Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR140W (SFL1)5.476ON76676631670.0
Smik_15.3195.476ON76272726640.0
Skud_15.3035.476ON74872926220.0
Suva_8.1915.476ON75873424720.0
ZYRO0D11286g5.476ON7171453946e-39
TDEL0A034005.476ON8101523931e-38
NCAS0H022805.476ON6571433901e-38
NDAI0C013805.476ON7671423893e-38
KNAG0B040405.476ON8521513842e-37
Kwal_55.212545.476ON8531393726e-36
CAGL0I07183g5.476ON7711423521e-33
KLTH0F14982g5.476ON8281423503e-33
Ecym_23125.476ON7563663466e-33
SAKL0G03586g5.476ON8532783451e-32
KLLA0E03191g5.476ON7701453342e-31
AFR136C5.476ON6951433314e-31
TPHA0A052505.77ON6011481895e-14
NDAI0D034304.385ON597801852e-13
Skud_7.2086.209ON836641825e-13
TDEL0G010105.77ON3981431761e-12
KAFR0C022506.209ON613641762e-12
KNAG0F020206.209ON771641772e-12
ZYRO0G08734g6.209ON572651743e-12
YGL073W (HSF1)6.209ON833641754e-12
TDEL0E051706.209ON546641734e-12
NCAS0A064504.385ON6091471735e-12
KAFR0B044105.77ON465661725e-12
Smik_7.2096.209ON837641736e-12
YHR206W (SKN7)4.385ON622741727e-12
SAKL0H02354g5.77ON385701689e-12
TPHA0H011305.77ON439661699e-12
Suva_7.1976.209ON846641719e-12
Skud_8.2734.385ON623731701e-11
TBLA0A020006.209ON627771701e-11
Smik_8.2964.385ON625731701e-11
KLLA0D03322g6.209ON677831691e-11
SAKL0A04576g6.209ON557641691e-11
KNAG0M001804.385ON615711692e-11
KAFR0B069904.385ON545641672e-11
Kwal_56.240366.209ON567641673e-11
KLTH0D17182g4.385ON464641663e-11
Kpol_1062.85.77ON433661653e-11
NCAS0D037806.209ON760641673e-11
KLTH0H04290g6.209ON569641663e-11
CAGL0F08195g5.77ON325711624e-11
TBLA0G02700singletonON445771635e-11
NCAS0E038705.77ON393701626e-11
Kpol_1033.466.209ON717641646e-11
Suva_15.4124.385ON617641637e-11
Kwal_47.167704.385ON461641628e-11
Kpol_265.24.385ON549691629e-11
Ecym_22086.209ON529641629e-11
SAKL0B12408g4.385ON465641601e-10
TDEL0D003204.385ON547641611e-10
NDAI0B009405.77ON526661601e-10
KLLA0A05368g5.77ON4121431582e-10
KLLA0A10219g4.385ON475641592e-10
Suva_7.5445.77ON469661592e-10
KNAG0K004705.77ON4141441582e-10
CAGL0H03443g6.209ON706641592e-10
ADL388W4.385ON482731583e-10
TBLA0A107004.385ON587641583e-10
KLTH0H00814g5.77ON3901521563e-10
ZYRO0G00484g4.385ON647641583e-10
AFL085C6.209ON569641583e-10
NDAI0I011106.209ON905641584e-10
Smik_16.585.77ON453661564e-10
TPHA0C001504.385ON510641564e-10
ZYRO0C11506g5.77ON334671535e-10
TBLA0E049804.385ON791651567e-10
TPHA0E028806.209ON718641557e-10
Ecym_74744.385ON496731548e-10
YGR249W (MGA1)5.77ON456701539e-10
CAGL0F09097g4.385ON630641541e-09
AEL216C5.77ON4501401502e-09
Skud_7.5825.77ON452661492e-09
Ecym_55735.77ON572701459e-09
Kpol_1050.795.77ON433661271e-06
Suva_12.2414.385ON349661126e-05
Skud_10.3734.385ON346641054e-04
YJR147W (HMS2)4.385ON35870960.006
Smik_10.4424.385ON34763860.097
AGR381C2.315ON33589770.99
TPHA0L019802.639ON55637781.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR140W
         (766 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}  SFL1Trans...  1224   0.0  
Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140...  1030   0.0  
Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...  1014   0.0  
Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...   956   0.0  
ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some s...   156   6e-39
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...   155   1e-38
NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476    154   1e-38
NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {O...   154   3e-38
KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {O...   152   2e-37
Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {...   147   6e-36
CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {...   140   1e-33
KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]...   139   3e-33
Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}...   137   6e-33
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...   137   1e-32
KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some s...   133   2e-31
AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON} S...   132   4e-31
TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5...    77   5e-14
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     76   2e-13
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    75   5e-13
TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {O...    72   1e-12
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    72   2e-12
KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {O...    73   2e-12
ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} simila...    72   3e-12
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    72   4e-12
TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.2...    71   4e-12
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    71   5e-12
KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.7...    71   5e-12
Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W ...    71   6e-12
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    71   7e-12
SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {...    69   9e-12
TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.7...    70   9e-12
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    70   9e-12
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    70   1e-11
TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.2...    70   1e-11
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    70   1e-11
KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {...    70   1e-11
SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {...    70   1e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    70   2e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    69   2e-11
Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073...    69   3e-11
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    69   3e-11
Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON...    68   3e-11
NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209     69   3e-11
KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {...    69   3e-11
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    67   4e-11
TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON}               67   5e-11
NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77      67   6e-11
Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON} (1155...    68   6e-11
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    67   7e-11
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    67   8e-11
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    67   9e-11
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    67   9e-11
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    66   1e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    67   1e-10
NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {O...    66   1e-10
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    65   2e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    66   2e-10
Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W ...    66   2e-10
KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON...    65   2e-10
CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly...    66   2e-10
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    65   3e-10
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    65   3e-10
KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON...    65   3e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    65   3e-10
AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON} S...    65   3e-10
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    65   4e-10
Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {O...    65   4e-10
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    65   4e-10
ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some s...    64   5e-10
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    65   7e-10
TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {O...    64   7e-10
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    64   8e-10
YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protei...    64   9e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    64   1e-09
AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON} S...    62   2e-09
Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W ...    62   2e-09
Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar...    60   9e-09
Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON} (1714...    54   1e-06
Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147...    48   6e-05
Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147...    45   4e-04
YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Prote...    42   0.006
Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147...    38   0.097
AGR381C Chr7 complement(1435245..1436252) [1008 bp, 335 aa] {ON}...    34   0.99 
TPHA0L01980 Chr12 (414853..416523) [1671 bp, 556 aa] {ON} Anc_2....    35   1.1  

>YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}
           SFL1Transcriptional repressor and activator; involved in
           repression of flocculation-related genes, and activation
           of stress responsive genes; negatively regulated by
           cAMP-dependent protein kinase A subunit Tpk2p
          Length = 766

 Score = 1224 bits (3167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/766 (81%), Positives = 624/766 (81%)

Query: 1   MSEEETVXXXXXXXXXXXXGTDVXXXXXXXXXXXXXXXXXXXXEDVKKHGSKMLVGPRPP 60
           MSEEETV            GTDV                    EDVKKHGSKMLVGPRPP
Sbjct: 1   MSEEETVSAPAPASTPAPAGTDVGSGGAAAGIANAGAEGGDGAEDVKKHGSKMLVGPRPP 60

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 120
           QNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN
Sbjct: 61  QNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 120

Query: 121 IYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTK 180
           IYGFHKV                              KNSSGDENTGGGVQEKEKSNPTK
Sbjct: 121 IYGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSGNKNSSGDENTGGGVQEKEKSNPTK 180

Query: 181 IWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXXXXXYDIDSGARVRPSSIQD 240
           IWEFKHSSGIFKKGDIEGLKHIK                     YDIDSGARVRPSSIQD
Sbjct: 181 IWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSINSRKNSSNQNYDIDSGARVRPSSIQD 240

Query: 241 PSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPLESNNPEMQEQNRPPNFQDE 300
           PSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPLESNNPEMQEQNRPPNFQDE
Sbjct: 241 PSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPLESNNPEMQEQNRPPNFQDE 300

Query: 301 TLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKDHQKQLQAFES 360
           TLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKDHQKQLQAFES
Sbjct: 301 TLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKDHQKQLQAFES 360

Query: 361 DMLTFKQHVMSRAHRTIDSLCAVNXXXXXXXXXXXXXXXXXXXXXXKSQYEMMVPPGNQY 420
           DMLTFKQHVMSRAHRTIDSLCAVN                      KSQYEMMVPPGNQY
Sbjct: 361 DMLTFKQHVMSRAHRTIDSLCAVNAAATAASVAPAPAPTSTSAYAPKSQYEMMVPPGNQY 420

Query: 421 VPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQHVTYAKQPAHVPNFINXXXXXXXXX 480
           VPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQHVTYAKQPAHVPNFIN         
Sbjct: 421 VPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQHVTYAKQPAHVPNFINQPIPIQQLP 480

Query: 481 XXYADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPLTPAASVGVQGPLNYPIMNINP 540
             YADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPLTPAASVGVQGPLNYPIMNINP
Sbjct: 481 PQYADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPLTPAASVGVQGPLNYPIMNINP 540

Query: 541 SVRDYNKPVPQNMAPSPIYPINEPTTRLYSQPKMRSLGSTSSLPNDRRNSPLKLTPRSSL 600
           SVRDYNKPVPQNMAPSPIYPINEPTTRLYSQPKMRSLGSTSSLPNDRRNSPLKLTPRSSL
Sbjct: 541 SVRDYNKPVPQNMAPSPIYPINEPTTRLYSQPKMRSLGSTSSLPNDRRNSPLKLTPRSSL 600

Query: 601 NEDSLYPKPRNXXXXXXXXXXXXXXFTLVANNPAPIRYSQQGLLRSLNKAANCAPDSVTP 660
           NEDSLYPKPRN              FTLVANNPAPIRYSQQGLLRSLNKAANCAPDSVTP
Sbjct: 601 NEDSLYPKPRNSLKSSISGTSLSSSFTLVANNPAPIRYSQQGLLRSLNKAANCAPDSVTP 660

Query: 661 LDSSVLTGPPPKNMDNLPAVSSNLINSPMNVEHSSSLSQAEPAPQIEXXXXXXXXXXXXK 720
           LDSSVLTGPPPKNMDNLPAVSSNLINSPMNVEHSSSLSQAEPAPQIE            K
Sbjct: 661 LDSSVLTGPPPKNMDNLPAVSSNLINSPMNVEHSSSLSQAEPAPQIELPQPSLPTTSTTK 720

Query: 721 NTGEADNSKRKGSGVYSLLNQEDSSTSSADPKTEDKAAPALKKVKM 766
           NTGEADNSKRKGSGVYSLLNQEDSSTSSADPKTEDKAAPALKKVKM
Sbjct: 721 NTGEADNSKRKGSGVYSLLNQEDSSTSSADPKTEDKAAPALKKVKM 766

>Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140W
           (REAL)
          Length = 762

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/727 (73%), Positives = 567/727 (77%), Gaps = 12/727 (1%)

Query: 44  EDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKAL 103
           EDVKKHGSKMLVGPRPPQNAIFIHKLYQILED+SLHDLIWW+PSGLSFMIKPVERFSKAL
Sbjct: 44  EDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKAL 103

Query: 104 ATYFKHTNITSFVRQLNIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGD 163
           ATYFKHTNITSFVRQLNIYGFHKV                              KN+SGD
Sbjct: 104 ATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGN------KNTSGD 157

Query: 164 ENTGGGVQEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXXXX 223
           EN G  VQEKE+SNPTKIWEFKHSSGIFKKGDIEGLKHIK                    
Sbjct: 158 ENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNSSSINSRKNSSNQ 217

Query: 224 XYDIDSGARVRPSSIQDPSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPLES 283
            YD DSG R RPSS+QDPSTSS++FGNFVPQIP ANN+IPE FNNSHVTYEN +H  LE 
Sbjct: 218 NYDTDSGVRARPSSVQDPSTSSSAFGNFVPQIPSANNTIPECFNNSHVTYENLSHGALEY 277

Query: 284 NNPEMQEQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKK 343
           NNP+MQEQ++PP+FQDE LKHLK+IN DMVKIIESMQHFISLQHSFCSQSFTFKNVSKKK
Sbjct: 278 NNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKK 337

Query: 344 SENIVKDHQKQLQAFESDMLTFKQHVMSRAHRTIDSLCAVNXXXXXXXXXXXXXXXXXXX 403
           SENIVK+HQKQL+AFE+DMLTFKQHVMSRAHRTIDSL A+N                   
Sbjct: 338 SENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLYAINSNAIATAPAPAPASISAYA 397

Query: 404 XXXKSQYEMMVPPGNQYVPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQH----VTY 459
              KSQY++MVPPGNQYVPQKSSS+TNIPSRFNT+SVPPSQLFVQYQ Q Q      +TY
Sbjct: 398 P--KSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFVQYQSQPQAQPQQYMTY 455

Query: 460 AKQPAHVPNFINXXXXXXXXXXXYADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPL 519
           AKQP H+PNF++           YADTFSTPQMMHNPFASKN NKPGNT+RTNSVLMDPL
Sbjct: 456 AKQPTHMPNFVHQPIPIQQLPPQYADTFSTPQMMHNPFASKNTNKPGNTRRTNSVLMDPL 515

Query: 520 TPAASVGVQGPLNYPIMNINPSVRDYNKPVPQNMAPSPIYPINEPTTRLYSQPKMRSLGS 579
           TPAASVGVQ PLNYPIMNINP  RDYNK VPQNMAPSPIYPINEPTTRLYSQPKMRSLGS
Sbjct: 516 TPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRLYSQPKMRSLGS 575

Query: 580 TSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNXXXXXXXXXXXXXXFTLVANNPAPIRYS 639
           TSSLPNDR+NSPLKLTPR SLNEDSLYPKPRN               TLVANNPAPIRYS
Sbjct: 576 TSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRNSLKSSTSGTSLSSSLTLVANNPAPIRYS 635

Query: 640 QQGLLRSLNKAANCAPDSVTPLDSSVLTGPPPKNMDNLPAVSSNLINSPMNVEHSSSLSQ 699
           QQGLLRSL+KAANCAPD  TPLDSSVLTGP PKNMDNLPAVSSNLINSPMNV+H SS+S 
Sbjct: 636 QQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSPMNVDHGSSISH 695

Query: 700 AEPAPQIEXXXXXXXXXXXXKNTGEADNSKRKGSGVYSLLNQEDSSTSSADPKTEDKAAP 759
           AE    IE            K T EADNSKR GS VYSLLN+ED+  SS D KTE+KA P
Sbjct: 696 AESISSIEVPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASSTDFKTEEKATP 755

Query: 760 ALKKVKM 766
            LKKVKM
Sbjct: 756 VLKKVKM 762

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/729 (71%), Positives = 559/729 (76%), Gaps = 12/729 (1%)

Query: 44  EDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKAL 103
           EDVKKHGSKMLVGPRPPQNAIFIHKLYQILED+SLHDLIWW+ SGLSFMIKPVERFSKAL
Sbjct: 26  EDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKAL 85

Query: 104 ATYFKHTNITSFVRQLNIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGD 163
           ATYFKHTNITSFVRQLNIYGFHKV                              KNSSG+
Sbjct: 86  ATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVNSTNDDGGGSKNSSGE 145

Query: 164 ENTGGGVQEKEK--SNPTKIWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXX 221
           EN G  VQEKEK  SNPTKIWEFKHSSGIFKKGDIEGLKHIK                  
Sbjct: 146 ENNGATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSINSRKNSS 205

Query: 222 XXXYDIDSGARVRPSSIQDPSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPL 281
              YD DSG R RPSSIQDP+ +SN F N+VPQI GANN IPE FNNSHV YENA H P+
Sbjct: 206 NQNYDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYENATHGPM 265

Query: 282 ESNNPEMQEQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSK 341
           E NNPE QEQ RP +FQDETL HLKEIN DM+KIIESMQHFISLQH+FCS+SFTFKNVSK
Sbjct: 266 EFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSK 325

Query: 342 KKSENIVKDHQKQLQAFESDMLTFKQHVMSRAHRTIDSLCAVNXXXXXXXXXXXXXXXXX 401
           KKSENI+KDHQKQL+ FE+DMLTFKQHVMSRAHRT+DSL                     
Sbjct: 326 KKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSL------HAATATATAPALASS 379

Query: 402 XXXXXKSQYEMMVPPGNQYVPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQ----HV 457
                KSQY+MMVPPGNQYVPQKSSS+TNIPSRFNT+SVPPSQ FVQYQPQ Q     H+
Sbjct: 380 SACAPKSQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQFFVQYQPQPQLQPQQHM 439

Query: 458 TYAKQPAHVPNFINXXXXXXXXXXXYADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMD 517
            Y+KQPAH+PNFIN           YADTF+TPQMMHNPFASKN +KPGNTKRTNSVLMD
Sbjct: 440 AYSKQPAHMPNFINQPIPIQQLPPQYADTFNTPQMMHNPFASKNGHKPGNTKRTNSVLMD 499

Query: 518 PLTPAASVGVQGPLNYPIMNINPSVRDYNKPVPQNMAPSPIYPINEPTTRLYSQPKMRSL 577
           PLTPA SVG+QG LNYPIMNINP+VRDYNK VPQNMAPSPIYPINEPTTR+YSQPKMRSL
Sbjct: 500 PLTPATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYSQPKMRSL 559

Query: 578 GSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNXXXXXXXXXXXXXXFTLVANNPAPIR 637
           GSTSSLPNDRRNSPLKLTPRSSLNEDSLY KP+N              FTLV+NNPAPIR
Sbjct: 560 GSTSSLPNDRRNSPLKLTPRSSLNEDSLYSKPKNSLKSSISGTSLSSSFTLVSNNPAPIR 619

Query: 638 YSQQGLLRSLNKAANCAPDSVTPLDSSVLTGPPPKNMDNLPAVSSNLINSPMNVEHSSSL 697
           YSQQGLLRSLNKAANC PDSV PLDS+VLTGP PKNMDNLPA+SSNLINSPMNVEH +SL
Sbjct: 620 YSQQGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMNVEHGTSL 679

Query: 698 SQAEPAPQIEXXXXXXXXXXXXKNTGEADNSKRKGSGVYSLLNQEDSSTSSADPKTEDKA 757
           S  EP P IE            K   E DN+KR GSGVYSLLNQE+S +S+ADP+ +++ 
Sbjct: 680 SHPEPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNADPRAKEET 739

Query: 758 APALKKVKM 766
           AP  KKV+M
Sbjct: 740 APPSKKVRM 748

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/734 (67%), Positives = 546/734 (74%), Gaps = 26/734 (3%)

Query: 44  EDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKAL 103
           EDVKKHGSK LVGPRPPQNAIFIHKLYQILED+SLHDLIWW+PSGLSFMIKPVERFSKAL
Sbjct: 40  EDVKKHGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKAL 99

Query: 104 ATYFKHTNITSFVRQLNIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGD 163
           ATYFKHTNITSFVRQLNIYGFHKV                              KNSSGD
Sbjct: 100 ATYFKHTNITSFVRQLNIYGFHKVSHDHTSNDTNSGDDGNTNDDANATDDNGGNKNSSGD 159

Query: 164 ENTGGGVQEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXXXX 223
           E TG G QEKEKSNPTKIWEFKHSSGIFKKGDIE LKHIK                    
Sbjct: 160 ETTGAGAQEKEKSNPTKIWEFKHSSGIFKKGDIESLKHIKRRASSRNNSSINSRKNSSNQ 219

Query: 224 XYDIDSGARVRPSSIQDPSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPLES 283
            YDI+S  R RP+SIQDP ++S++F N+VPQI GA++SIPE F  SHV YENANH PLE 
Sbjct: 220 NYDIESTIRARPASIQDPVSASSAFSNYVPQISGASSSIPECF--SHVPYENANHGPLEF 277

Query: 284 NNPEMQEQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKK 343
           NNP+ QE ++P +FQDETL HLK+INFDM+KIIESMQHFISLQH+FCSQSFTFKNVSKKK
Sbjct: 278 NNPDTQETSKPLSFQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKK 337

Query: 344 SENIVKDHQKQLQAFESDMLTFKQHVMSRAHRTIDSLCAVNXXXXXXXXXXXXXXXXXXX 403
           SENI+KDHQ QL+ FESDMLTFKQHVMSRAHRTID+L +                     
Sbjct: 338 SENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHST---------AAATATGPTLV 388

Query: 404 XXXKSQYEMMVPPGNQYVPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQ-------- 455
              KSQYE+MVPP NQ+ PQKSS + +IPSRFNT+SVPPSQ F+QYQPQ Q         
Sbjct: 389 PAHKSQYEIMVPPNNQFGPQKSSLSASIPSRFNTSSVPPSQFFIQYQPQPQPQQQQQQQQ 448

Query: 456 ---HVTYAKQPAHVPNFINXXXXXXXXXXXYADTFSTPQMMHNPFASKNNNKPGNTKRTN 512
              H+ Y KQP H+ NFIN           YA+TF+TPQMMHNPFASKN++KPGNTKRTN
Sbjct: 449 QQQHMAYPKQPPHMQNFINQPIPIQQLPPQYAETFNTPQMMHNPFASKNSHKPGNTKRTN 508

Query: 513 SVLMDPLTPAASVGVQGPLNYPIMNINPSVRDYNKPVPQNMAPSPIYPINEPTTRLYSQP 572
           SVLMDPLTPAA    QGPLNYPIMN+NPS RDYNK VPQN APSPIYP+NEPTTRLYSQP
Sbjct: 509 SVLMDPLTPAA----QGPLNYPIMNVNPSARDYNKCVPQNRAPSPIYPMNEPTTRLYSQP 564

Query: 573 KMRSLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNXXXXXXXXXXXXXXFTLVANN 632
           KMR+LGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRN              FTLV+NN
Sbjct: 565 KMRTLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNSLKSSISGTSISSSFTLVSNN 624

Query: 633 PAPIRYSQQGLLRSLNKAANCAPDSVTPLDSSVLTGPPPKNMDNLPAVSSNLINSPMNVE 692
           PAPIRYSQQGLLRSLNKAANCAPDS TPLD S+L GP PKN+DNLP VSSNLINSPMNVE
Sbjct: 625 PAPIRYSQQGLLRSLNKAANCAPDSATPLDPSLLAGPTPKNIDNLPIVSSNLINSPMNVE 684

Query: 693 HSSSLSQAEPAPQIEXXXXXXXXXXXXKNTGEADNSKRKGSGVYSLLNQEDSSTSSADPK 752
           H +SLS  +P PQ+E            K   E D  +R GSGVYSLLN++DSS+++A+ K
Sbjct: 685 HGTSLSHPQPTPQMELPQPSLPTTNVTKGNDETDTIRRTGSGVYSLLNKDDSSSANANSK 744

Query: 753 TEDKAAPALKKVKM 766
            + +  PA KK ++
Sbjct: 745 AKGETTPASKKARL 758

>ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 717

 Score =  156 bits (394), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 95/145 (65%), Gaps = 14/145 (9%)

Query: 59  PPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 118
           P Q+ +FIHKLY ILED+ L DLIWW+PSGLSF+I+P+E+FS+ALATYFKHTNI SFVRQ
Sbjct: 73  PLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQ 132

Query: 119 LNIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNP 178
           LN+YGFHKV                               +S  + N+   VQE      
Sbjct: 133 LNMYGFHKV---------SNDHGKSSEHDSASNSRTNNSNSSDNNNNSNADVQED----- 178

Query: 179 TKIWEFKHSSGIFKKGDIEGLKHIK 203
            KIW+F+HS+G+FK+GDIEGLK+IK
Sbjct: 179 IKIWKFRHSTGLFKRGDIEGLKYIK 203

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 112/315 (35%), Gaps = 66/315 (20%)

Query: 241 PSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPL-ESNNPEMQEQNRPPNFQD 299
           PS +  SF N     P  NNS P         +  + +A L +S N    E N      D
Sbjct: 335 PSLTYTSFPNHPTAQPAPNNSDP---------FLESRYAELSQSYNVLRYEYNSLQYRHD 385

Query: 300 ETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKDHQKQLQAFE 359
           E L +LK +N DMV ++E ++  +++Q S                    +   ++    E
Sbjct: 386 EALGYLKGVNMDMVHVLELLESLVTIQTS-------------------SEPSPQEFSGLE 426

Query: 360 SDMLTFKQHVMSRAHRTIDSLCAVNXXXXXXXXXXXXXXXXXXXXXXKSQYEMMVPPGNQ 419
            ++L FK  +MSR HR  D+                           +    + VP  + 
Sbjct: 427 QELLRFKALLMSRVHRNSDAQV--------------QQPSQRSFGENRPLSSISVPTSHS 472

Query: 420 YVPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQHVTYAKQPAHVPNFINXXXXXXXX 479
            VP        +P+R       PS      QP S          A               
Sbjct: 473 NVPSLVQHVFAVPAR-------PSSAVNVVQPAS------TTGSASSAPVPAPTPAPPPP 519

Query: 480 XXXYADTFSTPQ-MMHNPFASKNNNKPGNTKRTNSVLMDPLTPAAS--VGVQGPLNYPIM 536
                D FS P+ MM NPF S  N     +KR  S+LMDPL PA +  +G+      P M
Sbjct: 520 PPQATDHFSGPRMMMMNPFESTGN----GSKRNMSILMDPLAPAPNLMLGMSPSHPQPFM 575

Query: 537 NINP---SVRDYNKP 548
           N +P   S   Y  P
Sbjct: 576 NSSPVTASAAGYRAP 590

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score =  155 bits (393), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 90/152 (59%), Gaps = 40/152 (26%)

Query: 59  PPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 118
           P QN +FIHKLY ILED+ L DLIWW+PSG SF+I+P ERFS+ALATYFKHTNI SFVRQ
Sbjct: 46  PLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQ 105

Query: 119 LNIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQ------- 171
           LN+YGFHKV                                 S D N G   Q       
Sbjct: 106 LNMYGFHKV---------------------------------SNDHNKGIQQQQQQQQPS 132

Query: 172 EKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIK 203
            +   +  KIWEF+HS GIFK+GDIEGLK IK
Sbjct: 133 SEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIK 164

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 299 DETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSE-NIVKDHQKQLQA 357
           DE L+ L+ +N DMVK+++ +Q F++LQ    S+ +   ++    S+ +  + HQ+++  
Sbjct: 309 DELLEQLRVLNTDMVKLLDFLQKFVTLQ-KLSSEVYHEASLKDDPSKLHQFQKHQQEMSY 367

Query: 358 FESDMLTFKQHVMSRAHRTIDSL 380
            E ++L FK ++M R  + + S 
Sbjct: 368 LEQEILRFKANLMQRLTKKLGSC 390

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 487 FSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPLTPA 522
           F+ P+MM NPF +    +  + KR  S+LMDPL+ A
Sbjct: 533 FAGPRMMMNPFET--TGQTSSVKRNMSILMDPLSSA 566

>NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476
          Length = 657

 Score =  154 bits (390), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/143 (56%), Positives = 94/143 (65%), Gaps = 21/143 (14%)

Query: 62  NAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N IFIHKLY ILED+ L DLIWW+ SG SF IKP E+FSKALATYFKHTNITSFVRQLNI
Sbjct: 47  NTIFIHKLYNILEDKDLEDLIWWSSSGQSFFIKPTEKFSKALATYFKHTNITSFVRQLNI 106

Query: 122 YGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPT-K 180
           YGFHKV                               N++ ++N   G + ++ +N T K
Sbjct: 107 YGFHKV--------------------SNDHQYINYPNNNNSNDNDSKGKEREDLTNETIK 146

Query: 181 IWEFKHSSGIFKKGDIEGLKHIK 203
           IWEFKHS+GIFKKGD+EGLK IK
Sbjct: 147 IWEFKHSAGIFKKGDVEGLKLIK 169

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 12/117 (10%)

Query: 491 QMMHNPFASKNNNKPGNTKRTNSVLMDPLTPAASVGVQGPLNYPIMNINPSVRDYNKPVP 550
           Q+M NPF   NN+   +TKR  SVL+DPLTP  SV    P+   + ++   +    +P P
Sbjct: 478 QIMQNPFERTNNSI--STKRNQSVLLDPLTPVVSVSSNNPMRNRVSSL---INTKTQPCP 532

Query: 551 -QNMAPSPIYPINEPTTRLYSQPKMRSLGSTSSLP-NDRRNSPLKLTPRSSLNEDSL 605
            ++ + +P++  N    +  SQ  +       +LP N   + P  L P +S  +DS+
Sbjct: 533 IESASNTPMHVSNHDLMKTRSQSSLY-----PNLPLNKLEDLPSNLAPITSTAKDSI 584

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 14/82 (17%)

Query: 297 FQDETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKDHQKQ-L 355
           F    +  L+ IN DM K+I  M++F++L       S  +K         I  D QKQ  
Sbjct: 302 FSVSEIDDLRSINQDMAKLIGFMEYFVTLH----LDSGKYK---------IDDDPQKQNW 348

Query: 356 QAFESDMLTFKQHVMSRAHRTI 377
           + F++++  FK +V+ R H  +
Sbjct: 349 ENFQNELANFKNNVIKRLHTKL 370

>NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {ON}
           Anc_5.476
          Length = 767

 Score =  154 bits (389), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 87/142 (61%), Gaps = 15/142 (10%)

Query: 62  NAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N IFIHKLY ILED+ L DLIWW+  G SF+I+P ERFSKALATYFKHTNITSFVRQLNI
Sbjct: 77  NTIFIHKLYNILEDKDLEDLIWWSNDGKSFLIRPTERFSKALATYFKHTNITSFVRQLNI 136

Query: 122 YGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTKI 181
           YGFHKV                                +  + +    + + E+    KI
Sbjct: 137 YGFHKVSNDHQYINNKTEDDTTTNVT------------NHANTDVNNNITDNEQ---VKI 181

Query: 182 WEFKHSSGIFKKGDIEGLKHIK 203
           WEFKHS+GIF+KGD+E LK IK
Sbjct: 182 WEFKHSAGIFRKGDVESLKLIK 203

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 295 PNFQDETLKH-LKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKDHQK 353
           P +  E+++  +K  N DM+K+I+ MQ F+SL +   +   +  ++     +N +K   +
Sbjct: 356 PQYTHESVEQTMKAANMDMIKLIDYMQKFVSLLNKNTNGIISEPSIGTSLKDNEMK---Q 412

Query: 354 QLQAFESDMLTFKQHVMSR 372
           Q   F+S++  FK+ ++SR
Sbjct: 413 QWDEFQSEITNFKRSILSR 431

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 491 QMMHNPFASKNNNKPGNTKRTNSVLMDPLTPA 522
           QMM NPF S N +   ++KR  SVL+DPLTP 
Sbjct: 557 QMMQNPFNS-NASSRYSSKRHRSVLLDPLTPV 587

>KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {ON}
           Anc_5.476 YOR140W
          Length = 852

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/151 (50%), Positives = 91/151 (60%), Gaps = 10/151 (6%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 120
           QN +FIHKLY ILED++L DLIWW P+G+SF I+P E FSK LATYFKHTNITSFVRQLN
Sbjct: 61  QNTVFIHKLYHILEDDALRDLIWWAPNGMSFYIRPNETFSKTLATYFKHTNITSFVRQLN 120

Query: 121 IYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEK------- 173
           IYGFHKV                                 S   +TG  V+ +       
Sbjct: 121 IYGFHKVTNWNDTAAFAAVSNDGRNNSLGALPGGPDMNTHS--PSTGVVVKSEPHTKSGP 178

Query: 174 -EKSNPTKIWEFKHSSGIFKKGDIEGLKHIK 203
              S+P KIWEFKHS+ +F++GDIEGLK IK
Sbjct: 179 GATSSPVKIWEFKHSANLFRRGDIEGLKFIK 209

>Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {ON}
           YOR140W (SFL1) - 1:1 [contig 130] FULL
          Length = 853

 Score =  147 bits (372), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 83/139 (59%), Gaps = 19/139 (13%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 124
           FIHKLY +LEDE +H+LIWW+PS  SF+I+P ERFSKALATYFKHTN+ SFVRQLN+YGF
Sbjct: 60  FIHKLYSMLEDEEMHELIWWSPSQTSFLIRPTERFSKALATYFKHTNVASFVRQLNMYGF 119

Query: 125 HKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTKIWEF 184
           HKV                              K       T GG   +   N T +WEF
Sbjct: 120 HKV----------------NDHKAHGAKSGAANKGEEAGLKTRGG---QPTDNSTSVWEF 160

Query: 185 KHSSGIFKKGDIEGLKHIK 203
           KHSS  F++GD+E LK IK
Sbjct: 161 KHSSAAFRRGDMESLKLIK 179

>CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {ON}
           some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140w SFL1
          Length = 771

 Score =  140 bits (352), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/142 (48%), Positives = 83/142 (58%), Gaps = 18/142 (12%)

Query: 62  NAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N +FI+KLY +LE++ L DLIWW  +G SF+I+P E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67

Query: 122 YGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTKI 181
           YGFHK+                               N+SGDEN              K+
Sbjct: 68  YGFHKI-----SNDHFHNLKREKKQKSSTDNNTGVSNNNSGDEN-------------IKV 109

Query: 182 WEFKHSSGIFKKGDIEGLKHIK 203
           WEFKHS G+FKKGD+E LK IK
Sbjct: 110 WEFKHSGGLFKKGDLENLKLIK 131

>KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]
           {ON} some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 828

 Score =  139 bits (350), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 80/142 (56%), Gaps = 25/142 (17%)

Query: 62  NAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121
           N  FIHKLY +LED  + +LIWW+P   SF+I+P ERF KALATYFKHTN+ SFVRQLN+
Sbjct: 71  NTAFIHKLYSMLEDPEMDELIWWSPPQTSFLIRPTERFGKALATYFKHTNVASFVRQLNM 130

Query: 122 YGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTKI 181
           YGFHKV                              KN +   +      E    N T I
Sbjct: 131 YGFHKV---------------------NDHKTHAASKNGAAKTDDPASKSE----NTTSI 165

Query: 182 WEFKHSSGIFKKGDIEGLKHIK 203
           WEFKHSS  F++GD+E LK IK
Sbjct: 166 WEFKHSSSAFRRGDMESLKLIK 187

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 484 ADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPLTPA 522
           A++ S P +M NPF  K +    +  R  SVLMDPL PA
Sbjct: 575 ANSGSMPYLMMNPFEKKTSTS-SSGNRNMSVLMDPLAPA 612

>Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AFR136C
          Length = 756

 Score =  137 bits (346), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 108/366 (29%), Positives = 160/366 (43%), Gaps = 92/366 (25%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 124
           FIHKLY +LEDE + DLIWW+ S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGF
Sbjct: 73  FIHKLYSMLEDEEMKDLIWWSESENSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGF 132

Query: 125 HKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTKIWEF 184
           HKV                              K+S  D   G G  E++  N   +WEF
Sbjct: 133 HKV-----------------------SDHKSNEKSSETDGAHGNGDIEEDSIN---LWEF 166

Query: 185 KHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXXXXXYDIDSGARVRPSSIQDPSTS 244
           +HS G F+KGD E LK IK                     +          ++ QDPS+ 
Sbjct: 167 RHSLGCFRKGDKESLKSIKRRSSKNQIVTARVSSTCGAPSH----------TACQDPSSW 216

Query: 245 SNSFGNF----VPQIPGANNSIPEYFNNSHV-----------------------TYENAN 277
           S++ G       P +P A      ++   +                        +++  N
Sbjct: 217 SDTGGCCGHVQSPDVPDAYYRGSMFYQLPYYEVLQQGQKQQQQYPFQPQLQELQSHDARN 276

Query: 278 HAPLESNNPE-MQEQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISLQH--------- 327
           H   + +    M  QNR     D  ++ L+  N DM+K+++ +Q  I +           
Sbjct: 277 HFDYKQHQLGLMTLQNR----YDNAIEELRATNMDMMKLLDLVQKAIWISTVPSASSNTS 332

Query: 328 ------SFCSQSFTFKNVSKKKSENIV--------KDHQKQ-LQAFESDMLTFKQHVMSR 372
                 S  S+  T  NVS +  +++V        K +QKQ  +    +++ FK  ++++
Sbjct: 333 AIAPGVSSGSRPSTPVNVSAQIGQDVVSPGYELSPKTNQKQYFEQLNQEIVKFKASILNK 392

Query: 373 AHRTID 378
             R ID
Sbjct: 393 LQRQID 398

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 490 PQMMHNPFASKNNNKPGNTKRTNSVLMDPLTPA 522
           P +M NPFA + + +    KR  SV MDPL P 
Sbjct: 472 PYLMMNPFAKRKSTESLPKKRHMSVFMDPLAPV 504

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score =  137 bits (345), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 129/278 (46%), Gaps = 46/278 (16%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 124
           FIHKLY +LED+ + DLIWW+P+  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGF
Sbjct: 45  FIHKLYSMLEDQEMKDLIWWSPTQDSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGF 104

Query: 125 HKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTKIWEF 184
           HKV                                   D+ +       E S    +WEF
Sbjct: 105 HKVNDNTGKQT---------------------------DKYSTDSASTNEDS--INLWEF 135

Query: 185 KHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXXXXXYDIDSGA---RVRPSSIQDP 241
           KHSS  F+KGD+EGLK IK                        +S     R   S+   P
Sbjct: 136 KHSSSAFRKGDMEGLKTIKRRSSRNPILARKNSSTASTPAEQSESWTDHNRHPLSNASAP 195

Query: 242 STSSNSFGNF----VPQIPGANNSIP-EYFN----NSHVTYEN----ANHAPLESNNPEM 288
             +S S+ N      PQ       +P EYF      SH   +N    + H     N   +
Sbjct: 196 EMNSQSYTNLRSISSPQHSNGMVYVPVEYFGVQPAASHNQQQNQVLDSKHNEGVQNTTSL 255

Query: 289 Q-EQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISL 325
           + EQ   P   D+T+  L+  N DM++++E ++ +  L
Sbjct: 256 KNEQANAPWNCDQTVYELRTTNMDMIRLLELIEKWFFL 293

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 483 YADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPL 519
           Y+ +  TP +M NPFA + ++      R  SVLMDPL
Sbjct: 541 YSGSSGTPYLMMNPFAKRKSSASSARNRHMSVLMDPL 577

>KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 770

 Score =  133 bits (334), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 81/145 (55%), Gaps = 35/145 (24%)

Query: 60  PQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQL 119
           PQN  FIHKLY +LED+ L +LIWW+PS  SF+I+P ERFSKAL+ +FKHTN+ SFVRQL
Sbjct: 83  PQNPHFIHKLYSMLEDDDLKNLIWWSPSCDSFLIRPTERFSKALSAFFKHTNVASFVRQL 142

Query: 120 NIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPT 179
           N+YGF KV                                   D  +       +   P+
Sbjct: 143 NMYGFQKV----------------------------------SDHKSTWAANTDDSDEPS 168

Query: 180 -KIWEFKHSSGIFKKGDIEGLKHIK 203
             +WEFKHSSG F+KGD E LK IK
Sbjct: 169 INLWEFKHSSGYFRKGDTESLKSIK 193

>AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR140W
           (SFL1)
          Length = 695

 Score =  132 bits (331), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 81/143 (56%), Gaps = 33/143 (23%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 120
            N  FIHKLY +LED+++ DLIWW+ S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN
Sbjct: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLN 82

Query: 121 IYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTK 180
           +YGFHKV                              K +S DE+               
Sbjct: 83  MYGFHKV----------------------SDHKPSSAKGTSQDEDEA-----------IN 109

Query: 181 IWEFKHSSGIFKKGDIEGLKHIK 203
           +WEF+HS G F+KGD E LK IK
Sbjct: 110 LWEFRHSMGCFRKGDKESLKSIK 132

>TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5.77
           YGR249W
          Length = 601

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 64/148 (43%), Gaps = 8/148 (5%)

Query: 64  IFIHKLYQILEDESLHDLIWWTPSGLS-FMIKPVER-FS-KALATYFKHTNITSFVRQLN 120
           +FIH+LY IL+   L + I W P     F IKP    FS K L  YFKH N TSFVRQL 
Sbjct: 3   VFIHQLYSILDQSDLREWIHWIPDADGVFAIKPFHHNFSQKVLQKYFKHKNFTSFVRQLY 62

Query: 121 IYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGD---ENTGGGVQEKEKSN 177
           +YGFHK+                               NS       +   G  E  K+ 
Sbjct: 63  MYGFHKLSPNKNVIDSKASLTSNTGKTSQTNSTSAKDSNSRKSNSLSDKSKGNSENAKNG 122

Query: 178 PTKI-WEFKHSSGIFKKG-DIEGLKHIK 203
              I W F H SG+F KG D+  L  I+
Sbjct: 123 KEDIEWYFTHPSGLFHKGSDVVTLNKIQ 150

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 51/80 (63%), Gaps = 8/80 (10%)

Query: 49  HGSKMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYF 107
           HGSK         N  F+ KLY+ILE  +  +L+ WTP G SF++    +F+ + L T+F
Sbjct: 74  HGSK-------AANNDFVRKLYKILETNTFPNLVRWTPEGTSFVVLDTGKFTTQILPTHF 126

Query: 108 KHTNITSFVRQLNIYGFHKV 127
           KH+N +SFVRQLN Y FHKV
Sbjct: 127 KHSNFSSFVRQLNKYDFHKV 146

>Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W
           (REAL)
          Length = 836

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L D+S   LI W P G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNAKLIQWAPDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMYG 235

Query: 124 FHKV 127
           +HKV
Sbjct: 236 WHKV 239

>TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {ON}
           Anc_5.77 YGR249W
          Length = 398

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 68/143 (47%), Gaps = 36/143 (25%)

Query: 65  FIHKLYQILEDESLHDLI-WWTPSGLSFMIKPVER-FSK-ALATYFKHTNITSFVRQLNI 121
           FIH+LY IL++  L + I W+      F++KP +  FSK  L  YFKH N++SFVRQL++
Sbjct: 6   FIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSKYVLRRYFKHGNVSSFVRQLHM 65

Query: 122 YGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTKI 181
           YGFHK+                                ++  E  G G  +++    T  
Sbjct: 66  YGFHKI--------------------------------TNPQEGLGEGRSDEQGDRATTR 93

Query: 182 WEFKHSSGIFKK-GDIEGLKHIK 203
           W F H  G F+K  D+  LK I+
Sbjct: 94  WFFAHPLGYFRKDADLASLKKIQ 116

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
           YGL073W
          Length = 613

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L D S  DLI W+  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 152 FVNKLWSMLNDNSNLDLIQWSNDGKSFVVTNREQFVHEILPKYFKHSNFASFVRQLNMYG 211

Query: 124 FHKV 127
           +HKV
Sbjct: 212 WHKV 215

>KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {ON}
           Anc_6.209 YGL073W
          Length = 771

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L D++  DLI W   G SF++   E+F    L  YFKH+N  SFVRQLN+YG
Sbjct: 169 FVNKLWSMLNDQANLDLIRWADDGKSFIVTNREKFVHDILPKYFKHSNFASFVRQLNMYG 228

Query: 124 FHKV 127
           +HKV
Sbjct: 229 WHKV 232

>ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} similar
           to uniprot|P10961 Saccharomyces cerevisiae YGL073W HSF1
           Trimeric heat shock transcription factor activates
           multiple genes in response to hyperthermia recognizes
           variable heat shock elements
          Length = 572

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 64  IFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIY 122
           +F++K++ +L DES  +LI W   G SF++   E F  + L  YFKH+N  SFVRQLN+Y
Sbjct: 112 LFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFASFVRQLNMY 171

Query: 123 GFHKV 127
           G+HKV
Sbjct: 172 GWHKV 176

>YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimeric
           heat shock transcription factor, activates multiple
           genes in response to stresses that include hyperthermia;
           recognizes variable heat shock elements (HSEs)
           consisting of inverted NGAAN repeats;
           posttranslationally regulated
          Length = 833

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L D+S   LI W   G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 175 FVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYG 234

Query: 124 FHKV 127
           +HKV
Sbjct: 235 WHKV 238

>TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.209
           YGL073W
          Length = 546

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++K++ +L DES  +LI W+  G SF++   E F  + L  YFKH+N+ SFVRQLN+YG
Sbjct: 120 FVNKVWSMLNDESNVNLIQWSKDGKSFIVVNREEFVHQILPKYFKHSNLASFVRQLNMYG 179

Query: 124 FHKV 127
           +HKV
Sbjct: 180 WHKV 183

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 68/147 (46%), Gaps = 48/147 (32%)

Query: 58  RPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSK-ALATYFKHTNITSFV 116
           RPP N  F+ KLY ILE  +  D++ WT +G +F++    +F++  L  +FKH+N  SFV
Sbjct: 50  RPPANE-FVRKLYTILEKNAYPDIVRWTENGDTFVVLDTGKFTEDILPNHFKHSNFASFV 108

Query: 117 RQLNIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKS 176
           RQLN Y FHK+                                            +K+ +
Sbjct: 109 RQLNKYDFHKI--------------------------------------------KKKVT 124

Query: 177 NPTKIWEFKHSSGIFKKGDIEGLKHIK 203
           +  + WEFKH S  F++   EGL +IK
Sbjct: 125 DVERSWEFKHPS--FRRHFDEGLDNIK 149

>KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.77
           YGR249W
          Length = 465

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 65  FIHKLYQILEDESLHDLIWWTP-SGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 121
           FIH+L+ IL++  LH+LI W+P     F++KP +  FS + L  YFKH NI+SFVRQL++
Sbjct: 6   FIHQLHSILQEPDLHNLICWSPMENNIFLLKPHDPNFSTQVLKRYFKHGNISSFVRQLHM 65

Query: 122 YGFHKV 127
           YGFHK+
Sbjct: 66  YGFHKL 71

>Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W
           (REAL)
          Length = 837

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L D+S   LI W   G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNTKLIQWAKDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYG 235

Query: 124 FHKV 127
           +HKV
Sbjct: 236 WHKV 239

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 55  VGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSK-ALATYFKHTNIT 113
            G + P N  F+ KL++ILE+    D++ WT +G SF++    +F+   L  +FKH+N  
Sbjct: 78  AGAKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFA 136

Query: 114 SFVRQLNIYGFHKV 127
           SFVRQLN Y FHKV
Sbjct: 137 SFVRQLNKYDFHKV 150

>SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 385

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTP-SGLSFMIKPV--ERFSKALATYFKHTNITSFVR 117
           Q   FIH+L+ IL+ E L   I+W+  S   F +KP   E  S+ L  YFKH N++SFVR
Sbjct: 2   QTKTFIHQLHGILQQEDLDQWIYWSSKSQTVFALKPYDPEFSSQVLKRYFKHGNVSSFVR 61

Query: 118 QLNIYGFHKV 127
           QL++YGFHK+
Sbjct: 62  QLHMYGFHKI 71

>TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.77
           YGR249W
          Length = 439

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLS-FMIKP-VERFS-KALATYFKHTNITSFVRQLNI 121
           F+H+L+ IL  E+L++ I+WT    + F IKP   +FS K L  YFKH N++SFVRQL++
Sbjct: 6   FLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSAKILKGYFKHGNVSSFVRQLHM 65

Query: 122 YGFHKV 127
           YGFHK+
Sbjct: 66  YGFHKL 71

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ +L D+S   LI W   G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNTKLIQWALDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMYG 235

Query: 124 FHKV 127
           +HKV
Sbjct: 236 WHKV 239

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 2/73 (2%)

Query: 56  GPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSK-ALATYFKHTNITS 114
           G + P N  F+ KL++ILE+    D++ WT +G SF++    +F+   L  +FKH+N  S
Sbjct: 79  GAKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFAS 137

Query: 115 FVRQLNIYGFHKV 127
           FVRQLN Y FHKV
Sbjct: 138 FVRQLNKYDFHKV 150

>TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.209
           YGL073W
          Length = 627

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 5/77 (6%)

Query: 52  KMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHT 110
           ++L   RP     F++KL+ +L D    D+I W+  G SF++   E+F    L  YFKH+
Sbjct: 154 RVLAKTRPA----FVNKLWNMLNDPINQDMIRWSDDGKSFLVVNREKFVHHVLPNYFKHS 209

Query: 111 NITSFVRQLNIYGFHKV 127
           N  SFVRQLN+YG+HKV
Sbjct: 210 NFASFVRQLNMYGWHKV 226

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 2/73 (2%)

Query: 56  GPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSK-ALATYFKHTNITS 114
           G + P N  F+ KL++ILE+    D++ WT +G SF++    +F+   L  +FKH+N  S
Sbjct: 80  GSKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFAS 138

Query: 115 FVRQLNIYGFHKV 127
           FVRQLN Y FHKV
Sbjct: 139 FVRQLNKYDFHKV 151

>KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 677

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 52/83 (62%), Gaps = 2/83 (2%)

Query: 46  VKKHGSKMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALA 104
           V KH SK  +     + A F++KL+ ++ D+S    I W+ SG S ++   ERF  + L 
Sbjct: 179 VDKHHSKKKLSTTRARPA-FVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLP 237

Query: 105 TYFKHTNITSFVRQLNIYGFHKV 127
            YFKH+N  SFVRQLN+YG+HKV
Sbjct: 238 KYFKHSNFASFVRQLNMYGWHKV 260

>SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 557

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D S   LI W+  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 166 FVNKLWSMVNDTSNQKLIHWSKDGKSFIVTKREQFVHEILPKYFKHSNFASFVRQLNMYG 225

Query: 124 FHKV 127
           +HKV
Sbjct: 226 WHKV 229

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
           Anc_4.385 YJR147W
          Length = 615

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 2/71 (2%)

Query: 58  RPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFV 116
           RPP N  F+ KL++ILE     +++ WT  G SF++    +F+ + L  +FKH+N  SFV
Sbjct: 72  RPPSNE-FVRKLFKILESNIYSNIVRWTEEGDSFVVLDTGKFTTQILPNHFKHSNFASFV 130

Query: 117 RQLNIYGFHKV 127
           RQLN Y FHKV
Sbjct: 131 RQLNKYDFHKV 141

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KLY ILE+    D++ WT  G SF++    +F+ K L  +FKH+N  SFVRQLN Y 
Sbjct: 61  FVRKLYNILENNEYPDIVRWTARGDSFVVLDTGKFTTKILPNHFKHSNFASFVRQLNKYD 120

Query: 124 FHKV 127
           FHK+
Sbjct: 121 FHKI 124

>Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073W
           (HSF1) - heat shock transcription factor [contig 166]
           FULL
          Length = 567

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D +   LI W+  G SF+I   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDSANQKLIHWSSDGKSFIITNREHFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 124 FHKV 127
           +HKV
Sbjct: 220 WHKV 223

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 464

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL++ILE    +D+I WT  G SF++     F+ K L  +FKH+N +SFVRQLN Y 
Sbjct: 30  FVRKLFKILEGAEYNDIIRWTEDGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 89

Query: 124 FHKV 127
           FHK+
Sbjct: 90  FHKI 93

>Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON}
           complement(17211..18512) [1302 nt, 434 aa]
          Length = 433

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLS-FMIKP--VERFSKALATYFKHTNITSFVRQLNI 121
           F+H+LY IL    L D I+W+    S F IKP   +  S+ L +YFKH N++SFVRQL++
Sbjct: 6   FLHQLYSILHQPDLTDWIYWSEDDSSIFAIKPYSTQFSSQILKSYFKHGNVSSFVRQLHM 65

Query: 122 YGFHKV 127
           YGFHK+
Sbjct: 66  YGFHKL 71

>NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209
          Length = 760

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ DE+ H LI W+  G SF++     F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 197 FVNKLWSMVNDEANHPLIQWSDDGKSFVVTNRGSFVHEILPKYFKHSNFASFVRQLNMYG 256

Query: 124 FHKV 127
           +HK+
Sbjct: 257 WHKI 260

>KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 569

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D +   LI W+  G SF+I   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 161 FVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMYG 220

Query: 124 FHKV 127
           +HKV
Sbjct: 221 WHKV 224

>CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249w MGA1
          Length = 325

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 4/71 (5%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTPS--GLSFMIKPV--ERFSKALATYFKHTNITSFV 116
           Q+  F+H+L+ IL D +L  +I W     G  F++KP   E     L  YFKH N++SFV
Sbjct: 2   QHKTFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCDNVLKRYFKHGNVSSFV 61

Query: 117 RQLNIYGFHKV 127
           RQL++YGFHKV
Sbjct: 62  RQLHMYGFHKV 72

>TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 48/77 (62%), Gaps = 5/77 (6%)

Query: 52  KMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHT 110
           ++L   RP     F++KL+ +L++    D+I W   G SF++   E+F    L  YFKH+
Sbjct: 112 RVLAKTRPA----FVNKLWNMLKEPINQDMIRWNDDGKSFLVVNREKFVHHVLPNYFKHS 167

Query: 111 NITSFVRQLNIYGFHKV 127
           N  SFVRQLN+YG+HKV
Sbjct: 168 NFASFVRQLNMYGWHKV 184

>NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77
          Length = 393

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 3/70 (4%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTP-SGLSFMIKPVE-RFS-KALATYFKHTNITSFVR 117
           Q+  FIH+L+ IL++ +L D I W+      F++KP +  FS K L  YFKH NI+SFVR
Sbjct: 2   QHRNFIHQLHSILQEPTLDDWITWSSFDNNVFILKPYDPNFSDKVLKKYFKHGNISSFVR 61

Query: 118 QLNIYGFHKV 127
           QL++YGFHK+
Sbjct: 62  QLHMYGFHKI 71

>Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON}
           (115581..117734) [2154 nt, 718 aa]
          Length = 717

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 123
           F++K++ ++ D++  +LI W+  GLS +I   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 186 FVNKVWNMVNDDNNAELIRWSSDGLSIVINNREELVREILPKYFKHSNFASFVRQLNMYG 245

Query: 124 FHKV 127
           +HKV
Sbjct: 246 WHKV 249

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSK-ALATYFKHTNITSFVRQLNIYG 123
           F+ KL++ILE+    D++ WT +G SF++    +F+   L  +FKH+N  SFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 124 FHKV 127
           FHKV
Sbjct: 147 FHKV 150

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
           (SKN7) - transcription factor involved in oxidative
           stress response [contig 376] FULL
          Length = 461

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL++ILE     D+I WT  G SF++     F+ K L  +FKH+N +SFVRQLN Y 
Sbjct: 29  FVRKLFKILEGGEYTDIIRWTADGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 88

Query: 124 FHKV 127
           FHK+
Sbjct: 89  FHKI 92

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 1/69 (1%)

Query: 60  PQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQ 118
           PQ+  F+ K+Y ILE     D++ WT +G SF++     F S+ L  +FKH+N  SFVRQ
Sbjct: 82  PQSNEFVRKIYGILERGDYPDIVRWTENGDSFVVLDTGSFTSQILPNHFKHSNFASFVRQ 141

Query: 119 LNIYGFHKV 127
           LN Y FHKV
Sbjct: 142 LNKYDFHKV 150

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D +   LI W   G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 214 FVNKLWSMVNDPTNQALIHWNDDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 273

Query: 124 FHKV 127
           +HKV
Sbjct: 274 WHKV 277

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           weakly similar to YHR206W uniprot|P38889 Saccharomyces
           cerevisiae
          Length = 465

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL+ ILE     D++ WT +G SF++     F+ K L  +FKH+N  SFVRQLN Y 
Sbjct: 26  FVRKLFNILEGGEYTDIVCWTETGDSFVVLNTNDFTTKILPKHFKHSNFASFVRQLNKYD 85

Query: 124 FHKV 127
           FHKV
Sbjct: 86  FHKV 89

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KLY ILE     D++ WT +G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 34  FVRKLYGILERCEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 93

Query: 124 FHKV 127
           FHKV
Sbjct: 94  FHKV 97

>NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {ON}
           Anc_5.77 YGR249W
          Length = 526

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 65  FIHKLYQILEDESLHDLI-WWTPSGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 121
           F+++L+ IL+ + LH  I W++     F++KP +  FS K L  YFKH NI+SFVRQL++
Sbjct: 6   FVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSEKVLKKYFKHGNISSFVRQLHM 65

Query: 122 YGFHKV 127
           YGFHK+
Sbjct: 66  YGFHKI 71

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 67/143 (46%), Gaps = 28/143 (19%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLS-FMIKP-VERFS-KALATYFKHTNITSFVRQLNI 121
           FIH+L+ IL  + L + I W+    S F+IKP    FS K L  +FKH N++SFVRQL++
Sbjct: 6   FIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSKVLKRFFKHGNVSSFVRQLHM 65

Query: 122 YGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSNPTKI 181
           YGFHK+                                +SG +N G        ++ ++I
Sbjct: 66  YGFHKLPHSASSTLA-----------------------ASGADNNGATASTNNATSKSEI 102

Query: 182 -WEFKHSSGIFKKGDIEG-LKHI 202
            W+F H S  F K   E  LK I
Sbjct: 103 EWKFTHHSHDFCKSASEAQLKRI 125

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL+ ILE E    +I W+P G +F++    +F+   L  +FKH+N  SFVRQLN Y 
Sbjct: 43  FVRKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD 102

Query: 124 FHKV 127
           FHKV
Sbjct: 103 FHKV 106

>Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W
           (REAL)
          Length = 469

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 65  FIHKLYQILEDESLHDLIWWTPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVRQLNI 121
           F+H+L+ IL +  ++  I+W+P+  + F +KP +  FS   L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNQWIYWSPTDSMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 122 YGFHKV 127
           YGFHK+
Sbjct: 66  YGFHKL 71

>KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON}
           Anc_5.77 YGR249W
          Length = 414

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 66/144 (45%), Gaps = 23/144 (15%)

Query: 65  FIHKLYQILEDESLHDLIWWTPS-GLSFMIKPVER-FSK-ALATYFKHTNITSFVRQLNI 121
           F+HKL+ IL++  + +LI W+     +F +KP +  F+   L  YFKH N++SFVRQL++
Sbjct: 6   FVHKLHSILQEPGISNLIAWSDKYDGAFCLKPYDADFANLVLKRYFKHGNVSSFVRQLHM 65

Query: 122 YGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGG---------VQE 172
           YGFHK+                               NS+G E TG            QE
Sbjct: 66  YGFHKIPVLDVKNTISPLPSSDSINNTST--------NSTGPEFTGNNNENSSLESMAQE 117

Query: 173 KEKSNPTK---IWEFKHSSGIFKK 193
            ++    K   IW F H SG F K
Sbjct: 118 TDQRRTDKASTIWYFSHPSGNFYK 141

>CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073w HSF1
          Length = 706

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++K++ ++ D     LI W+  GLS ++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 230 FVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASFVRQLNMYG 289

Query: 124 FHKV 127
           +HKV
Sbjct: 290 WHKV 293

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 56  GPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSK-ALATYFKHTNITS 114
           G R   N  F+ KL+ ILE     D+I WT  G SF++     F+   L  +FKH+N +S
Sbjct: 30  GSRAAYND-FVRKLFAILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSS 88

Query: 115 FVRQLNIYGFHKV 127
           FVRQLN Y FHKV
Sbjct: 89  FVRQLNKYDFHKV 101

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F+  +Y ILE E   D+I W+  G SF++    +F S+ L  +FKH+N  SFVRQLN Y 
Sbjct: 67  FVRIIYGILEREDYPDIITWSEKGDSFLVLDTGKFTSQILPNHFKHSNFASFVRQLNKYD 126

Query: 124 FHKV 127
           FHKV
Sbjct: 127 FHKV 130

>KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W MGA1 Protein similar to heat shock
           transcription factor; multicopy suppressor of
           pseudohyphal growth defects of ammonium permease mutants
          Length = 390

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 62/152 (40%), Gaps = 32/152 (21%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTPS----GLSFMIKPVER-FSK-ALATYFKHTNITS 114
           QN  FIH+L+ IL+   L   I W P     G+ F ++P +  FS   L  YFKH N++S
Sbjct: 2   QNKTFIHQLHAILQQPELERWIRWEPDEQLRGV-FSLRPHDAAFSTNVLKRYFKHGNVSS 60

Query: 115 FVRQLNIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGV---- 170
           FVRQL++YGFHK+                                S+G    GGG     
Sbjct: 61  FVRQLHMYGFHKLAAPTAPTSTEPASPATSPAA------------SAGSSVAGGGTSSAD 108

Query: 171 ---------QEKEKSNPTKIWEFKHSSGIFKK 193
                       +      +W+F H SG F +
Sbjct: 109 GSAGAAATTAGTKSGKSAVVWQFSHPSGAFCR 140

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL+ ILE     D++ WT  G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 44  FVRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 103

Query: 124 FHKV 127
           FHKV
Sbjct: 104 FHKV 107

>AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL073W
           (HSF1)
          Length = 569

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++KL+ ++ D     LI W+  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDPVNQSLIHWSHDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 124 FHKV 127
           +HKV
Sbjct: 220 WHKV 223

>NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {ON}
           Anc_6.209
          Length = 905

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F++K++ ++ D     LI W+  G SF+++  E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 266 FVNKVWSMINDPVNKGLINWSDDGRSFIVQNRENFVHEVLPKYFKHSNFASFVRQLNMYG 325

Query: 124 FHKV 127
           +HKV
Sbjct: 326 WHKV 329

>Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {ON}
           YGR249W (REAL)
          Length = 453

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 65  FIHKLYQILEDESLHDLIWWTPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVRQLNI 121
           F+H+L+ IL +  ++  I+W+P+  + F +KP +  FS   L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNKWIYWSPTDNMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 122 YGFHKV 127
           YGFHK+
Sbjct: 66  YGFHKL 71

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 123
           F+ K+Y ILE     +++ WT +G SF++    +F S+ L  +FKH+N  SFVRQLN Y 
Sbjct: 51  FVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASFVRQLNKYD 110

Query: 124 FHKV 127
           FHKV
Sbjct: 111 FHKV 114

>ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 334

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 5/67 (7%)

Query: 65  FIHKLYQILEDESLHDLIWWTPS--GLSFMIKPVERF--SKALATYFKHTNITSFVRQLN 120
           FIH+L+ IL D +L + I W+    G+ F+++P +++  +  L  YFKH N++SFVRQL+
Sbjct: 6   FIHQLHAILNDATLAEWIRWSDDQDGV-FVLRPYDKWFSTLVLKRYFKHGNVSSFVRQLH 64

Query: 121 IYGFHKV 127
           +YGFHK+
Sbjct: 65  MYGFHKL 71

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON}
           Anc_4.385 YJR147W
          Length = 791

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 64  IFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIY 122
           +F+  L+ ILEDE   ++I WT  G  F++     F S  L  +F H+N  SFVRQLN +
Sbjct: 34  LFVKTLFNILEDEKYQNIIKWTEKGDRFVVIDAGLFTSDILPIHFNHSNFASFVRQLNKF 93

Query: 123 GFHKV 127
           GFHK+
Sbjct: 94  GFHKI 98

>TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {ON}
           Anc_6.209 YGL073W
          Length = 718

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 123
           F++K++ ++ D S + LI W   G SF +   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 171 FVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSNFASFVRQLNMYG 230

Query: 124 FHKV 127
           +HK+
Sbjct: 231 WHKI 234

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 56  GPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSK-ALATYFKHTNITS 114
           G R   N  F+ KL+ ILE     ++I WT  G SF++     F+   L  +FKH+N +S
Sbjct: 35  GTRAAYND-FVRKLFAILESGEYTNIISWTKDGNSFVVVDTNEFTTNILPKHFKHSNFSS 93

Query: 115 FVRQLNIYGFHKV 127
           FVRQLN Y FHKV
Sbjct: 94  FVRQLNKYDFHKV 106

>YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protein
           similar to heat shock transcription factor; multicopy
           suppressor of pseudohyphal growth defects of ammonium
           permease mutants
          Length = 456

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVR 117
           Q   F+H+L+ IL +  ++  I+W+P+    F +KP +  FS   L  YFKH N+ SFVR
Sbjct: 2   QPKTFVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFVR 61

Query: 118 QLNIYGFHKV 127
           QL++YGFHK+
Sbjct: 62  QLHMYGFHKL 71

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar
           to uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
           transcription factor
          Length = 630

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 123
           F+ KL+ ILE     +++ W+ +G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 77  FVRKLFNILESNQYSNIVRWSNTGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 136

Query: 124 FHKV 127
           FHK+
Sbjct: 137 FHKI 140

>AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR249W
           (MGA1)
          Length = 450

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 58/140 (41%), Gaps = 27/140 (19%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTPSGLS-FMIKPV--ERFSKALATYFKHTNITSFVR 117
           Q   FIH+L+ +L D SL   I W+      F +KP   E     L   FKH N++SFVR
Sbjct: 2   QPKTFIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGTVLKKNFKHGNVSSFVR 61

Query: 118 QLNIYGFHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDENTGGGVQEKEKSN 177
           QL++YGFHK+                                 +GD      + +  K  
Sbjct: 62  QLHLYGFHKL----------------------QTGPGAASSGPAGDNEPPTHIIKSNKE- 98

Query: 178 PTKIWEFKHSSGIFKKGDIE 197
            + +W F H SG F KG  +
Sbjct: 99  -SMVWYFTHPSGYFYKGACQ 117

>Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W
           (REAL)
          Length = 452

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 65  FIHKLYQILEDESLHDLIWWTPS-GLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 121
           F+H+L+ IL +  ++  I+W+ +  + F +KP +  FS + L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNKWIYWSSTDNVVFFLKPYDPNFSTQVLKRYFKHGNVNSFVRQLHM 65

Query: 122 YGFHKV 127
           YGFHK+
Sbjct: 66  YGFHKL 71

>Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar to
           Ashbya gossypii AEL216C
          Length = 572

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 61  QNAIFIHKLYQILEDESLHDLIWWTPSGLS-FMIKPV--ERFSKALATYFKHTNITSFVR 117
           Q   FIH+L+ +L D+SL   I W+      F +KP   E   K L   FKH N++SFVR
Sbjct: 2   QPKTFIHQLHHMLNDKSLESWIRWSAEDDHIFCLKPYDPEFPGKVLKKNFKHGNVSSFVR 61

Query: 118 QLNIYGFHKV 127
           QL++YGFHK+
Sbjct: 62  QLHMYGFHKL 71

>Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON}
           (171402..172703) [1302 nt, 434 aa]
          Length = 433

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLS-FMIKPV--ERFSKALATYFKHTNITSFVRQLNI 121
           F+H+L+ +L      + I W     S F+I P   E   K L  YFKH N +SFVRQL++
Sbjct: 4   FVHQLFSMLNQPDYKEWIHWLNDEDSIFVITPYNQEFGDKVLKKYFKHGNFSSFVRQLHM 63

Query: 122 YGFHKV 127
           YGF K+
Sbjct: 64  YGFQKL 69

>Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147W
           (REAL)
          Length = 349

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 64  IFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHT--NITSFVRQLNI 121
           +F+ KL+Q+L+  +  ++I W P G  F+I   ++F+K +   F  +  +  SFVRQL+ 
Sbjct: 6   VFVSKLFQLLQSNAYSEIIQWLPDGTRFVIWNTDQFAKVILKRFFPSLPSFASFVRQLSK 65

Query: 122 YGFHKV 127
           Y F K+
Sbjct: 66  YEFQKM 71

>Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147W
           (REAL)
          Length = 346

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 64  IFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIY 122
           +F+ KL+ +L+  +   +I W+  G  F+I   E+F+K  L  +F  ++ T+FV+QL+ Y
Sbjct: 6   VFVSKLFHLLQSNAYSSIIQWSSDGSRFIIWDPEQFTKVILERFFSLSSYTAFVKQLSKY 65

Query: 123 GFHK 126
            F K
Sbjct: 66  SFQK 69

>YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Protein
           with similarity to heat shock transcription factors;
           overexpression suppresses the pseudohyphal filamentation
           defect of a diploid mep1 mep2 homozygous null mutant
          Length = 358

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 58  RPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKA-LATYFKHTNITSFV 116
           R  Q  +F+ KLY +L+  +  ++I W+  G   +I   ++F+K  L  +F      +FV
Sbjct: 6   RMEQPDVFVSKLYHLLQGNAYSNIIQWSTDGSKLVIWNPDQFTKVILERFFGIHTFAAFV 65

Query: 117 RQLNIYGFHK 126
           +QL+ Y F K
Sbjct: 66  KQLSKYNFQK 75

>Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147W
           (REAL)
          Length = 347

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 65  FIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 123
           F+  L++IL+  +   +I W+  G  F+I   ++F+K  L  +F   +  +F +QL+ Y 
Sbjct: 7   FLSILFEILQGNAYSSIIQWSADGSKFIIWNPDQFTKVILERFFSIASFAAFAKQLSKYK 66

Query: 124 FHK 126
           F K
Sbjct: 67  FQK 69

>AGR381C Chr7 complement(1435245..1436252) [1008 bp, 335 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL153W
           (PEX14)
          Length = 335

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 289 QEQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENI- 347
           QEQ+    F+D+ ++ LKE++  ++K+  +++     +++    +F F+++  + +E   
Sbjct: 154 QEQD---EFRDQQVEKLKELDATIIKLQGALEETTKTRNNI---NFEFRDLKLQVTEMAK 207

Query: 348 -------VKDHQKQLQAFESDMLTFKQHV 369
                   +DH  QL A +SDM + K+ +
Sbjct: 208 KLDEFRQARDHNSQLTALQSDMESLKRLI 236

>TPHA0L01980 Chr12 (414853..416523) [1671 bp, 556 aa] {ON} Anc_2.639
           YMR068W
          Length = 556

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 554 APSPIYPINEPTTRLYSQPKMRSLGSTSSLPNDRRNS 590
            PSPIY +N PT  LYSQ  +  L + S + N RR S
Sbjct: 228 GPSPIYSLNSPTVSLYSQANV--LNNLSRISNGRRAS 262

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,188,805
Number of extensions: 3210947
Number of successful extensions: 10816
Number of sequences better than 10.0: 151
Number of HSP's gapped: 11193
Number of HSP's successfully gapped: 180
Length of query: 766
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 649
Effective length of database: 40,065,477
Effective search space: 26002494573
Effective search space used: 26002494573
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)