Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR138C (RUP1)5.475ON67165232860.0
Smik_15.3185.475ON67265428020.0
Skud_15.3025.475ON67865726760.0
Suva_8.1905.475ON66664926440.0
Kpol_543.95.475ON64264614800.0
TDEL0A033905.475ON62265014330.0
KAFR0E025405.475ON65966213900.0
TPHA0J027805.475ON63164813780.0
SAKL0G03564g5.475ON60564413321e-176
NCAS0H022705.475ON69652812081e-156
Kwal_55.212675.475ON60463911391e-147
NDAI0C013905.475ON70954810951e-139
KLTH0F15004g5.475ON59750310621e-136
KNAG0B040505.475ON67368210461e-133
TBLA0A025405.475ON67851610361e-131
ZYRO0D11264g5.475ON5476449761e-124
CAGL0I07205g5.475ON6036598661e-107
TBLA0B022305.475ON7905148721e-105
KLLA0E03169g5.475ON5444986437e-75
Smik_5.3088.185ON42835910.022
YER143W (DDI1)8.185ON42835840.17
Skud_5.2808.185ON42835830.19
NDAI0C058908.185ON46233810.34
KAFR0C004103.270ON76956800.53
KLLA0E10341g8.185ON41433771.1
Ecym_71787.488ON126936761.6
NCAS0I016203.270ON79567761.6
ZYRO0G17996g7.488ON145534742.9
Suva_2.707.488ON138034743.0
Suva_5.2718.185ON42835733.3
Kpol_1013.697.488ON124436733.8
AGR023C3.270ON78044724.3
NCAS0A039208.185ON47233724.7
KLLA0F18700g3.270ON77056724.8
KAFR0B023008.185ON41634707.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR138C
         (671 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...  1270   0.0  
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...  1083   0.0  
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...  1035   0.0  
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...  1023   0.0  
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   574   0.0  
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   556   0.0  
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   540   0.0  
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   535   0.0  
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   517   e-176
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   469   e-156
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   443   e-147
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   426   e-139
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   413   e-136
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   407   e-133
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   403   e-131
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   380   e-124
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   338   e-107
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   340   e-105
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   252   7e-75
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    40   0.022
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    37   0.17 
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    37   0.19 
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    36   0.34 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    35   0.53 
KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {...    34   1.1  
Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar ...    34   1.6  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    34   1.6  
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    33   2.9  
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    33   3.0  
Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W ...    33   3.3  
Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa]...    33   3.8  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    32   4.3  
NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {O...    32   4.7  
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    32   4.8  
KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.1...    32   7.0  

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score = 1270 bits (3286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/652 (94%), Positives = 618/652 (94%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60
           MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60

Query: 61  SENKIVAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQNY 120
           SENKIVAGTKPCDVPNNGDQDIDMP                 ERSGSNSTSGCRVTAQNY
Sbjct: 61  SENKIVAGTKPCDVPNNGDQDIDMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQNY 120

Query: 121 DRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHV 180
           DRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHV
Sbjct: 121 DRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHV 180

Query: 181 FLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQL 240
           FLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQL
Sbjct: 181 FLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQL 240

Query: 241 QKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPG 300
           QKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPG
Sbjct: 241 QKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPG 300

Query: 301 IRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXX 360
           IRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP       
Sbjct: 301 IRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEE 360

Query: 361 XXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTK 420
                     ARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTK
Sbjct: 361 DVIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTK 420

Query: 421 QCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANNE 480
           QCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANNE
Sbjct: 421 QCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANNE 480

Query: 481 AAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILT 540
           AAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILT
Sbjct: 481 AAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILT 540

Query: 541 MAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFI 600
           MAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFI
Sbjct: 541 MAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFI 600

Query: 601 YCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGDPEQAT 652
           YCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGDPEQAT
Sbjct: 601 YCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGDPEQAT 652

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score = 1083 bits (2802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/654 (80%), Positives = 572/654 (87%), Gaps = 3/654 (0%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60
           MMDNQAVKSLLEMGIPHEVAV+ALQRTGGNLEAAVNFIFSNELP+Q  M  EN+   PRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60

Query: 61  SENKIVAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQNY 120
           SEN+I+AG    DVPNNG+QD+DMP                 +RSGSNST+  R  AQ Y
Sbjct: 61  SENRIMAGNS-YDVPNNGEQDVDMPDVGGVDVDYDDDEDITDDRSGSNSTNEYRRAAQEY 119

Query: 121 DRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHV 180
           D YS+SETSIPPPSY+IVQHNEFKS + DPTVVLPLPLNSLIESYFGLFALL +VYFPHV
Sbjct: 120 DHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHV 179

Query: 181 FLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQL 240
           FLKPDF+DLN+R DWFKG+SFTEPKYR+AY EA+DGSTTS+IVLASGP++ LQPHLLWQL
Sbjct: 180 FLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQL 239

Query: 241 QKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPG 300
           QKLISVVNTR CERAFVSAK+FT SLEPQL+SKLA+SEHLYEVLPAFIKSLAVDLEMCPG
Sbjct: 240 QKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPG 299

Query: 301 IRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXX 360
           IRD+ETR+LFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP       
Sbjct: 300 IRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEE 359

Query: 361 XXXXX--XXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLY 418
                        RYVEPENTLKEVAPVLTILFNELETNTESV+LPNGVD+PLEFYPQLY
Sbjct: 360 EVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLY 419

Query: 419 TKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDAN 478
           TK+CKDQLIRHIISKRKQAR RSR LL+EI+ LKSYQGKN  TILESTLAYLQ  PDDAN
Sbjct: 420 TKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDAN 479

Query: 479 NEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYI 538
           NEAA QIASLKDTLNS R+AKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPY+
Sbjct: 480 NEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYV 539

Query: 539 LTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLM 598
           LTMAA+SPYSYFIR+RNG WSWIQSNTLGTEFKV KCSS SVVQEAI+HGTKYASE PLM
Sbjct: 540 LTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMPLM 599

Query: 599 FIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGDPEQAT 652
           FIYCEEGKIPTEEVV +AL SN+GC KFA+DDQ+SL+TL SQF DG+ + EQ+T
Sbjct: 600 FIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQFIDGIDNAEQST 653

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score = 1035 bits (2676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/657 (77%), Positives = 558/657 (84%), Gaps = 5/657 (0%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60
           MMDNQAVKSLLEMGIPHEVA+DAL RTGGNLEAAVNFIFSNELPEQA+ G E    QPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60

Query: 61  SENKIVAGTKPCDVPNNGDQ-DIDMPXXX--XXXXXXXXXXXXXXERSGSNSTSGCRVTA 117
           SEN+++AG+   DVPN+GDQ DIDM                      SGS+S++     A
Sbjct: 61  SENRMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHSGSSSSNERGPAA 120

Query: 118 QNYDRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYF 177
           ++YD YSISETSI PPSY+IVQ NEFK  V DPTVVLPLPLNSLIESYFGLFALL +VYF
Sbjct: 121 RDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYF 180

Query: 178 PHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLL 237
           PHVFLKPDF+DLNY  DWFKGSSFT PKYRLAY EA+DGS TSEIVLASG ++ LQP LL
Sbjct: 181 PHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLL 240

Query: 238 WQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEM 297
           WQLQKLISV+NTR CERAFVSA++FT SLEPQL+SKLADSEHLYEVLP FIKSLAVDLEM
Sbjct: 241 WQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEM 300

Query: 298 CPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXX 357
           CPGIRDRETR+LFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP    
Sbjct: 301 CPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEN 360

Query: 358 XXXXXXXXXX--XXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYP 415
                            + EPENTLKEVAPVLTILFNELETNTES++LPNGVDIPLEFYP
Sbjct: 361 DEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYP 420

Query: 416 QLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPD 475
           QLYTK+CKDQLIRH+ISKRKQAR RSR LLQEIN LKSYQGKNIST+LESTLAYLQ  P+
Sbjct: 421 QLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPN 480

Query: 476 DANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIEN 535
           DANN+AA+QIASLKDTLNS R+AKMEEYKDLASK+HGEW+LSHPETHII TAKQL LIEN
Sbjct: 481 DANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIEN 540

Query: 536 PYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASET 595
           PYILT+AALSPYSYF+R+RNG WSW+QSN LGTEFK+K C SPSVVQEAIKHGTKYASET
Sbjct: 541 PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASET 600

Query: 596 PLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGDPEQAT 652
           PLMFIYCEEGKIPTEE V++AL++N+GC KFA+DD+NSL+TLRS F D   + +Q T
Sbjct: 601 PLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSHFNDDNDNTDQGT 657

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/649 (77%), Positives = 552/649 (85%), Gaps = 14/649 (2%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60
           MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQ   G      QPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATG------QPRI 54

Query: 61  SENKIV--AGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQ 118
           SEN++V  AG    DVPN+GDQDIDMP                     S S+S       
Sbjct: 55  SENRVVPDAGAGAYDVPNSGDQDIDMPDVVGGGGDGDGDGYDDLTDDRSGSSSSNGRGP- 113

Query: 119 NYDRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFP 178
             D YSISETS+PPPSYSIVQHN+FKS V DPTVVLPLPLNSLIESYFGLFALL ++YFP
Sbjct: 114 --DHYSISETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFP 171

Query: 179 HVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLW 238
           HVFLKPDF+DLNYR DWFKGSSF EP+YRLAY E+ DGSTTSEIV+ASGP++ +QPHLLW
Sbjct: 172 HVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLW 231

Query: 239 QLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMC 298
           QLQKLISVVNT+ CERAFVSAK+FT SLEPQL++KLADSEHLYEVLP FIKSLAVDLEMC
Sbjct: 232 QLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMC 291

Query: 299 PGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXX 358
           PGIRDRETR+LFISSALHTP+KNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP     
Sbjct: 292 PGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEE 351

Query: 359 XXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLY 418
                         + EPENTLKEVAPVLTILFNELETNTESV+LPNGVD+PLEFYPQLY
Sbjct: 352 EGEVVYGGD---GAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLY 408

Query: 419 TKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDAN 478
           TK+CKDQLIRHIISKRKQAR +SR LLQEIN LKSYQGKNISTILESTLAYLQ    DA+
Sbjct: 409 TKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDAD 468

Query: 479 NEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYI 538
           NEA+KQIASLKDTLNS+RAAKMEEYKDLASKLHGEWNLSHPE HIINTAKQLGLIENPYI
Sbjct: 469 NEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYI 528

Query: 539 LTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLM 598
           L+MA LSPYSYF R R+G WSWIQSNTLGTEFK+ KCSSPSVVQEAI+HGTKYASE PLM
Sbjct: 529 LSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLM 588

Query: 599 FIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGD 647
           FIYCEEG+IPT++ V++AL++N+GC+KFA+DDQ++L TLR+QF D  G+
Sbjct: 589 FIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGN 637

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/646 (45%), Positives = 411/646 (63%), Gaps = 36/646 (5%)

Query: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRIS 61
           ++  ++ SL+EMGIP ++A+DAL R  GNLEAAVNFIFSNELP +AE  +    S     
Sbjct: 4   LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKE-K 62

Query: 62  ENKIVAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVT---AQ 118
            N +    K    P       D+                    +  N  S C V+     
Sbjct: 63  ANHVEISNKESFQPG------DLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVD 116

Query: 119 NYDRYSISETSIP--------PPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFA 170
           N D YS     I         PPSY IV+H++ KS + DPTV+LPLP NS+IE+YF L++
Sbjct: 117 NMDYYSSDSDYITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYS 176

Query: 171 LLTAVYFPHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNE 230
           L    Y PH+ ++PDFKDL++  DWFKGSSF++PK  L     E   TTS+  +   P E
Sbjct: 177 LCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDE---TTSKSTMKICPIE 233

Query: 231 GL-----QPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLP 285
            +     QP LLWQLQKL S+VN+   ERA+V AK+F+  L+ Q + +LA+++HL EVLP
Sbjct: 234 DMNQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLP 293

Query: 286 AFIKSLAVDLEMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYK 345
           +FIK L V+LE CPG  + E R LFISSA +TP+ ++ P+ T LSLFHFLP+EYDSNLYK
Sbjct: 294 SFIKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYK 353

Query: 346 MFNVLLYPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPN 405
           MFNVLLYP                     E  N+L +++P+L+I+F+E E  +  +SLP 
Sbjct: 354 MFNVLLYPDENDSDYESGDES--------EQGNSLGDISPILSIVFDEAEEGSSGISLPE 405

Query: 406 GVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILES 465
           GV++PLEF+PQ+YTK CK++LI+HII+KRK A+ +S+ +L +IN +KS+QGK+I   + S
Sbjct: 406 GVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINS 465

Query: 466 TLAYLQTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIIN 525
           +L YL+   D+ ++   +++  +K+ +   +  KM EY+DLA KL  EWN+S+PETHI+ 
Sbjct: 466 SLEYLER--DNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVE 523

Query: 526 TAKQLGLIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAI 585
           T ++LGLI  PY+L MA LSPYSY+IR R G W+ +Q +T G +F V++CSS   V++ I
Sbjct: 524 TGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTI 583

Query: 586 KHGTKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQ 631
           K  T++ASETPLMF+YC    IP E  + ++ +SNSGCL F ++DQ
Sbjct: 584 KQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQ 629

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/650 (44%), Positives = 413/650 (63%), Gaps = 58/650 (8%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60
           M D  AV+SL+EMGI  +VA DAL+RT G++EAA NFIF N+ P Q     EN   +  I
Sbjct: 1   MNDTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQIS---ENVEQRAHI 57

Query: 61  SENKIVAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQNY 120
              ++ AG+     P + ++ I                           ++     ++++
Sbjct: 58  ---ELPAGSASGFQPGDLNEYI---------------------------SNAPDTESEDF 87

Query: 121 DRYSISETSIPP-PSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPH 179
           +   + E S+   PS   ++ +  K  + DPTVVLPLP N L E YF LF L  A Y PH
Sbjct: 88  EEIDVEEDSVETGPS---LECSGRKGQISDPTVVLPLPPNFLFEGYFALFCLFVANYMPH 144

Query: 180 VFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLA-------SGPNEGL 232
           +  +PDF DLNY  +W++G S+T  +YRL Y  +++GS   +I +           +  L
Sbjct: 145 LLARPDFIDLNYDKNWYRGDSYTNAEYRLKYL-SKNGSDDEQIEIVPKDELTQEDGDYTL 203

Query: 233 QPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLA 292
           Q  LLWQLQKL SV N+R  +RA+V AK+F  ++EPQ++  +A++EHL+EVLP+FIKS+A
Sbjct: 204 QSELLWQLQKLASVANSRMSDRAYVRAKMFAIAVEPQVQRNMAEAEHLHEVLPSFIKSVA 263

Query: 293 VDLEMCPGIRDRETRSLFISSALHTPNKNEP----PMETFLSLFHFLPEEYDSNLYKMFN 348
           VDLEMCP  +D E R  FISSA HTP+ + P     M+T+LSLFHFLPEEY++NLY+MFN
Sbjct: 264 VDLEMCPNFQDNEVRECFISSAFHTPSNSAPQEESTMKTWLSLFHFLPEEYETNLYRMFN 323

Query: 349 VLLYPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVD 408
            LL+                      E EN+L E+APV TI+F+E+E  TE+V L  GV+
Sbjct: 324 ALLFADDSVESDQSDSPDG-------EGENSLSEIAPVFTIVFDEMEETTEAVPLAEGVE 376

Query: 409 IPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLA 468
           +PLEFYPQLYTK+CKD+LI+HII+KR+Q++T SR +LQEI +LKS+QGK++S  + S+L 
Sbjct: 377 MPLEFYPQLYTKECKDKLIKHIIAKRRQSQTDSRAILQEITDLKSFQGKDLSKFINSSLD 436

Query: 469 YLQTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAK 528
           YLQ   D+ + E  K +  LKD + + +  KM EYK++A +L  EWNLS PE  I+ TAK
Sbjct: 437 YLQK--DEKSPELIKGLLDLKDQITNKKTKKMNEYKEIAHRLQSEWNLSLPEIQIVKTAK 494

Query: 529 QLGLIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHG 588
           +LGLI++ Y+LTMA +SPY Y+ R+R+G W ++QS      + V+ CSSP  +Q+AIK  
Sbjct: 495 ELGLIDDSYLLTMAVISPYMYYTRNRDGQWFFVQSTPYEASYNVRACSSPLEIQDAIKQH 554

Query: 589 TKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLR 638
           T+  SE PLMFIYC++G IP ++ V +AL++N GC +FA+DDQ  L  ++
Sbjct: 555 TRRPSEAPLMFIYCKKGFIPDDDTVLKALENNQGCHRFAKDDQLQLNKMQ 604

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/662 (45%), Positives = 409/662 (61%), Gaps = 50/662 (7%)

Query: 6   AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRISENKI 65
           ++ SLLEMGI   VA+DALQ+  GNLEAA+N+IFSN++  ++        + P + E+ +
Sbjct: 7   SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEHTV 66

Query: 66  V---AGTKPCDV-----PNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRV-- 115
               +  KP D+     P  G  + D+                    +G        +  
Sbjct: 67  ELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKVNIPIDS 126

Query: 116 ----------TAQNYDRYSISETSI-PPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIES 164
                     +  N +   +SE +   PP YS VQH+E KS++ DPT+VLPLP NSLIE+
Sbjct: 127 QSSSYSSFSTSLSNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPPNSLIEN 186

Query: 165 YFGLFALLTAVYFPHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVL 224
           Y  L+AL  A +F   FLKPDFKDLNYR +W++ SS  EP YR+ + +A++  T +EIV 
Sbjct: 187 YLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADE--TENEIVP 244

Query: 225 ASGPNEGL--QPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYE 282
           A+   E    QP LLWQLQKLI+VVN+   ERA+VSAK+F SS   QL+SKL D+EHL E
Sbjct: 245 AAELTETDHPQPKLLWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQLQSKLGDAEHLNE 304

Query: 283 VLPAFIKSLAVDLEMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSN 342
           VLP FIK+LAVDLE C G +  + + LFISSA + P++NEP  ET+LS FHFLPEEYD+N
Sbjct: 305 VLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEEYDTN 364

Query: 343 LYKMFNVLLYPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTE--- 399
           LYKMFNVLL P                     +P+N+L  ++P LTI+FNE++ +T+   
Sbjct: 365 LYKMFNVLLIPDEDDEESGESDED--------QPDNSLNIISPFLTIVFNEMDESTDDNM 416

Query: 400 --SVSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGK 457
             S S   GVDIP EFYPQLYTK+CKD+LI+HI+SKRK+++++ + +LQEIN LKSY GK
Sbjct: 417 TTSASF-QGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVILQEINALKSYHGK 475

Query: 458 NISTILESTLAYLQTIPDDANNEA------AKQIASLKDTLNSARAAKMEEYKDLASKLH 511
           +I   L ST+ +LQ    D+N E+      A+++  L+  +N  +A   +EYK+L+ KLH
Sbjct: 476 DILMFLNSTIDFLQK---DSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLH 532

Query: 512 GEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIRSRNGA--WSWIQSNTLGTE 569
            EWNLS+P+ HII TAK LGLI+ PY+LT   +SPY YF+R R     W  +QSN LGT+
Sbjct: 533 NEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTD 592

Query: 570 FKVKKCSSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAED 629
           F +        V   IK  TK  +E+PLMFIYC+E  I +++ + + ++ N GC  F + 
Sbjct: 593 FHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKA 652

Query: 630 DQ 631
           DQ
Sbjct: 653 DQ 654

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/648 (43%), Positives = 403/648 (62%), Gaps = 36/648 (5%)

Query: 1   MMDNQ-AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPR 59
           M DN+ +VKS+++MGIP +VA+DAL R  G+LEAAVNFIFSNELP+   MGE     +  
Sbjct: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDN-NMGESVGNEKYT 59

Query: 60  ISENKIVAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQN 119
            SE+  ++        +N  Q  D+                    + S   S   V+   
Sbjct: 60  TSEHVNISN-------DNNFQAGDLSEVMNVSNYGYDNRF----ETDSGDLSSDEVSDPE 108

Query: 120 YDRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPH 179
                IS  ++  P+Y+IV+H   K+++ DPTVV+PLP NS+IESYFGLF++  ++Y PH
Sbjct: 109 IVENDIS-NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPH 167

Query: 180 VFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAE----DGSTTSEIVLASGPNEGLQPH 235
           + LKPDFKDLNY  +W+ G  F  PK+ +     E    D  T+ E +     +   QP 
Sbjct: 168 LLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPK 227

Query: 236 LLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDL 295
           LLWQLQKL +++N+   ER++VS+K+F+  L+   + KL D+EHLYEVLP+FIK L  +L
Sbjct: 228 LLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNL 287

Query: 296 EMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXX 355
           EMCP  R  E R+  ISSA + P+ +EPP++T L+LFHFLP+EY+SNLYKMFN+LLY   
Sbjct: 288 EMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYADD 347

Query: 356 XXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYP 415
                             ++  N+L  +AP LTI+F+E++  +    LP GV IPLEFYP
Sbjct: 348 EDGDGA------------IDEGNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYP 395

Query: 416 QLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYL----- 470
           QLYTK+CKDQLI+HII KR+ A+  SR  L+++N LKS+QGK+I   L STL +L     
Sbjct: 396 QLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQ 455

Query: 471 -QTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQ 529
            Q    + N +  + +  +K+ L   +  KM  YKDL  KL+  WNLS+PE  II TAK+
Sbjct: 456 RQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKK 515

Query: 530 LGLIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGT 589
           LGLI+ PY L+MA +SP  Y+I+ R+G W  +Q    G +F ++KCSS   +Q+ ++  T
Sbjct: 516 LGLIDEPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYT 575

Query: 590 KYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTL 637
           ++ SETPLMF+Y +EG IP ++ V + L++N+GCL+F +DDQ  L  +
Sbjct: 576 RHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEM 623

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  517 bits (1332), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 277/644 (43%), Positives = 395/644 (61%), Gaps = 62/644 (9%)

Query: 4   NQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNEL---PEQAEMGEENDGSQPRI 60
           NQ+++ LL+MGI HEVAVDAL RT G+LEA+VN+IFS EL    E  ++ +++  S    
Sbjct: 5   NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDS---- 60

Query: 61  SENKIVAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQNY 120
            EN I  G     +PN                               N T+      +N 
Sbjct: 61  -ENGIKPGMLNDVIPNT-----------------------------DNVTTVETREVEN- 89

Query: 121 DRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHV 180
              +I +  + P           K ++ DPTVVLPLP N+L+E+YF LF L   + FPH 
Sbjct: 90  ---TIPDDVLAPSGIMDSTTQLLKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHH 146

Query: 181 FLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQL 240
           FLKPDF+DLNY  +WFKG  +++P+YRL +    + S   +  L    +  LQP LLWQ 
Sbjct: 147 FLKPDFQDLNYNRNWFKGY-YSKPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQF 205

Query: 241 QKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPG 300
           QK I+V+N+   +R FVSAK+F   LEP +  KL   +HL+EVLP+FIKSLA D+EMC  
Sbjct: 206 QKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLL 265

Query: 301 IRD-RETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXX 359
             D R+ R LFIS+A H P+K+E  +ET +SL HFLPEEYD+NLY+MFN LLYP      
Sbjct: 266 KEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPEED--- 322

Query: 360 XXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYT 419
                          E EN+L  +AP+LT++F+E++ +TE+VSL  GVD+PL+FYPQ+YT
Sbjct: 323 -----------EDGEEVENSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYT 371

Query: 420 KQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIP----D 475
           K  KD LI H+I+KRK+A++ S  +LQ++N LKS+QGK+I++ L ST+ +    P    D
Sbjct: 372 KSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQND 431

Query: 476 DANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIEN 535
               E  K + S+K+ + + +  KMEEYK+++  +H +WNLSHP+ ++++ AK++GLI+ 
Sbjct: 432 KDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDE 491

Query: 536 PYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASET 595
           PY+LT A LSPY Y+IR R+G W  + S   G++ +    + P  V E+IK  T++ASET
Sbjct: 492 PYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEA-SITEPHEVSESIKLATRHASET 550

Query: 596 PLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRS 639
           PLMF YC+E KI  E  + ++L+ N G  KF + DQ  L+ L++
Sbjct: 551 PLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQN 594

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  469 bits (1208), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 241/528 (45%), Positives = 335/528 (63%), Gaps = 23/528 (4%)

Query: 124 SISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVFLK 183
           S+S+  IPP  Y++V     K  +  PT++LPLPLNS+IE+Y  LFAL   +  P  FLK
Sbjct: 157 SMSQEMIPP-KYNLVAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLK 215

Query: 184 PDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEI---------------VLASGP 228
            DFKDLNY  +W+KG+SF  PK+ L +  + D +T +E                +  S  
Sbjct: 216 TDFKDLNYNKNWYKGTSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDK 275

Query: 229 NEGLQPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFI 288
            E  QP LLWQLQKL ++ +    ERA+ SA++F+     Q+RS L+ S++L +VLP FI
Sbjct: 276 VEKQQPFLLWQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFI 335

Query: 289 KSLAVDLEMCPGIRDRET-RSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMF 347
           KS+  DL++CP   D E+ + LFI+SA H P K++  +ET L+ FHF+PEEY+ NLYKMF
Sbjct: 336 KSITTDLQLCPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMF 395

Query: 348 NVLLYPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGV 407
           NVLLYP                        N+L + A ++T++FNE +  T  ++  +GV
Sbjct: 396 NVLLYPDDPSENNEDNGEQEEVY------NNSLNKAAHIITVIFNEADAYTPEMTSNSGV 449

Query: 408 DIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTL 467
           +IPL FYPQLY K+CKDQLI+HI+ KR+QA  RS+ LL EI +LKS++GK+IS  LES  
Sbjct: 450 EIPLTFYPQLYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAK 509

Query: 468 AYLQTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTA 527
            YLQ   +       + I  ++  +   + +KMEEYK L+S+LH +WNLSHPE  II TA
Sbjct: 510 EYLQKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETA 569

Query: 528 KQLGLIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKH 587
           K LGLI+ PY+LT   +SPY Y+IR ++G W  +Q NTLGT+F+V +  S + VQE IK 
Sbjct: 570 KTLGLIDEPYLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKA 629

Query: 588 GTKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLK 635
            T   +ETPLMF++C E  IP E+ V +A++ N GCL+FA+ DQ SL+
Sbjct: 630 QTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSLE 677

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/45 (77%), Positives = 39/45 (86%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPE 45
          M +N+ VK+LLEMGIP EVAVDAL RTGGNLE AV FIFSNELP+
Sbjct: 1  MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQ 45

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  443 bits (1139), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 247/639 (38%), Positives = 364/639 (56%), Gaps = 53/639 (8%)

Query: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRIS 61
           M   A+KSLL+MGI  +VA++AL +T G++E +VN+IFS ELP+Q   G E+   QP  +
Sbjct: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQ---GPESKPLQPLHA 57

Query: 62  ENKIVAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQNYD 121
           +    A   P    +  D  +                        ++ ++G     + Y 
Sbjct: 58  D----AEQGPQKEEDREDSAL------------------LEHTEYASVSNGPLEEPERYR 95

Query: 122 RYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVF 181
            Y++S              NE K++  DP VV P   N+L E+YF LF L   + FPH F
Sbjct: 96  DYTLSTQEEAA--------NEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFPHYF 147

Query: 182 LKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQLQ 241
           L PDFKDLNY  DW +G  F +P++R+ +   ED +      L S  N  LQP LLWQ Q
Sbjct: 148 LGPDFKDLNYGPDWARGQ-FLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPELLWQFQ 206

Query: 242 KLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGI 301
           K ++V ++    R  VSA+  T +LEPQ+  KL ++EHL++VLP+FI+SLA D+E+CPG 
Sbjct: 207 KFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPG- 265

Query: 302 RDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXX 361
             +  + LFIS+A + P     P+ET +SL HF+PEEYDSN+YKMFN LLYP        
Sbjct: 266 -SQSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNDADDDDD 324

Query: 362 XXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTKQ 421
                        E +N+L  +A ++TI+F+E++ +T+ + LP+GV++P++FYPQLYT+ 
Sbjct: 325 VE-----------ETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTED 373

Query: 422 CKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYL-----QTIPDD 476
            K  LI+ +     + + R+  +L+ +NELKS+QGK+I + L STL ++         + 
Sbjct: 374 AKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENP 433

Query: 477 ANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENP 536
             N+    +  +K  L+  +   M EYK ++ KL+ +WNLSHPE  II   ++LGLI+ P
Sbjct: 434 QINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEP 493

Query: 537 YILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETP 596
           YILT A +SP++YFIR R+  W  +          V K  + +V    I+  T+ ASETP
Sbjct: 494 YILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTN-TIRLNTRTASETP 552

Query: 597 LMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLK 635
           LMF Y +E  I T E + EA++ N+G   FAE DQ+SLK
Sbjct: 553 LMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  426 bits (1095), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 224/548 (40%), Positives = 329/548 (60%), Gaps = 46/548 (8%)

Query: 134 SYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVFLKPDFKDLNYRA 193
           +Y++V + + K+ V DPT++LP+P+NSL+E+Y  L  L  A+  P  FL+PDFKDLNY  
Sbjct: 156 NYNVVTYTQLKARVTDPTIILPVPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYEN 215

Query: 194 DWFKGSSFTEPKYRLAYCEAEDGS-------TTSEIVLASGP-----NEGLQPHLLWQLQ 241
           DW+KG+S + P Y L      D         + + I+   G      N+ +QP LLWQLQ
Sbjct: 216 DWYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQ 275

Query: 242 KLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGI 301
           KLISVVN+   ER+++S KVF+  L P +R  LA+ E+L +VLP F KSLA ++E C  I
Sbjct: 276 KLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAI 335

Query: 302 -------------------------RDR-ETRSLFISSALHTPNKNEPPMETFLSLFHFL 335
                                    R R E  SLF+S+A +        ++T ++   F 
Sbjct: 336 FGSDITENDKVDNADNDNNNGNSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFS 395

Query: 336 PEEYDSNLYKMFNVLLYPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELE 395
           PEEY+SNLYKMFN LL+P                    V     L  +AP+ T++F+ ++
Sbjct: 396 PEEYESNLYKMFNTLLFPEIDNPSKTAVSEGD------VPGTGCLDYIAPIFTVVFHAMD 449

Query: 396 TNTESVSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQ 455
           + T+ V LP GVD+P+EFYPQLYT  C+D L+R +  +RK+A   S+ LLQ+ N+L+S+Q
Sbjct: 450 STTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQ 509

Query: 456 GKNISTILESTLAYLQTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWN 515
           GK+I+  L+ST+ YL T    +  +A +++  L+  +N+A+   ME+YK L++ L G  N
Sbjct: 510 GKDITMFLKSTMDYL-TKDCGSETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLN 568

Query: 516 LSHPETHIINTAKQLGLIEN-PYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKK 574
           +SHPE  II+ AK   LI++ PY+LTMA +SP +YFIR+R G W  ++ N + TEF++ +
Sbjct: 569 VSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITE 628

Query: 575 CSSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSL 634
           C S   VQ AIK  T +A+E PLMFIYC +  I  + ++ + L+ N GCL+F++DDQ +L
Sbjct: 629 CESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIAL 688

Query: 635 KTLRSQFF 642
             LR Q F
Sbjct: 689 DVLRQQIF 696

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 42/61 (68%), Gaps = 4/61 (6%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELP----EQAEMGEENDGS 56
          M  N +V SL+EMGIP EVAV+AL R  GNLEAAV FIFSNE+P    E + +  +ND  
Sbjct: 1  MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60

Query: 57 Q 57
          Q
Sbjct: 61 Q 61

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  413 bits (1062), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 215/503 (42%), Positives = 306/503 (60%), Gaps = 21/503 (4%)

Query: 142 EFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVFLKPDFKDLNYRADWFKGSSF 201
           + K+   DP VV P   N+L E+YF LF L   + FPH FL+PDF+DL Y  DW+KG  F
Sbjct: 102 QLKNRPEDPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKGQ-F 160

Query: 202 TEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQLQKLISVVNTRKCERAFVSAKV 261
            +P YR+ +   +D S   +  L S  N  LQP LLWQ QK ++V N+ +C R +V+A+ 
Sbjct: 161 LKPAYRVKFENNDDVSIVPQETLTSQDNLILQPELLWQFQKFLAVQNSPQCRRKYVTARY 220

Query: 262 FTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGIRDRETRSLFISSALHTPNKN 321
            T  LEPQ+  KL +S+HL+E LP+FIKSLA D+E+CPG      + LFIS+A + P   
Sbjct: 221 LTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGAHS--VKELFISTAYYKPVSE 278

Query: 322 EPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXXXXXXXXXXARYVEPENTLK 381
             P+ET +SL HF+PEEYD+N+YKMFN LLYP                 A   + +N+L 
Sbjct: 279 PEPIETLVSLLHFMPEEYDTNIYKMFNALLYPDSNED------------AEMDDIQNSLG 326

Query: 382 EVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRS 441
            +AP++TI+F+E++ +TE  +LP+GVD+PLEFYPQLYT++ K+ LI+ +      ++T++
Sbjct: 327 NLAPMITIVFDEMDESTEQATLPHGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQTQA 386

Query: 442 RCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANNEAAKQ-----IASLKDTLNSAR 496
           R +L+ +N+LKS+QGK I + L S L ++       + ++  Q     +  +K  L S +
Sbjct: 387 RSILRNLNDLKSFQGKQIHSFLNSALDFITKDMSGVSEQSGVQELVDSLQEVKQQLGSKK 446

Query: 497 AAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIRSRNG 556
             KM +YK ++ +L+ E NLSHPE  II  AK LGLI+ PY+LT A +S  +YFIR  NG
Sbjct: 447 TEKMAQYKAVSHRLNNELNLSHPELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQNNG 506

Query: 557 AWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEVVAEA 616
            W  +   +      V K  + S V  AI+  T+ ASE+PLMF Y +   I TE  V EA
Sbjct: 507 QWFHVVGRSNSEHMDVTKTDA-STVSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVKEA 565

Query: 617 LKSNSGCLKFAEDDQNSLKTLRS 639
           +  N G   FAE DQ  + TL +
Sbjct: 566 VGHNKGAKLFAEQDQKHINTLSA 588

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%)

Query: 2  MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQA 47
          M   A++SLL+MGI  EVA++AL +T G++E +VN+IFS ELP+Q 
Sbjct: 1  MSENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQG 46

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  407 bits (1046), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 249/682 (36%), Positives = 361/682 (52%), Gaps = 63/682 (9%)

Query: 3   DNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRISE 62
           +  AV SL EMGIP +VA+DAL+R  GNL AAVN+IFSN++P     GE  +  QPR S 
Sbjct: 4   EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP----AGEHVELPQPRESS 59

Query: 63  NKIVAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQNYDR 122
           +      KP D+    DQ +                        ++  +G  +     D 
Sbjct: 60  D-----LKPGDL----DQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDN 110

Query: 123 YSISE---------TSIPP---------------PSYSIVQHNEFKSNVGDPTVVLPLPL 158
             +           TSIPP               P Y   +    +     P        
Sbjct: 111 IEVGSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGAAPAA 170

Query: 159 NSLIESYFGLFALLTAVYFPHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGS- 217
                +Y  LFA   A Y P  F++ DFK+LNY A+W+ G +  +P   ++   A+ GS 
Sbjct: 171 ERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSR 230

Query: 218 --TTSEIVLASGPNEGLQPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLA 275
                E V +  P   +QP +LWQLQ++ISV +++  ER++VSAKVFT   + ++ S + 
Sbjct: 231 QIVPEEEVTSDTP---VQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIR 287

Query: 276 DSEHLYEVLPAFIKSLAVDLEMCPGIR-DRETRSLFISSALHTPNKNEPPMETFLSLFHF 334
           DS+HLYE LP+FIKS+  D EMCP    + + +S+F+SSA+    +   P ETFL LFHF
Sbjct: 288 DSDHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHF 347

Query: 335 LPEEYDSNLYKMFNVLLYPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNEL 394
            PEEY++NLYKMFN LLYP                    V+ E +LKE+AP+LTI+FNE 
Sbjct: 348 PPEEYNANLYKMFNALLYPEDDTIDDNSSDTDSSNDTD-VQVEGSLKELAPLLTIIFNEA 406

Query: 395 ETNTES-------VSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQE 447
           +    S       ++ P GV++P  FYPQLYT++ K+Q+++ I+ +RK AR   R  L  
Sbjct: 407 DPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLAR 466

Query: 448 INELKSYQGKNISTILESTLAYLQTIP---------DDANNEAAKQIASLKDTLNSARAA 498
           +N+LKSY+GK     LE     L   P          +   E  +++ S+K  LN  RA 
Sbjct: 467 MNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAK 526

Query: 499 KMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIRSRNGA- 557
             ++Y DL++KL  EWN+S+PE  +I  AK+LGL++ P++L+M  LSPY Y +R  +G  
Sbjct: 527 LKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGS 586

Query: 558 -WSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEVVAEA 616
            W+ +QSN+ GT+  + K  +   VQ+ I+  TK A++ PLMFIYC E    ++E    A
Sbjct: 587 DWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSA 646

Query: 617 LKSNSGCLKFAEDDQNSLKTLR 638
           ++ N GC +F + DQ  L T R
Sbjct: 647 IEKNMGCSEFNKADQLYLLTHR 668

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  403 bits (1036), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 205/516 (39%), Positives = 310/516 (60%), Gaps = 14/516 (2%)

Query: 132 PPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVFLKPDFKDLNY 191
           PP YS   +   KS   DPTV+L L  + L+ +YFGLF++  A++ P +F+ PDF +LN+
Sbjct: 160 PPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVNLNF 219

Query: 192 RADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEG-------LQPHLLWQLQKLI 244
             +W KG     P+Y + Y    +      I + +  N          QP++LWQLQK+I
Sbjct: 220 NDNWNKGLQIDTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELTYQPYILWQLQKVI 279

Query: 245 SVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGIRDR 304
           S++N++   RA++S+ +++  L+   + KL ++ HLY++LP FI+SL  D +  P +   
Sbjct: 280 SIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKHVPDLDQN 339

Query: 305 ETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLY-----PXXXXXX 359
             +++F+S A H    ++ P +  L LFHFLPEEYDSNLYKMFN LLY     P      
Sbjct: 340 RMKNMFVSKAFHQIPIHKEPTKVSLFLFHFLPEEYDSNLYKMFNSLLYRSYDEPIYPRTN 399

Query: 360 XXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYT 419
                          E E++L E++ +LT++F+EL+ +TE ++ P+GV+IP EFYP+LYT
Sbjct: 400 QNSADSSSSDDEISNEEESSLDEISTILTVIFDELDQDTELITQPDGVEIPFEFYPELYT 459

Query: 420 KQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANN 479
           K+CK++LI  I+  R Q + + + +L ++N LKS++GK+I   L STL YLQ   D    
Sbjct: 460 KKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEYLQR--DGKEG 517

Query: 480 EAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYIL 539
               +++ +K+ L+ A+  KM EYK ++  L  EWN+  PE  II  A+ LGLI +P++L
Sbjct: 518 PMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQAQDLGLIGDPHLL 577

Query: 540 TMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMF 599
            MA LSPY YF R R   W   QS+ +GT+F++ K  S   VQ+ IK  TK ASETP+MF
Sbjct: 578 VMAVLSPYLYFFRDRRNRWFKFQSSIMGTDFEITKYESDKTVQDEIKLNTKSASETPIMF 637

Query: 600 IYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLK 635
           +YC++  IP + +V +    N GC  FA+ D+ SLK
Sbjct: 638 VYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSLK 673

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 13 MGIPHEVAVDALQRTGGNLEAAVNFIF 39
          MGI  +VA   L + GGNLEAA+N IF
Sbjct: 1  MGIAKDVATSTLNKVGGNLEAAINHIF 27

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  380 bits (976), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 251/644 (38%), Positives = 345/644 (53%), Gaps = 117/644 (18%)

Query: 6   AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRISENKI 65
           A +SL+EMGI  EVA  ALQ+T GNLEAAV                           N I
Sbjct: 3   AQQSLIEMGITPEVAQRALQQTHGNLEAAV---------------------------NYI 35

Query: 66  VAGTKPCDVPNNGDQDIDMPXXXXXXXXXXXXXXXXXERSGSNS---TSGCRVTAQNYDR 122
            +G    D P N  Q   MP                    GS S   T+       +   
Sbjct: 36  FSGEVSDDQPVNQPQSAPMPGFA----------------PGSLSGVMTNQIDDDEDDDSS 79

Query: 123 YSISETS--IPP---PSYS-------IVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFA 170
            S  E S  +PP   P +S       I   +  KS V DPTVV+PLP +SL E+YF LF+
Sbjct: 80  SSERELSPPLPPRDSPGFSGMSEGVEIEIQSPKKSLVTDPTVVIPLP-HSLFENYFALFS 138

Query: 171 LLTAVYFPHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNE 230
           L    Y PH+  KP+  DL Y   W +GSS              D ST+           
Sbjct: 139 LSMCQYLPHLMAKPELGDLMYNPKWAQGSS--------------DPSTS----------- 173

Query: 231 GLQPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKS 290
                 + QLQ+L SVVN    +R +VSAK+F + L+  L+ KLA++EHL+EVLP+FI+S
Sbjct: 174 -----FIQQLQRLCSVVNASFSDRCYVSAKLFAAVLDAPLKRKLAEAEHLHEVLPSFIRS 228

Query: 291 LAVDLEMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVL 350
           L   LE C    + + RSLF+SSAL +  K      + LS+  F+PEEY+S+LY MFN L
Sbjct: 229 LIHALEECGCYAEDQIRSLFVSSALSSECK------SLLSVLQFMPEEYESSLYAMFNAL 282

Query: 351 LYPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIP 410
           LYP                     E  N+L ++APVLTI+F+E++ +TE V+   GVD+P
Sbjct: 283 LYPELEEGE---------------ESGNSLLDLAPVLTIVFDEMDADTE-VTSNRGVDVP 326

Query: 411 LEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYL 470
           LEFYPQLYTK  KD ++R +  +RK A+ RSR +L E+N LKSYQGK+    + STL YL
Sbjct: 327 LEFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKFINSTLDYL 386

Query: 471 QTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQL 530
           Q   D+ + E   ++ SLK+++   +  +  EYK+L+ KLHGEWNLSHP T++IN A + 
Sbjct: 387 QR--DNQSKEIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLSHP-TYLINEAMER 443

Query: 531 GLIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTK 590
           GLI+ PY+L M  LSP  Y  RSR+G W  I++++     ++  C +PS VQ  I+  T 
Sbjct: 444 GLIDEPYLLAMVVLSPGHYLQRSRSGQWKMIRTDS--NMIRISDC-APSQVQATIRQHTT 500

Query: 591 YASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSL 634
           + S+TPLM +Y +   +  + +V+++L+SN G   F   DQ  L
Sbjct: 501 FPSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITNFLRIDQEEL 544

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  338 bits (866), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 235/659 (35%), Positives = 341/659 (51%), Gaps = 83/659 (12%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRISENKIV 66
           V+SLLEMGI  +VA  AL+   G++EAA+N+IF+                 P   +N  +
Sbjct: 7   VQSLLEMGIARDVAEQALRECNGDVEAALNYIFNT----------------PNEIDNDAM 50

Query: 67  AGTKPCDVPNNGDQDI--DMPXXXXXXXXXXXXXXXXXERSGSNSTSGCRVTAQNYDRYS 124
           AG +   VP  G Q I  D                   +    N       +  + +  S
Sbjct: 51  AGQQMGSVPV-GTQGIFDDSAFKIQENNPPQSQSYSEQQLVQENLPDNTFRSDSDTNSDS 109

Query: 125 ISETSIPPPSYSIVQH---NEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVF 181
            S +S+    Y+ +      +FK+ +  PTVV+P P       Y  LFAL  +++ PH F
Sbjct: 110 DSSSSLEQSQYTSIDDLIPQQFKNTMDYPTVVIPAPAVPNHIYYCALFALFISIHLPHYF 169

Query: 182 LKPDFKD--LNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLW- 238
           +K D  D  L +  DWF               E ED                 +P L+  
Sbjct: 170 VKADHDDMPLLFSPDWFNDID----------REPED-----------------EPLLVLR 202

Query: 239 -QLQKLISVVNTRK-CERAFVSAKVFTSSLEPQLRSK---LADSE--HLYEVLPAFIKSL 291
            QL KLI+V N+     RAFV++K+F   L+  ++S    L +    HLY++LP+FIK++
Sbjct: 203 DQLHKLIAVQNSNDHSARAFVTSKMFDVDLQSVIQSNEPMLTNPNYFHLYQILPSFIKTI 262

Query: 292 AVDLEMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLL 351
           A +L           ++LFISSA+    +     E+ LSLFHFLPEEY+SNLYKMFNVLL
Sbjct: 263 A-NLSYT-------EKNLFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNVLL 314

Query: 352 YPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPL 411
           YP                       EN+LKE+APV+TI+FNE E   E+  + NGV++PL
Sbjct: 315 YPDDDHDIGEDEDEVS---------ENSLKELAPVMTIIFNEAENIDENAPVTNGVEVPL 365

Query: 412 EFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQ 471
           +FYPQLYTK+CKDQLI H++SKRK  R   + +L++I  LKSYQGK+I + + S+L YL 
Sbjct: 366 KFYPQLYTKKCKDQLISHVLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYLT 425

Query: 472 TIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLG 531
              DD+    A+++  LKD L + +  KM  YK ++ K+H EWN+ +PE  I+ TA +LG
Sbjct: 426 KDKDDSG--IAEELHKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLG 483

Query: 532 LIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGT---EFKVKKCSSPSVVQEAIKHG 588
           LI+ PY L +A +SP+ YF+R+R   W  ++ N   T   +  V KC  P  V + +K+ 
Sbjct: 484 LIDEPYFLNLAVVSPFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNS 543

Query: 589 TKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGD 647
           T   + TPLMF+Y ++  +  +  + E L  N   L F + DQ  L+   +    G GD
Sbjct: 544 TTVPNSTPLMFVYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYLQNFENA--RGEGD 600

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  340 bits (872), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/514 (37%), Positives = 292/514 (56%), Gaps = 58/514 (11%)

Query: 144 KSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFP-HVFLKPDFKDLNYRADWFKGSSFT 202
           K  + DPTV+LPL  N L+E+Y  LF     +  P  +F    F DL Y   W+  S+  
Sbjct: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSISNNN 237

Query: 203 EPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQLQKLISVVNTRKCERAFVSAKVF 262
           E             +TT++              L  QLQ++ S++N+R  ERAF+S K+F
Sbjct: 238 E-------------NTTTD-------------SLFLQLQRVTSIINSRMSERAFISTKMF 271

Query: 263 TSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGIRDRETRSLFISSALHTPNKNE 322
           + +    L   L+ S+HL E+   FI+SL   + + P  +D     + +++A++  ++  
Sbjct: 272 SFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD-----ILVTTAINKDSQTN 325

Query: 323 PPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXX---XXXXXXXXXXXXXXXARYVEPENT 379
               + +S+ +FLPEEY+SNLYKMFN L+YP                          ++ 
Sbjct: 326 EIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNDDEQSDESLQTDDDDNDDANDSA 385

Query: 380 LKEVAPVLTILFNEL-ETNTESVSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQAR 438
           L+E++P+ TILF E  E+++ S +LP GV+IPL+FYPQLY+K+  DQLI+HIISKRK+A+
Sbjct: 386 LEEISPIFTILFEEYDESDSSSTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQ 445

Query: 439 TRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANNE--AAKQIASLKDTLNSAR 496
           ++SR LL EIN LKS+QGK+I  IL+ST+ Y++    D+  E  +A  + ++   + + +
Sbjct: 446 SKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEK---DSQRETKSANNLTNILTEMKNCK 502

Query: 497 AAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIRSRNG 556
             KM++YK+L  KLH EWNLSHPE  II TAKQL LI++PY L+M   SP  Y I+  N 
Sbjct: 503 NLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANV 562

Query: 557 AWSWIQSNTLGTE----------------FKVKKCSSPSVVQEAIKHGTKYASETPLMFI 600
            W  I   ++                   F ++KC+S   +Q+ IK  T+  SETPLMFI
Sbjct: 563 DWYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFI 622

Query: 601 YCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSL 634
           YC+E  +P E+ V ++ +SN  C KF ++DQ +L
Sbjct: 623 YCKESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60
          M D + +++L++MGIP +VA +AL+   GN+EAAVN+IFSNELP QA    E     PRI
Sbjct: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPE---LPPRI 57

Query: 61 SEN 63
           EN
Sbjct: 58 DEN 60

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  252 bits (643), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 160/498 (32%), Positives = 263/498 (52%), Gaps = 35/498 (7%)

Query: 153 VLPLPLNSLIESYFGLFALLTAVYFPHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCE 212
           +LP   ++L+ESYF LFAL  AV  P  FL  DFK+L Y   WFKG    +  YRL +  
Sbjct: 57  ILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKGE-LVQSDYRLVHRN 115

Query: 213 AEDGSTTSEIVLASGPNEGLQPHLLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRS 272
           A         +  S   E +QP L+ ++Q LI + N  +  R FV++++     +  +  
Sbjct: 116 AGPLLIHKRELTGSEYLE-MQPELIPRMQLLIGIANDPESMRRFVASELINKGTDFNVSR 174

Query: 273 KLADSEHLYEVLPAFIKSLAVDLEMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLF 332
            L++ +HL EV P FIK+L  D+++C    D+ T  LF+S ALH PN  EP   T LS+ 
Sbjct: 175 ALSECDHLSEVFPQFIKNLHNDMDLCLK-DDKSTSKLFLSKALHRPNVLEPFQPTSLSVL 233

Query: 333 HFLPEEYDSNLYKMFNVLLYPXXXXXXXXXXXXXXXXXARYVEPENTLKEVAPVLTILFN 392
           +F PE Y   LY+MFN +L P                  R  E EN    +APV TI+F+
Sbjct: 234 NFSPENYAYTLYEMFNPMLLPEDS--------------GRGYEIENAFDFLAPVFTIIFD 279

Query: 393 ELETNTESVSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELK 452
           +++  TE V+L +GV IP+EFYPQLYTK   ++++  ++ +    R  ++  + +++ L+
Sbjct: 280 DMDDTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQMSSLQ 339

Query: 453 SYQGKNISTILESTLAYLQTIP---DDANNEAAKQIASLKDTLNSARAAKMEEYKDLASK 509
           S+QGK IS+ L S++ YL+ IP   +D + E    +  +K  L++ +   M +Y +   +
Sbjct: 340 SFQGKQISSFLNSSINYLEEIPLGDEDKSKELVDTLEKIKYQLSNKKREMMADYTETQRQ 399

Query: 510 LHGEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIR---SRNGAWSWIQS--N 564
           +    +   P   II+ AKQ+G+I+ PY+L +   SP  Y I    S +   + +++  N
Sbjct: 400 I-DLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGNTGMETGNN 458

Query: 565 TLGTEFKVKKCSSPSVVQEAI---------KHGTKYASETPLMFIYCEEGKIPTEEVVAE 615
            L     + +  S S+ QE +         K  T++ASETP++F+Y ++  I   + +  
Sbjct: 459 NLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIKKDHIDAPQDILA 518

Query: 616 ALKSNSGCLKFAEDDQNS 633
           ++  N     F +++  +
Sbjct: 519 SISENETLTNFLKEEHTT 536

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%)

Query: 5   QAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V AL++TGGN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 5   QAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V AL++T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 5   QAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V AL++T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           +K L+++G P    + AL RTGGN E A   +F
Sbjct: 429 IKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQ 57
           ++ +++ S++ MG+   ++  AL    G++ A++ ++F+N + +  E+ EEN  SQ
Sbjct: 640 INEESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNN-MDDNGELPEENTASQ 694

>KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 414

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 24/33 (72%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           +K L+++G   + A++AL +TGGN++ A + +F
Sbjct: 381 IKKLVDLGFSRKEAINALNKTGGNVDYAASLLF 413

>Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar to
            Ashbya gossypii ABR149W
          Length = 1269

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 6    AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN 41
            A++ L  MG   E AV AL++   +LEAA NF+  N
Sbjct: 1233 AIEELSNMGFSEEEAVKALEKCKWDLEAATNFLLDN 1268

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRIS 61
           +D +++ ++++MG+  ++++ AL    G++ A++ ++F+N  P+  + GE    + P+  
Sbjct: 665 VDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNN--PD--DNGELPSETTPKRD 720

Query: 62  ENKIVAG 68
           E  I+ G
Sbjct: 721 EEGIIYG 727

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
            similar to uniprot|P34216 Saccharomyces cerevisiae
            YBL047C EDE1 Key endocytic protein involved in a network
            of interactions with other endocytic proteins binds
            membranes in a ubiquitin-dependent manner may also bind
            ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 6    AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
            AV+ L  MG   + AVDAL+R   +LEAA N++ 
Sbjct: 1419 AVEELSGMGFTEQEAVDALERCKWDLEAATNYLL 1452

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
            YBL047C (REAL)
          Length = 1380

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 6    AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
            AV+ L  MG   E A +AL+R+  +LEAA NF+ 
Sbjct: 1344 AVEELSGMGFTEEEAHNALERSNWDLEAATNFLL 1377

>Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 23/35 (65%)

Query: 5   QAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           + +K L+++G P +  V AL++T GN + A + +F
Sbjct: 393 KTIKQLMDLGFPRDDVVKALKQTNGNADFAASLLF 427

>Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa] {ON}
            complement(167435..171169) [3735 nt, 1245 aa]
          Length = 1244

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 6    AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN 41
            A++ L  MG   E A  AL+R G +LE+A N++  N
Sbjct: 1208 AIEELSGMGFSKEEATRALERCGYDLESATNYLLDN 1243

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 3   DNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN-ELPE 45
           D   V S++ MG     A+ AL  TG  +E A+N+IF + E PE
Sbjct: 584 DEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPE 627

>NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {ON}
           Anc_8.185 YER143W
          Length = 472

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           +K + ++G     A++AL RTGGN E A   +F
Sbjct: 439 IKQVTDLGFTRTEAINALNRTGGNAELAAALLF 471

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 5/56 (8%)

Query: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN-----ELPEQAEMGEE 52
           +D++A+ S+  MG+  ++   AL    G++ A+V ++FS+     ELPE  E  ++
Sbjct: 633 VDSEALNSMTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAEEWKDQ 688

>KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.185
           YER143W
          Length = 416

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFS 40
           +K L+++G      + AL  TGGN + A +F+F+
Sbjct: 383 IKQLMDLGFSRNEVIKALDATGGNADFAASFLFN 416

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,965,230
Number of extensions: 2833688
Number of successful extensions: 6438
Number of sequences better than 10.0: 45
Number of HSP's gapped: 6544
Number of HSP's successfully gapped: 59
Length of query: 671
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 555
Effective length of database: 40,180,143
Effective search space: 22299979365
Effective search space used: 22299979365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)