIIDGTVIKNAVLSSKYGG 190

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           KV+L  P +    + E    V+     F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KVLLTEPPMNPVKNRERMCEVMFERYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%)

Query: 458 FKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGT 517
           + +S  E   + +   ++     I+  SLAT Y  G   +  V++IG A T I  + + T
Sbjct: 56  WSQSEQEILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVIDIGGAHTDIIPIVDYT 115

Query: 518 VLEHSAITLDYGGDDITRLFALFL 541
            LE+ A +   GGD I    A FL
Sbjct: 116 PLEYLAYSAPVGGDAINAKLASFL 139

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+S S  V++ G   T
Sbjct: 105 KVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 51  KILLTEPPMNPIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 109

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 110 HIVPVYESVVLNHLTRRLDVAGRDVTR 136

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%)

Query: 462 HVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEH 521
           H+E     +   LQ  +   +  SLA+ Y      ++C+++IG   T I  V +   ++H
Sbjct: 123 HIEKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDIGETHTDIVPVIDYLQMDH 182

Query: 522 SAITLDYGGDDI 533
            A ++ YGG  I
Sbjct: 183 IASSIKYGGQTI 194

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVGIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDMTR 190

>TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 2/104 (1%)

Query: 474 LQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDI 533
           L+  +  ++  SLA  +      ++ V++IG   T I  + + + L H + T+  GG+DI
Sbjct: 143 LKLNSFLMLPTSLAATHAMAALQNSIVIDIGKTHTDILPIVDYSQLTHFSSTIPIGGNDI 202

Query: 534 -TRLFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDAD 576
            T L ++    SD  ++D K+ + +  L AE  KKN+     AD
Sbjct: 203 NTHLKSILPSLSDDQIEDLKLSNIYEVLNAEA-KKNYADLHQAD 245

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 463 VETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHS 522
           VE +  + L +LQ  A+ I+ E LA     G S S  V+++GA  T +  + +GTV+   
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMGKS-SALVIDVGARGTTVTPIVDGTVVRSG 171

Query: 523 AITLDYGGD 531
            +   +GGD
Sbjct: 172 VMKSRFGGD 180

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508
           KV+L  P +    + E    V+  +  F    +  +++   Y  G+S S  VV+ G   T
Sbjct: 105 KVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLS-SGVVVDSGDGVT 163

Query: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535
            I  V E  VL H    LD  G D+TR
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 66/143 (46%), Gaps = 17/143 (11%)

Query: 450 VVLVIPDIFKKSH------VETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNI 503
           V++ IP    K+       +E + ++   + +   + I+ ESL+   G G  TS  V++I
Sbjct: 102 VLITIPSSISKNEDIENKVIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKTS-LVIDI 160

Query: 504 GAAETRIACVDEGTVLEHSAITLDYGGD----DITRLFALFLLQSDFPLQDWKIDSKHGW 559
             + + +  + +G ++++  +   YGGD     I + F+      D  L++   +S + W
Sbjct: 161 SGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQIIKKFSTI----DEDLEEEMTNSSNIW 216

Query: 560 LLAERLKKNF--TTFQDADVAVQ 580
           + +    KNF  T  Q  D  +Q
Sbjct: 217 VSSNSWIKNFKKTMLQVTDKKLQ 239

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%)

Query: 450 VVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETR 509
           V +V    + +  +E+ ++ L   L+     ++  +L++ Y  G   + CV++IG A T 
Sbjct: 111 VFIVTHHSWSQFQLESIVQFLFEALRVNGAMLLSTALSSTYAMGSLQNCCVIDIGTAHTD 170

Query: 510 IACVDEGTVLEHSAITLDYGGDDITRLFALFL 541
           I  V +   L     T+ YGG+ I    A  L
Sbjct: 171 IIPVVDYAPLVPLTSTIPYGGNTINENLARIL 202

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 131/321 (40%), Gaps = 67/321 (20%)

Query: 467 IRVLLTELQFQAVAIIQESLATCYGAGISTSTC-VVNIGAAETRIACVDEGTVLEHSAIT 525
           + VLL  + F+A  +   + A  +  G    TC VV+IG   T ++ V +G  L  S++ 
Sbjct: 125 LEVLLEGMDFEACYLTPTATAVSFAMG--RPTCLVVDIGHDITSVSPVIDGMTLSKSSMR 182

Query: 526 LDYGGDDITRLFALFLLQSD-FPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNF 584
               G  +  L    L   +  PL  +++  K      E +K++F    D ++   L NF
Sbjct: 183 SFIAGGLLNELIRTSLKPREILPL--FQVAKKR----PEFVKRSF----DYEIHPSLLNF 232

Query: 585 MNRSPNQPTEKYEFKLFDEVML--APLAL--FFPQIFKLIRTSSHK--------NSSLEF 632
           +N       E+  F+ F E ML  AP +L  F  ++ +L + S           +S   F
Sbjct: 233 VN-------ERQFFQEFKETMLQVAPTSLTKFKSELEQLSKRSIEAPWGEDLVFDSETRF 285

Query: 633 QLPESRDLFTNEL----NDWNSLSQFESKEG------NLYCDLNDDLKILNR-----ILD 677
            + E   LF  E      DW       SK+G      N Y  L  +    N       +D
Sbjct: 286 NIAEQ--LFRPETAKFPEDWPI-----SKDGVVETWHNDYVPLKRNKPGANSKEKEGTID 338

Query: 678 AHNIIDQLQDKPENY----GNTLKENFAPLEKAIVQSIAN----ASITADVTRMNSFYSN 729
           A  + D+    P  +    G    E+  P  K  +  +A+    + ++ DV    +   N
Sbjct: 339 ATPVPDENSVTPSEHLNDQGKRSLEDDTPEAKNEISGLADLIHSSIMSTDVDLRTTLAHN 398

Query: 730 ILIVGGSSKIPALDFILTDRI 750
           ++I GGSS IP     LTDRI
Sbjct: 399 VVITGGSSSIPG----LTDRI 415

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%)

Query: 463 VETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHS 522
           +E+    +  +L+   + ++  SL   Y      + C+++IG   T I  + + T + H 
Sbjct: 123 MESITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHL 182

Query: 523 AITLDYGGDDITRLFALFL 541
           + TL+YGG  I  +    L
Sbjct: 183 SNTLNYGGSYINTILQKLL 201

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 130/329 (39%), Gaps = 65/329 (19%)

Query: 467 IRVLLTELQFQAVAIIQESLATCYGAGISTSTC-VVNIGAAETRIACVDEGTVLEHSAIT 525
           + VLL  + F A  ++  + A  +  G    TC VV+IG   T +  V +G  L  S++ 
Sbjct: 124 LEVLLESMDFSACYLVPTATAVSFAMG--RPTCLVVDIGHDVTSVCPVVDGMTLSKSSMR 181

Query: 526 LDYGGDDITRLFALFLL-QSDFPLQDWKIDSKHGWLLAER----LKKNFTTFQDADVAVQ 580
               G  +  L    L  +   PL          + +A+R    +++ F    D ++   
Sbjct: 182 SYIAGSLLNELIRSQLAPRKVIPL----------FQVAQRRPVFMERKF----DYEIHPS 227

Query: 581 LYNFMNRSPNQPTEKYEFKLFDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDL 640
           L  F+N       E+  F+ F E ML        +    I T+S ++     + P   +L
Sbjct: 228 LQKFVN-------ERQFFQEFKETMLQVAPTSISKFKSEIETTSKRS----IEAPWGEEL 276

Query: 641 FTNELNDWN--------SLSQFE-----SKEGNLYCDLND-----------DLKILNRIL 676
             + L             LSQF      SK+G +    ND           ++K     L
Sbjct: 277 VYDSLQRLEFAEQLFTPDLSQFPEDWPISKDGVVETWHNDYVPLKRNKPGTNVKDKEGTL 336

Query: 677 DAHNIIDQ----LQDKPENYGNTLKENFAPLEKAIVQSIAN----ASITADVTRMNSFYS 728
           DA  + D+      D+P + G    E   P +K  V  +A+    + ++ DV    +   
Sbjct: 337 DATPVPDENSVTSADQPNDNGKRNLEETTPDQKNEVSGLADLIYSSIMSTDVDLRTTLSH 396

Query: 729 NILIVGGSSKIPALDFILTDRINIWRPSL 757
           N++I GG+S +P L   ++  +N   P+L
Sbjct: 397 NVVITGGTSSLPGLMDRISAELNRSLPAL 425

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 38.5 bits (88), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 4/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P  + + +   D+  L  H  N +TLNV+  + +   +      I K+ H+  
Sbjct: 69  GLLRLQHPMNRGVVDNWDDMELLWWHIFN-DTLNVQNIEEHPLLITEAPLTIEKQRHI-- 125

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
               L       ++ +   S+ + Y +G +T+ CVV+ G        + EG VL  S   
Sbjct: 126 MCERLFETFNIPSLYVANPSVLSLYASG-NTTGCVVDCGDGYCSSTPIYEGFVLPASIRK 184

Query: 526 LDYGGDDIT 534
           ++ GG DIT
Sbjct: 185 MEVGGRDIT 193

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 464 ETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSA 523
           ET   +L     F A+ +   ++ + Y  G  T+ CV+  G   +    V +G  L  S 
Sbjct: 128 ETMCEILYETFNFDALYVAHPAVLSLYATG-QTTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 524 ITLDYGGDDITRLFALFLLQS 544
             +D GG DIT+    ++ +S
Sbjct: 187 RRIDIGGRDITQELQFYIRKS 207

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 315 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 359

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 48  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 103

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 104 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 162

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 163 IDLAGRDLT 171

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             ++L       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQILFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDMT 186

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 331 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 375

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 64  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 119

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 120 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 178

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 179 IDLAGRDMT 187

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAIMR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDLT 186

>Smik_6.140 Chr6 (227599..230382) [2784 bp, 927 aa] {ON} YGR056W
           (REAL)
          Length = 927

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 22/149 (14%)

Query: 394 DEKFVIRKPFRGGSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLV 453
           D   +IR P    +   + P+Y S  + ++D  ++   + N+ T N K +   +Y  +L 
Sbjct: 46  DYYIIIRNPVSLNTLKKRLPHYASPQDFVNDFAQI---SWNAMTYNAKDSVIYKYATIL- 101

Query: 454 IPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIG--------- 504
             + F KS V   IR    E+ + ++  I ESL    G  I  S   +N+          
Sbjct: 102 --ESFIKSKVIVNIRNYYPEVNYPSLGRIPESL----GDVIQPSNLSLNLTNIPGNNERA 155

Query: 505 --AAETRIACVD-EGTVLEHSAITLDYGG 530
              +E ++A    + +++E   I+ DY G
Sbjct: 156 ELNSEIKMAFAKLDNSIIEKKQISQDYRG 184

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+ +KC
Sbjct: 331 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 64  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 119

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             +++       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 120 MTQIMFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 178

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 179 IDLAGRDMT 187

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 88/226 (38%), Gaps = 34/226 (15%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   +K P  + +     D+  L  H L     +++ T   ++ +++    +  +S+ E 
Sbjct: 67  GLLKLKHPMERGVVSDWDDMELLWSHILFD---SLQLTSGMEHPLLITEAPLNPESNKEK 123

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
            + V        A+ +    + + Y +G  T+ CVV+ G        V EG  L  S   
Sbjct: 124 MLEVFFETFNIPAICVSIPGVLSLYASG-RTTGCVVDCGEGYCSSVPVCEGYTLASSIKR 182

Query: 526 LDYGGDDITRLFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFM 585
           ++ GG D+T+       Q  F L+         WL +   ++   T ++    V L    
Sbjct: 183 INLGGIDVTK-------QLQFQLR----KESGVWLFSSGERELVRTMKEKSCYVSL---- 227

Query: 586 NRSPNQPTEKYE-------FKLFDEVML--------APLALFFPQI 616
           N+  ++    +E       FKL D  ML        AP  LF PQI
Sbjct: 228 NQLKDEEKFTFEPGKMNTNFKLPDGNMLTLSKSRFRAPEILFQPQI 273

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 440 VKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTC 499
           +K +   ++ +V+    +  K + E     L       A+ I   ++ + Y +G  T+ C
Sbjct: 100 LKVSNLGEHPLVVTEAPLNPKPNREKMCETLFESFNIPALYIANPAVLSLYASG-RTTGC 158

Query: 500 VVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQS 544
           VV  G        + EG  L  S   +D GG DIT+   L L +S
Sbjct: 159 VVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKS 203

>ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR033W
           (ARP9); 1-intron
          Length = 464

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%)

Query: 464 ETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSA 523
           E   + +  E++     ++  +L+  Y  G   +  V++IGA  T I  + +   L++ A
Sbjct: 118 ELITQYVFEEMRLNHFMVVPAALSISYAFGSIQNCLVIDIGATHTDIVPIVDYVPLDYMA 177

Query: 524 ITLDYGGDDITRLFALFL 541
            +   GGDDI    A  L
Sbjct: 178 YSAPIGGDDINAKLATLL 195

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 450 VVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETR 509
           V + +P     +    F  ++L +L+   + +I E LA     G ST+  VV++GA++  
Sbjct: 94  VCITVPPDLSATVRSQFHELVLCKLRAPVLQLISEPLAVTLSLGRSTAL-VVDVGASKVT 152

Query: 510 IACVDEGTVLEHSAITLDYGGD 531
           +  + +G+V++   +   Y GD
Sbjct: 153 VTPIVDGSVVKTGILRSRYAGD 174

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 61/149 (40%), Gaps = 12/149 (8%)

Query: 401 KPFRGGSFNVKSPYYKSL----AELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPD 456
           KP + GS    + + + L      L+SD     + A  +E  N+         ++L+   
Sbjct: 66  KPIQNGSIIDINAFLQFLRLIYVSLLSDRANKGQDAFEAELSNIP--------LLLITHH 117

Query: 457 IFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEG 516
            + +S +ET  + +   L+   +  +  SLA  Y      + C++++G   T I  + + 
Sbjct: 118 SWSQSDLETITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDIIPIVDY 177

Query: 517 TVLEHSAITLDYGGDDITRLFALFLLQSD 545
             L+H   +L  GG  I       L Q D
Sbjct: 178 AQLDHLVSSLPVGGQSINDSLKKLLPQWD 206

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+  KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 374

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             ++L       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H  + 
Sbjct: 119 MTQILFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHGILR 177

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 178 IDLAGRDMT 186

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+  KC
Sbjct: 330 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 374

 Score = 35.4 bits (80), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 60/141 (42%), Gaps = 5/141 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  K++ E 
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKNNREK 118

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             ++L       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H+ + 
Sbjct: 119 MTQILFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHAILR 177

Query: 526 LDYGGDDITRLFALFLLQSDF 546
           +D  G DIT      L +  +
Sbjct: 178 IDLAGRDITDYLMKILAERGY 198

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 829 IIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKC 877
           I PP R  +    +W G S+LA +   ++++I+  ++D  G  I+  KC
Sbjct: 315 IAPPERKYS----VWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 359

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 5/129 (3%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    +     D+ K+  H   +E L V P    ++ V+L    +  KS+ E 
Sbjct: 48  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAP---EEHPVLLTEAPMNPKSNREK 103

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
             ++L       A  +  +++ + Y +G  T+  V++ G   T +  +  G  L H  + 
Sbjct: 104 MTQILFETFNVPAFYVSIQAVLSLYSSG-RTTGIVLDSGDGVTHVVPIYAGFSLPHGILR 162

Query: 526 LDYGGDDIT 534
           +D  G D+T
Sbjct: 163 IDLAGRDMT 171

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 464 ETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSA 523
           E   +VL       A+ I   ++ + Y +G  T+ CVV+ G        + +G  L  S 
Sbjct: 125 EVMAQVLFETFNLPALYISNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASI 183

Query: 524 ITLDYGGDDIT 534
           + +D GG DIT
Sbjct: 184 MRMDIGGRDIT 194

>NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {ON}
           Anc_2.593 YMR033W
          Length = 501

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 43/95 (45%)

Query: 443 TKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVN 502
           T+ +    +L+    + +  +E   + +   L+     ++  SL+T        + C+++
Sbjct: 108 TELSNIPFLLITHYTWSQPQLEKITQFIFESLKILNAMLLPSSLSTSVAMISLQNCCIID 167

Query: 503 IGAAETRIACVDEGTVLEHSAITLDYGGDDITRLF 537
           IG + T I  + + T L   A TL  GGD+I +  
Sbjct: 168 IGKSHTDIIPIIDYTPLSFLASTLPMGGDNINKFL 202

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 464 ETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSA 523
           E   +VL       A+ +   ++ + Y +G  T+ CV++ G        + +G  L  S 
Sbjct: 125 EVMAQVLFETFNLPALYVSNPAVLSLYASG-RTTGCVIDCGEGYCSTVPIYDGFALPASM 183

Query: 524 ITLDYGGDDITRLFALFLLQS 544
           + +D GG DIT+     L +S
Sbjct: 184 MRMDIGGRDITKQLQFQLRKS 204

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 464 ETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSA 523
           E   +V+       A+ +   ++ + Y +G  T+ CVV+ G        + +G  L  S 
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPAVLSLYASG-RTTGCVVDCGEGYCSSVPIYDGFALPASI 183

Query: 524 ITLDYGGDDIT 534
           + +D GG DIT
Sbjct: 184 MRMDIGGGDIT 194

>YDL206W Chr4 (90176..92464) [2289 bp, 762 aa] {ON} Putative protein
           of unknown function; YDL206W is not an essential protein
          Length = 762

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/154 (20%), Positives = 64/154 (41%), Gaps = 19/154 (12%)

Query: 419 AELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETF---IRVLLTELQ 475
           +++I  V  LL  A  S+ +++       +  V  I +      + T+   I  L++ + 
Sbjct: 588 SDIIFTVAFLLSLACLSKAVHIIVVTLTHWINVFNISETILGLTIFTWGNSIGDLVSNIT 647

Query: 476 FQAVAIIQESLATCYGA-------GISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDY 528
           F  + +++ ++  C+G+       G+     ++ +G    +I    +  +L H    +D+
Sbjct: 648 FVKIGVLEIAIGACFGSPLLYFLFGVGFDGIMIMLGDKTGKIVSGRDSNILMHH---IDF 704

Query: 529 GGD------DITRLFALFLLQSDFPLQDWKIDSK 556
             D       +  L A  +     PL DWKID K
Sbjct: 705 KVDKNLINTGVGILIAFLIFTVLIPLNDWKIDKK 738

>KAFR0I00250 Chr9 complement(53495..55828) [2334 bp, 777 aa] {ON}
           Anc_7.21 YAL047C
          Length = 777

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 639 DLFTNELNDWNSLSQFESKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYG----- 693
           D+  NEL   N    FE     L  DLN+ LK  N       ++DQL D  +NY      
Sbjct: 549 DVQINELTSTNK--NFEDLVAQLKTDLNE-LKTSN-----EELLDQLDDNKKNYDTSMNQ 600

Query: 694 -NTLKENFAPLEKAIVQSIANASITADVTRMN--SFYSNILI 732
            N LK N A LE  +++  A  S  +DV  M+   F +NI+I
Sbjct: 601 LNELKSNNALLEHLLLKQKAQQSRLSDVNEMDFKKFNNNIMI 642

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 463 VETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHS 522
           VE ++ +   +L+   + I+ E L      G S+S  V+++GA    +  + +GT+L +S
Sbjct: 135 VENYMELAFEKLKVPVLQIVVEPLGIMLSTGKSSS-LVIDVGATGCTVTPIIDGTILRNS 193

Query: 523 AITLDYGGD 531
            +   + GD
Sbjct: 194 IVKSRFAGD 202

>TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 461
           aa] {ON} Anc_2.593 YMR033W
          Length = 461

 Score = 35.0 bits (79), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%)

Query: 450 VVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETR 509
           +++V    + +  +E   + +   LQ     ++  SLA+ Y      + C+++IG   T 
Sbjct: 110 LLMVAHHSWSQIQLEVITQFVFEALQINNALLLPASLASSYAMSSLQNCCIIDIGTTHTD 169

Query: 510 IACVDEGTVLEHSAITLDYGG 530
           I  + + T LE  +  + YGG
Sbjct: 170 IIPIIDYTPLEALSSKIAYGG 190

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 59/138 (42%), Gaps = 4/138 (2%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P  + + +   D+  + ++  + +TL ++    N++ +++  P +   ++ + 
Sbjct: 71  GILKLRHPMLRGVVQNWDDMETIWQYVFD-DTLYLE--NLNEHPILITEPPLNNMANRQK 127

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
               L     F AV I    + + Y +G  T+ C V+ G        V  G  L  S   
Sbjct: 128 MCEALFEIFGFPAVYISVSPVLSLYASG-QTTGCAVDCGDGYCTSIPVYNGFSLASSVKK 186

Query: 526 LDYGGDDITRLFALFLLQ 543
           +D GG DIT      +L+
Sbjct: 187 IDIGGCDITEQLQFSILK 204

>KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033W ARP9
           Actin-related protein
          Length = 432

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%)

Query: 463 VETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHS 522
           +ET  + +  +LQ      +  +LA+ Y  G   +  V++I    T +  + +   L H 
Sbjct: 97  LETIAQFVFEQLQINNFMFLPSALASSYALGSLQNCVVIDIHTNGTDVIPILDYIQLGHL 156

Query: 523 AITLDYGGDDITRLFALFLLQ 543
           A+ +++GG  I +  A  L Q
Sbjct: 157 AVKVEHGGSQIDQELAKLLPQ 177

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 34.7 bits (78), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 464 ETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSA 523
           E   +VL       A+ +   ++ + Y +G  T+ CVV+ G        + +G  L  S 
Sbjct: 125 EQMAQVLFETFDVSALYVSNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASM 183

Query: 524 ITLDYGGDDIT 534
           + +D GG DIT
Sbjct: 184 MRMDIGGADIT 194

>SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 aa]
           {ON} similar to uniprot|Q05123 Saccharomyces cerevisiae
           YMR033W ARP9 Actin-related protein
          Length = 466

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 444 KFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNI 503
           + N    +LV    + +SH+E   + +   L+  +  I+  +LAT Y  G   ++ V+++
Sbjct: 104 ELNNIPFLLVSHHSWTRSHIEQITQYVFELLEINSFMILPLALATTYAFGSLQNSLVIDV 163

Query: 504 GAAETRIACVDEGTVLEHSAITLDYGGDDI 533
           G  +T +  + + T +   + TL  G   I
Sbjct: 164 GLEKTDLVPILDYTPIGFLSTTLRKGSTSI 193

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 444 KFNQYKVVLVIP---DIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCV 500
           K +++ +V+ +P   D      +E +  +   +     + +I E LA     G S S  V
Sbjct: 95  KSDEFPLVITVPIMKDAVALRVMERYFDLAFNKFNVPVLQVIIEPLAIALSMGKS-SALV 153

Query: 501 VNIGAAETRIACVDEGTVLEHSAITLDYGGD 531
           V++G++   +  V +GTV ++S +   Y GD
Sbjct: 154 VDLGSSSCNVTPVIDGTVAKNSVLKSKYAGD 184

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 122/320 (38%), Gaps = 50/320 (15%)

Query: 467 IRVLLTELQFQAVAIIQESLATCYGAGISTSTC-VVNIGAAETRIACVDEGTVLEHSAIT 525
           + +LL  LQF+A  +   S  TC         C VV++G   T ++ V +G  L  S + 
Sbjct: 128 LEILLESLQFEACYL--SSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMR 185

Query: 526 LDYGGDDITRLFALFLLQSDF-PLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNF 584
               G+ I  L    L   D  PL  ++I  +      E  KK F    D  +   LYN+
Sbjct: 186 NFLAGNCINELIKKPLKGKDLVPL--FEIAQRK----PEFKKKTF----DYQIHPSLYNY 235

Query: 585 MN-RSPNQPTEKYEFKLFDEVMLAPLALFFPQIFKLIRTSSHKNSSLEF----------- 632
            N R   Q  ++       +V  +PL     Q+  + + S     + E            
Sbjct: 236 ANSRGFLQECKE----TLCQVAPSPLDKMDSQLESMAKRSIEAPWAEELVFDNKTRFGFA 291

Query: 633 ---------QLPESRDLFTNEL-----NDWNSLSQFESKEGNLYCDLNDDLKILNRILDA 678
                    +LPE+  L  + +     ND+  L + +   G      N++ +       A
Sbjct: 292 EQLFAPQKDELPENWPLSKDGIVETWHNDYVPLKRNKPNGGKPEKQNNEEGESA-----A 346

Query: 679 HNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITA-DVTRMNSFYSNILIVGGSS 737
           H      +   EN    L+E+    + A    + NASI A DV    +   NI++ GG+S
Sbjct: 347 HEDDTATETPNENGKRPLEESVTGSDIAGAADLVNASILASDVDLRATLAHNIVLTGGTS 406

Query: 738 KIPALDFILTDRINIWRPSL 757
            IP     L   +N   P+L
Sbjct: 407 SIPGFSDRLMSELNKKLPAL 426

>Skud_4.260 Chr4 (453509..454183) [675 bp, 225 aa] {ON} YDR007W
           (REAL)
          Length = 225

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 611 LFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYC 663
           L FP+   ++ ++  + + L   L +S    T EL DWNS+S + +++GN  C
Sbjct: 120 LVFPRDCDILLSTPSEKTHLFMPLFDSEAGGTGELLDWNSISDWFAEQGNPEC 172

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 2/104 (1%)

Query: 444 KFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNI 503
           +  ++ VVL       K   E    VL  +    A+   ++ + + YG G +T  C V+ 
Sbjct: 103 QLQEHPVVLTNSMSTSKKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTG-CSVSC 161

Query: 504 GAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDFP 547
           G     I  V +G ++  S+   + GG  +T    L LL+ + P
Sbjct: 162 GHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTM-LDLLRHNHP 204

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 454 IPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACV 513
           +PD  +  ++E    + L  L+     ++ E LA     G +T+  VV++GAA++ +  +
Sbjct: 98  LPDAVRAQYLE----MALGRLKIPVFQLVVEPLAVALSLGRNTA-LVVDVGAAKSTVTPI 152

Query: 514 DEGTVLEHSAITLDYGGD 531
            +GTV++ +     + GD
Sbjct: 153 IDGTVVQTAVARSKFAGD 170

>TPHA0L01180 Chr12 complement(244127..246157) [2031 bp, 676 aa] {ON}
           Anc_8.458 YDL206W
          Length = 676

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 5/97 (5%)

Query: 470 LLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAA--ETRIACVDEGTVL-EHSAITL 526
           L++ + F  V I   +L+ C+G+ +    C + +       ++    +G++   H    L
Sbjct: 564 LISNVMFVQVGIFDIALSACFGSPLLYFVCGLGVNGIILLLKLTSKTDGSIFNSHLKFEL 623

Query: 527 D--YGGDDITRLFALFLLQSDFPLQDWKIDSKHGWLL 561
           D  +       + A+ +L    PL +WKID K  +LL
Sbjct: 624 DAHFKVTSFGTICAILVLIGIVPLNNWKIDRKISFLL 660

>TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574
           YFR050C
          Length = 265

 Score = 33.1 bits (74), Expect = 2.7,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 53/117 (45%), Gaps = 2/117 (1%)

Query: 643 NELNDWNSLSQFESKEGNLYCDLNDDLKILNRILDAHNIIDQLQD--KPENYGNTLKENF 700
           + L  + SL +F   E  +    N  + +   + D  +I   L++     NY NT  E+F
Sbjct: 58  DNLASYGSLLRFNGIERLIKVGQNTVVGVSGDVSDMQHIERLLEEIETDNNYDNTYSESF 117

Query: 701 APLEKAIVQSIANASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSL 757
             L+ + V    +A + +  ++MN  ++ I++ G  +  P + ++    +    P+L
Sbjct: 118 EQLQPSYVFKYLSAVMYSRRSKMNPLWNAIIVAGVENGAPFMRYVNLLGVTYTSPTL 174

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 450 VVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETR 509
           +V+ +P          ++ + L +L+     ++ E LA     G +TS  VV+IGA++  
Sbjct: 93  LVITVPPDLSAGTRSKYLELALEKLKVPVFQMVVEPLAISLSLGRNTS-LVVDIGASKIT 151

Query: 510 IACVDEGTVLEHSAITLDYGGD 531
           +  + +G+V++ + +   + GD
Sbjct: 152 VTPIIDGSVVKPAVLRSKFAGD 173

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 455 PDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVD 514
           PD+   S +E +  +   +L+     I+ E LA     G S S  V+++GA+   +  + 
Sbjct: 115 PDM---SILERYYELAFDKLKVPVFQIVIEPLAIALSMGKS-SAFVIDMGASGCNVTPII 170

Query: 515 EGTVLEHSAITLDYGGD 531
           +G V++++ +   +GGD
Sbjct: 171 DGIVVKNAVVRSKFGGD 187

>TBLA0C04920 Chr3 (1195902..1200074) [4173 bp, 1390 aa] {ON}
           Anc_3.522 YER032W
          Length = 1390

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 20/152 (13%)

Query: 690 ENYGNTLKENFAPLEKAIVQSIANASITADVT--RMNSFYSNILIVGGSSKIPALDFILT 747
           +N GN+LK   +   + +  + +N +I +D+T  +  S  SN L    +S  P    +  
Sbjct: 602 KNEGNSLKLMVSSPLRNMESAYSNDNINSDITPTKTKSNSSN-LSFAATSTPPTSSLVAP 660

Query: 748 DR--INIWRPSLLSSA--SFPQFYKKL----------TKEIKDLEGHYVNAPDKTEDENK 793
            R  + + R SLL+++  S P     L            E+K++E HY++     E  N+
Sbjct: 661 SRSPLRLNRNSLLNTSHISIPDSTNDLDTNSPEMMFNNNEVKNMENHYLSDSHSQETTNQ 720

Query: 794 Q---ILQAQIKEKIVEELEEQHQNIEHQNGNE 822
               +L + + E I +  E  H      N NE
Sbjct: 721 NGVSLLTSHLNEDIHQNKEPSHTTYTQDNTNE 752

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 22/112 (19%)

Query: 446 NQYKVVL---VIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVN 502
           N+ K+V+   V+ D+ KK        VLL  L   +V  + + L  C   G+ T   VV+
Sbjct: 58  NRLKIVILENVLLDVPKKKR---LCHVLLDRLMVSSVVFLPDILMACVAGGV-TDAIVVD 113

Query: 503 IGAAETRIACVDEGTVLE-HSAI--------------TLDYGGDDITRLFAL 539
           IG   T +A + +  +LE H  I              T +  G+ I R+  L
Sbjct: 114 IGWENTVVAPIMDMRILEQHMGISKIGAKWIGSKLSSTFEIDGEKIVRMIKL 165

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

Query: 463 VETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHS 522
           V  +  +   +L+   + I+ E LA       S S  V++IGA E +I  V +GTV++  
Sbjct: 119 VHKYFELAFEKLRVPTLQIVVEPLAIALSMSKS-SALVIDIGARECKITPVIDGTVVKSG 177

Query: 523 AITLDYGGD----DITRLFALFLLQSDFPLQDW 551
            +   + GD     +T L    L  ++   Q W
Sbjct: 178 VMKSKFAGDFLDFQVTELLKDRLPPAESSCQMW 210

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 463 VETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHS 522
           +E +  +   +L      I+ E LA     G S S  V++IGA+   +  + +G V++++
Sbjct: 120 LERYYELAFDKLNVPVFQIVIEPLAIALSMGKS-SAFVIDIGASGCNVTPIIDGIVVKNA 178

Query: 523 AITLDYGGD 531
            +   +GGD
Sbjct: 179 VVRSKFGGD 187

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 706 AIVQSIANASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSL 757
            IV  I+++  + DV    S   N++I GGSS IP L   + + +N+  P+L
Sbjct: 388 GIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPAL 439

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 10/124 (8%)

Query: 445 FNQYKVVLVIPDIFK-KSHVETFIRVLLTELQFQAVAI-----IQESLATCYGAGISTST 498
             +Y ++ ++P I K K  +E  I+    +L F+   I     I   LA  +  G   S 
Sbjct: 113 MTEYPLLALMPVIGKDKKELEKQIKEEYYKLAFEKFRIPILYLIPSPLAIAFSLG-KKSA 171

Query: 499 CVVNIGAAETRIACVDEGTVLEHSAITLDYGGD--DITRLFALFLLQSDFPLQDWKIDSK 556
            VV+IGA   ++  + +GT+++ + +   + GD  D   +  L L+++     + KIDS 
Sbjct: 172 LVVDIGAKTCQVTPILDGTIIKDAVMKSKFAGDFLDYQIMKKLNLIETSTDANN-KIDSL 230

Query: 557 HGWL 560
             WL
Sbjct: 231 KIWL 234

>Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/96 (19%), Positives = 41/96 (42%)

Query: 450 VVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETR 509
           ++L+    + +S +E   + +   L+   +  +  SLA  Y      + C++++G   T 
Sbjct: 111 LLLITHHFWSQSDLERITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTD 170

Query: 510 IACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSD 545
           +  + +   L+H   ++  GG  I       L Q D
Sbjct: 171 VIPIVDYAQLDHLVSSIPMGGQSINESLKKLLPQWD 206

>YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa]
           {ON}  ARP9Component of both the SWI/SNF and RSC
           chromatin remodeling complexes; actin-related protein
           involved in transcriptional regulation
          Length = 467

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 68/171 (39%), Gaps = 16/171 (9%)

Query: 379 DDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSL----AELISDVTKLLEHALN 434
           D S  Y+ ++     D K  + KP + G     S + + L      ++SD     + A  
Sbjct: 48  DGSYTYHSTNK----DNKAELIKPIQNGEIIDISAFTQFLRLIFVSILSDRANKNQDAFE 103

Query: 435 SETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGI 494
           +E  N+         ++L+    + +S +E   + +   L+   +  +  SLA  Y    
Sbjct: 104 AELSNIP--------LLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMIS 155

Query: 495 STSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSD 545
             + C++++G   T I  + +   L+H   ++  GG  I       L Q D
Sbjct: 156 LQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWD 206

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 450 VVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETR 509
           V  V PD+   +    ++ + L  L+     ++ E LA     G +T+  +V++GAA+  
Sbjct: 47  VATVAPDLPAAARAR-YLEMALGRLKIPVFQLVVEPLAVALSLGRNTA-LIVDLGAAKAT 104

Query: 510 IACVDEGTVLEHSAITLDYGGD 531
           +  V +GTV++ +     + GD
Sbjct: 105 VTPVIDGTVVQAAIGRSRFAGD 126

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/136 (18%), Positives = 56/136 (41%), Gaps = 4/136 (2%)

Query: 406 GSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVET 465
           G   ++ P    + +  SD+  +  +  N    +++      + +++    +  +++ E 
Sbjct: 65  GLLKLRHPVEHGIVKNWSDMEHIWSYVFNK---SLQLQNVEDHPILITEAPLNPRNNRER 121

Query: 466 FIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAIT 525
              +L       A+ +  +++ + Y +G  T+ CVV+ G        V +G  +  S   
Sbjct: 122 MCELLFESFNVPALYVSIQAVLSLYASG-RTTGCVVDCGDGCCHAVPVFDGFSIPSSIRR 180

Query: 526 LDYGGDDITRLFALFL 541
           +D  G DIT    L L
Sbjct: 181 IDIAGRDITEFLQLLL 196

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,642,503
Number of extensions: 4190692
Number of successful extensions: 17992
Number of sequences better than 10.0: 168
Number of HSP's gapped: 18466
Number of HSP's successfully gapped: 194
Length of query: 881
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 762
Effective length of database: 39,836,145
Effective search space: 30355142490
Effective search space used: 30355142490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)