Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR136W (IDH2)5.473ON36935517580.0
Smik_15.3165.473ON36935517240.0
Skud_15.3005.473ON36935517150.0
Suva_8.1885.473ON36935516870.0
SAKL0G03520g5.473ON36935515650.0
NDAI0C014105.473ON36935515650.0
NCAS0H022505.473ON42235515660.0
CAGL0I07227g5.473ON36835515590.0
Ecym_23135.473ON37035415390.0
KLLA0E03125g5.473ON36835515330.0
KNAG0B040705.473ON37335015160.0
KLTH0F15048g5.473ON36835515130.0
Kpol_440.125.473ON36835515110.0
Kwal_55.212735.473ON36835515090.0
AFR137C5.473ON36735514920.0
TDEL0A033705.473ON37135414870.0
KAFR0B063705.473ON37835314500.0
TBLA0B022405.473ON37334714430.0
Kpol_543.85.473ON36835014360.0
TPHA0J027705.473ON37635014320.0
ZYRO0D11220g5.473ON36835114160.0
TPHA0E014805.473ON37734812661e-174
ADL223W2.278ON3623497126e-91
Ecym_33162.278ON3623437004e-89
KLLA0F04103g2.278ON3613456971e-88
ZYRO0D02838g2.278ON3613466901e-87
KLTH0G10186g2.278ON3603456717e-85
SAKL0E07876g2.278ON3613446701e-84
Smik_14.2902.278ON3603446701e-84
YNL037C (IDH1)2.278ON3603446692e-84
NDAI0B035902.278ON3593436682e-84
Kwal_23.50122.278ON3613456673e-84
TBLA0B069102.278ON3653446613e-83
Skud_14.2932.278ON3613446571e-82
KNAG0A052802.278ON3613456552e-82
CAGL0G02673g2.278ON3583456519e-82
TPHA0D015602.278ON3603616458e-81
Kpol_1039.352.278ON3593436422e-80
TDEL0C038402.278ON3613476352e-79
NCAS0B062902.278ON3593436325e-79
KAFR0J014102.278ON3503426082e-75
Suva_14.3022.278ON3002865372e-65
NCAS0B062502.287ON3733554054e-45
Kpol_1003.392.287ON3703604021e-44
KNAG0A054202.287ON3723604011e-44
TBLA0B059402.287ON3693543932e-43
NDAI0B035502.287ON3723553923e-43
Smik_9.852.287ON3713603897e-43
KLLA0E08339g2.287ON3693603881e-42
CAGL0G02585g2.287ON3723593853e-42
SAKL0E07656g2.287ON3683813845e-42
ADL214C2.287ON3673533835e-42
TPHA0C034102.287ON3713773811e-41
YIL094C (LYS12)2.287ON3713603811e-41
Suva_9.1052.287ON3713603793e-41
Skud_9.792.287ON3713603775e-41
ZYRO0A01914g2.287ON3683523696e-40
Ecym_33262.287ON3663743661e-39
TDEL0G021802.287ON3693533556e-38
KAFR0J013602.287ON3733543461e-36
Kwal_27.115282.287ON3673653425e-36
KLTH0G10384g2.287ON3673603407e-36
Ecym_12961.402ON3632762203e-19
AAL012C1.402ON3723502204e-19
NDAI0G042301.402ON3633632179e-19
Skud_3.431.402ON3643552133e-18
KAFR0I022001.402ON3653562124e-18
Kwal_0.2251.402ON3643642072e-17
YCL018W (LEU2)1.402ON3643552072e-17
Smik_3.661.402ON3643592063e-17
TDEL0B060001.402ON3623522054e-17
KLLA0D04906g1.402ON3623072036e-17
TBLA0C015001.402ON3653062037e-17
ZYRO0E04796g1.402ON3622682011e-16
Suva_3.31.402ON3643651992e-16
CAGL0H03795g1.402ON3653591983e-16
KLTH0H12188g1.402ON3643511931e-15
KNAG0I012801.402ON4473611941e-15
NCAS0C048701.402ON3653661913e-15
SAKL0D08690g1.402ON3642681861e-14
Kpol_1048.631.402ON3643631824e-14
TPHA0B037301.402ON3653531648e-12
Suva_14.303singletonON53511002e-05
ADR028W3.425ON83258741.2
TDEL0A042205.559ON1334135704.3
KLLA0F08459g3.153ON83763679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR136W
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   681   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   668   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   665   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   654   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   607   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   607   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    607   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   605   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   597   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   595   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   588   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   587   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   586   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   585   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   579   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   577   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   563   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   560   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   557   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   556   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   550   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   492   e-174
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   278   6e-91
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   274   4e-89
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   273   1e-88
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   270   1e-87
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   263   7e-85
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   262   1e-84
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   262   1e-84
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   262   2e-84
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   261   2e-84
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   261   3e-84
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            259   3e-83
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   257   1e-82
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              256   2e-82
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   255   9e-82
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   253   8e-81
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   251   2e-80
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   249   2e-79
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   248   5e-79
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   238   2e-75
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   211   2e-65
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   160   4e-45
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   159   1e-44
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              159   1e-44
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   155   2e-43
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   155   3e-43
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   154   7e-43
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   154   1e-42
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   152   3e-42
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   152   5e-42
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   152   5e-42
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   151   1e-41
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   151   1e-41
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   150   3e-41
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   149   5e-41
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   146   6e-40
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   145   1e-39
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   141   6e-38
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   137   1e-36
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   136   5e-36
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   135   7e-36
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    89   3e-19
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    89   4e-19
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    88   9e-19
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    87   3e-18
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    86   4e-18
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    84   2e-17
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    84   2e-17
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    84   3e-17
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    84   4e-17
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    83   6e-17
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    83   7e-17
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    82   1e-16
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       81   2e-16
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              81   3e-16
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    79   1e-15
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    79   1e-15
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    78   3e-15
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    76   1e-14
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    75   4e-14
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    68   8e-12
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    43   2e-05
ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic ho...    33   1.2  
TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {...    32   4.3  
KLLA0F08459g Chr6 complement(787966..790479) [2514 bp, 837 aa] {...    30   9.4  

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/355 (94%), Positives = 337/355 (94%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS
Sbjct: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI
Sbjct: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI
Sbjct: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV
Sbjct: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                  ANIGHKISIFEAVHGSAPDIAGQDKANPTALL
Sbjct: 255 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL
Sbjct: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/355 (92%), Positives = 335/355 (94%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           LATVKQPSIG+YTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWE CDV+
Sbjct: 15  LATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWEFCDVN 74

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKS+
Sbjct: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSV 134

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI
Sbjct: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD+TLETELIDNSVLKVVTNPSAYT+AV
Sbjct: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSVLKVVTNPSAYTNAV 254

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                  ANIGHKISIFEAVHGSAPDIAGQDKANPTALL
Sbjct: 255 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGLTN+ADQIQNAVLSTIASGPENRTGDLAG ATTSSFTEAVIKRL
Sbjct: 315 LSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/355 (91%), Positives = 334/355 (94%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           LATVKQPSIGR+TGKPNPSTG+YTVSFIEGDGIGPEISKSVKKIF+AANVPIEWESCDV+
Sbjct: 15  LATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEWESCDVN 74

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           PIFVNGLTTIPD AVQSIT NL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKS+
Sbjct: 75  PIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSV 134

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI
Sbjct: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD+ LETELIDNSVLKVVTNPSAYT+AV
Sbjct: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAV 254

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                  ANIGHKISIFEAVHGSAPDIAGQDKANPTALL
Sbjct: 255 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL
Sbjct: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/355 (90%), Positives = 332/355 (93%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           L+TVKQPSIGRYTGKP+PSTG+YTVSFIEGDGIGPEISKSVKKIFSAA+VPI WE CDV+
Sbjct: 15  LSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPINWEFCDVN 74

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI
Sbjct: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR+ASERVIRYAFEYARAI
Sbjct: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYARAI 194

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRPR+IVVHKSTIQRLADGLFVNVAKELSKEYPD+T ETELIDN VL VVTNPSAYT+AV
Sbjct: 195 GRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAV 254

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                  ANIGHK+SIFEAVHGSAPDIAG+DKANPTALL
Sbjct: 255 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALL 314

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGLT+HADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL
Sbjct: 315 LSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/355 (81%), Positives = 317/355 (89%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           L++ KQPSIGR+TGKPNPSTGKYTVSFIEGDG+GPEISKSVK IF+AA VP+EWESCDV+
Sbjct: 15  LSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFAAAEVPVEWESCDVT 74

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           P+F+NGLTTIP PAV SI KNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKS+
Sbjct: 75  PLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSV 134

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYAFEYARA+
Sbjct: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAV 194

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRP+V+VVHKSTIQRLADGLFV+VAKELS EYPD+ L+ +L+DN+VL VV+NP AY D V
Sbjct: 195 GRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTVLNVVSNPGAYADTV 254

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                  ANIGHK+SIFEAVHGSAPDIAGQ+KANPTALL
Sbjct: 255 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALL 314

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGL   AD I+ AVLSTIASGPENRT DLAG+A+TSSFTEAVIKRL
Sbjct: 315 LSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/355 (82%), Positives = 321/355 (90%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           L+   QPSIG++TGKPNPSTGK+TVSFIEGDGIGPEIS+SVK+IF AA VPI+WE CDVS
Sbjct: 15  LSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVS 74

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           P+F+NGLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI
Sbjct: 75  PLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EGFKT Y+NVDLV+IRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYA+EYARAI
Sbjct: 135 EGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAI 194

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRPRVIVVHKSTIQRLADGLFV+VAKELS+EYPD+ LETELIDN+VL VV+NPS+Y++AV
Sbjct: 195 GRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAV 254

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                  ANIGH++SIFEAVHGSAPDIAGQ+KANPTALL
Sbjct: 255 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALL 314

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGL NHAD+I+ AVLSTIASGPE RTGDLAG ATTSSFT+AVI RL
Sbjct: 315 LSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/355 (82%), Positives = 323/355 (90%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           L+   QPSIG+YTGKPNPSTGKYTVSFIEGDGIGPEIS SVK+IFSAA VPIEWE+CDV+
Sbjct: 68  LSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFSAAKVPIEWETCDVT 127

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           P+F++GLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+S+
Sbjct: 128 PLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSV 187

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           +GFKTTY NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+ASERVIRYAFEY RAI
Sbjct: 188 KGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAI 247

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRPR++VVHKSTIQRL+DGLFVNVAKELSKEYPD+  ETELIDN+VLKVV+NPS+YTDAV
Sbjct: 248 GRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTVLKVVSNPSSYTDAV 307

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                   NIG++ISIFEAVHGSAPDIAG++ ANPTALL
Sbjct: 308 SVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALL 367

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGL+ HADQI+NAVLSTIASGPE+RTGDLAGTATTS+FT+AVIK+L
Sbjct: 368 LSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/355 (82%), Positives = 319/355 (89%), Gaps = 1/355 (0%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           LAT  QPSIGR+TGKPNPSTGK+TVSFIEGDGIGPEIS SVK+IF AA+VP+EWE+CDV+
Sbjct: 15  LATA-QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQAADVPVEWETCDVT 73

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           PIFVNGLTTIPDPAVQSI KNLVALKGPLATPIGKGHRSLNLTLRKTF LFANVRPAKSI
Sbjct: 74  PIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSI 133

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYA+EYARAI
Sbjct: 134 EGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDASERVIRYAYEYARAI 193

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRPR+IVVHKSTIQRLADGLFVNVAKEL+ EYPD+ LETELIDN+ L VV+NPS+YTDAV
Sbjct: 194 GRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTCLNVVSNPSSYTDAV 253

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                  ANIGHK+SIFEAVHGSAPDIAGQ+KANPTALL
Sbjct: 254 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMG+T HAD+I+ AVL TIA G E RTGDL G+A+T+SFT+A+IK+L
Sbjct: 314 LSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/354 (81%), Positives = 315/354 (88%)

Query: 16  ATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSP 75
           A+ KQPSIGR+TGKPNP TGKYTVSFIEGDGIGPEIS+SVK IFSAA VP+EWE CDV+P
Sbjct: 17  ASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIFSAAKVPVEWEYCDVTP 76

Query: 76  IFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIE 135
           IF+NGLTTIPDPAVQSI KNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIE
Sbjct: 77  IFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIE 136

Query: 136 GFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIG 195
           GFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYAFEYARA+G
Sbjct: 137 GFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAVG 196

Query: 196 RPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVS 255
           RP+V+VVHKSTIQRLADGLFVNVA+E+ KEYPD+ L+ ELIDN+VL VV+ P  Y+D+V+
Sbjct: 197 RPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDNTVLNVVSKPEKYSDSVA 256

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLL 315
           VCPNLYGDI                  ANIGH +SIFEAVHGSAPDIAGQ+ ANPTALLL
Sbjct: 257 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLL 316

Query: 316 SSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           SSVMMLNHMGL  HADQI++AVL+T+AS  +NRT DLAGTATTSSFT+AVI+RL
Sbjct: 317 SSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/355 (81%), Positives = 314/355 (88%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           LAT KQPSIGRYTGKPNP TGKYTVSFIEGDG+GPEISKSVK IFSAA VPIEWESCDVS
Sbjct: 14  LATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVS 73

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           PIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI
Sbjct: 74  PIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 133

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EG+KTTYENV+LVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DASERVIRYAFEYARA+
Sbjct: 134 EGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAV 193

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
            R +V+VVHKSTIQRLADGLFV+VAK+LS EYPD+ L+TEL+DN+VLK V +P AY D V
Sbjct: 194 DRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVV 253

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
            VCPNLYGDI                  ANIGH +SIFEAVHGSAPDIAGQ+KANPTALL
Sbjct: 254 VVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGLT HAD+I+ AVL+TIAS  +NRTGDL G+A+TSSFT+AVI+RL
Sbjct: 314 LSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/350 (81%), Positives = 310/350 (88%)

Query: 20  QPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVN 79
           QPSIGR+TGKPNP+TGK+ VSFIEGDGIGPEIS+SVK IF AA VPI WE CDV+PIFVN
Sbjct: 24  QPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFKAAEVPINWEFCDVTPIFVN 83

Query: 80  GLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKT 139
           GLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNLTLRKTF LFANVRPAKSIEGFKT
Sbjct: 84  GLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSIEGFKT 143

Query: 140 TYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRV 199
           TY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYAFEYA+AIGRPRV
Sbjct: 144 TYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAFEYAKAIGRPRV 203

Query: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPN 259
           +VVHKSTIQRLADGLFVNVAKELSKEYP++ LETELIDN+VL VV+NP+ YTDAVSVCPN
Sbjct: 204 VVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPN 263

Query: 260 LYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVM 319
           LYGDI                  ANIG++ISIFEAVHGSAPDIAGQ+KANPTALLLSSVM
Sbjct: 264 LYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVM 323

Query: 320 MLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           MLNHMGL + A +I+ AVL+TIAS  +NRTGDL G+ATTSSFT+AVIK L
Sbjct: 324 MLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/355 (78%), Positives = 313/355 (88%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           LAT KQPSIGRYTGKP+P+TGKYTVSFIEGDG+GPEISK+VK IF+AA  PI+WESCDVS
Sbjct: 14  LATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWESCDVS 73

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           P+F+NGLTTIP PA  SI KNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKS+
Sbjct: 74  PLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSV 133

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           +G+KT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DASERVIRYAFEYARA+
Sbjct: 134 QGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDASERVIRYAFEYARAV 193

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
            RP+V+VVHKSTIQRLADGLFV+VA++LSKEYPD+ L+TELIDN+VL  V +P+ Y+D V
Sbjct: 194 ERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTVLHTVRDPTKYSDVV 253

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
            VCPNLYGDI                  ANIGHK+SIFEAVHGSAPDIAGQ+KANPTALL
Sbjct: 254 VVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGLT HAD+I+ AV +TIA+GPE+RTGDL G+A+TSSF EAVI RL
Sbjct: 314 LSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/355 (79%), Positives = 311/355 (87%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           + T  QP+IGR+TGKPNP TGKYTV FIEGDG+GPEISKSVK IF+AA VPIEWE CDV 
Sbjct: 14  MMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFAAAKVPIEWEPCDVG 73

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           PIFVNGLTTIPD AVQSI K+LVALKGPLATPIGKGHRSLNLTLRKTF LFANVRPA+S+
Sbjct: 74  PIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPARSV 133

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
             +KTTY+NVDLVLIRENTEGEYSGIEH++ PGV+QSIKLIT+DASERVIRYAFEY RAI
Sbjct: 134 PNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDASERVIRYAFEYTRAI 193

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRPR++VVHKSTIQR+ADGLFVNVAKEL+ EYPD+ L+TELIDN++L VVT+P +YTDAV
Sbjct: 194 GRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTILNVVTHPESYTDAV 253

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           SVCPNLYGDI                  ANIG K+SIFEAVHGSAPDIAGQ+KANPTALL
Sbjct: 254 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGL  HA +I+NA+LSTIASG ENRTGDLAGTATTSSFTEAVI +L
Sbjct: 314 LSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/355 (78%), Positives = 312/355 (87%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
            AT KQPSIGRYTGKP+P+TGKYTVSFIEGDG+GPEISK+VK IF+AA  PI+WE+CDV+
Sbjct: 14  FATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVT 73

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           P+F+NGLTTIP PA  SI KNL+ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI
Sbjct: 74  PLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 133

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           +GFKT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DASERVIRYAFEYARA+
Sbjct: 134 QGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAV 193

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
            RP+V+VVHKSTIQRLADGLFV+VA++L+KEYPD+ L+TELIDN+VL  V +P  Y+D V
Sbjct: 194 ERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVV 253

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
            VCPNLYGDI                  ANIGH++SIFEAVHGSAPDIAGQ+KANPTALL
Sbjct: 254 VVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALL 313

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGLT HAD+I+ AV STIASGPENRTGDLAG+A+TSSF EAVI RL
Sbjct: 314 LSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/355 (78%), Positives = 311/355 (87%), Gaps = 1/355 (0%)

Query: 15  LATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVS 74
           LA+V+QPSIGRY GKPN + GKYTVSFIEGDG+GPEIS+SVK IFSAA+VP+EWE CDV+
Sbjct: 14  LASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVT 72

Query: 75  PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 134
           P+ VNGLTTIP+PAV SI KNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI
Sbjct: 73  PLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSI 132

Query: 135 EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI 194
           EG+KTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+ASERVIRYAFEYAR +
Sbjct: 133 EGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTV 192

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           GRP+V+VVHKSTIQRLADGLFVNVA+EL +EYPD+ L+TEL+DN+VL VVT P AY D V
Sbjct: 193 GRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVV 252

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           +VCPNLYGDI                  ANIGH++SIFEAVHGSAPDIAGQ++ANPTALL
Sbjct: 253 AVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALL 312

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LSSVMMLNHMGL  HA +I+ AVLSTIAS  ENRT DLAGTA+TSSFT AVI+RL
Sbjct: 313 LSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/354 (77%), Positives = 312/354 (88%)

Query: 16  ATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSP 75
           AT KQPSIG+YTGKP+P TGKYTVSFIEGDG+GPEISKSVK IF+AA VPI WESC V+P
Sbjct: 18  ATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTP 77

Query: 76  IFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIE 135
           + VNG+TTIP+ A +SI +NLVALKGPLATPIGKGHRS+NLTLRKTFGLFANVRPAKS+E
Sbjct: 78  LLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTLRKTFGLFANVRPAKSVE 137

Query: 136 GFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIG 195
           GFKTTYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITR+ASERVIRYA+EYARA+G
Sbjct: 138 GFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVG 197

Query: 196 RPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVS 255
           RP+++VVHKSTIQRLADGLFV VAKEL+ E+PD+ L+TELIDN+VL VV+NPS Y+D V 
Sbjct: 198 RPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVY 257

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLL 315
           VCPNLYGDI                   NIGHK+SIFEAVHGSAPDIAGQ+KANPTALLL
Sbjct: 258 VCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 317

Query: 316 SSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           SSVMMLNHMGL  HA +I+ AVL+TIA+GPE+RTGDLAG+A+TSSFTEAVI RL
Sbjct: 318 SSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/353 (78%), Positives = 305/353 (86%), Gaps = 2/353 (0%)

Query: 19  KQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFV 78
           +QPSIGR+TGKP+ +TGKYTVSFIEGDGIGPEIS+SVK IF AA+VPI WE+CDVSPI V
Sbjct: 26  RQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILV 85

Query: 79  NGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFK 138
           +GLTTIPD AV+SI KNLV LKGPLATPIGKGHRSLNLTLRKTF LFANVRPAKS+ GFK
Sbjct: 86  DGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSVRGFK 145

Query: 139 TTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR 198
           TTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYAFEYA+AIGRP+
Sbjct: 146 TTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPK 205

Query: 199 VIVVHKSTIQRLADGLFVNVAKELSKE--YPDLTLETELIDNSVLKVVTNPSAYTDAVSV 256
           VIVVHKSTIQRL+DGLFVNVAKEL KE  + ++ L+TELIDN+VL VV NPS Y+DAV V
Sbjct: 206 VIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316
           CPNLYGDI                  ANIG KISIFEAVHGSAPDIAGQ+KANPTALLLS
Sbjct: 266 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTALLLS 325

Query: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           SVMML+HMGL  + D+I+NAVL TIA+  +NRTGDL GTATT+SFTEAVI  L
Sbjct: 326 SVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/347 (76%), Positives = 307/347 (88%)

Query: 23  IGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLT 82
           +G+Y G PNPSTG++TV FIEGDG+GPEISKSVK IF AA VP++WE CDVSP+ +NGLT
Sbjct: 27  VGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLT 86

Query: 83  TIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
           TIP+PAVQ I K+ +ALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA+SI G++TTY+
Sbjct: 87  TIPEPAVQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146

Query: 143 NVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVV 202
           NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYA+EYARAIGRPR++VV
Sbjct: 147 NVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVV 206

Query: 203 HKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYG 262
           HKSTIQ+LADGLFVN+AKEL+ E+PD+ LETELIDN+VL VV +P +YTDAV+VCPNLYG
Sbjct: 207 HKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYG 266

Query: 263 DIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN 322
           DI                  ANIG+++SIFEAVHGSAPDIAGQ+KANPTALLLSS MMLN
Sbjct: 267 DILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLN 326

Query: 323 HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           +MGL +++++I+NA+L+TIASG ENRTGDLAGTATTSSFTE+VIK L
Sbjct: 327 YMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/350 (75%), Positives = 304/350 (86%)

Query: 20  QPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVN 79
           QPSIGR+TGKP+P+TGK+TV FIEGDG+GPEIS+SVKKIFSAA VPIEW  CDV PIFVN
Sbjct: 19  QPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSAAKVPIEWVPCDVGPIFVN 78

Query: 80  GLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKT 139
           G TTIP+PAV+ I K+L+ALKGPLATPIGKGHRSLNLTLRKTF LFANVRPA+SI  +K+
Sbjct: 79  GQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPARSIPNYKS 138

Query: 140 TYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRV 199
           TYENVDLVLIRENTEGEYSGIEH++ PGV+QSIKLITR+A+ERV+RYAFEY +AIGRPR+
Sbjct: 139 TYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREATERVVRYAFEYTQAIGRPRL 198

Query: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPN 259
           +V+HKSTIQR+ADGLFV VA+EL+ EYPD+ LETE+ID S+L VV+ P  Y+DAVSVCPN
Sbjct: 199 LVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSILNVVSKPELYSDAVSVCPN 258

Query: 260 LYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVM 319
           LYGDI                  ANIG K+SIFEAVHGSAPDIAGQ+KANPTALLLSSVM
Sbjct: 259 LYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 318

Query: 320 MLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           ML HMGL  HA++I+NAVL+TIASG ENRT DL+GTA+TSSFTE VI+RL
Sbjct: 319 MLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/350 (76%), Positives = 303/350 (86%), Gaps = 1/350 (0%)

Query: 20  QPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVN 79
           QP+IGR+TGK N S+G YTV FIEGDG+GPEISKSVK IFSAANVPI+W+ CDV PIFVN
Sbjct: 28  QPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQPCDVGPIFVN 86

Query: 80  GLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKT 139
           GLTTIP+PAV++I ++LVALKGPLATP+GKGHRSLNLTLRKTF LFANVRPAKS+  +K+
Sbjct: 87  GLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRPAKSVPNYKS 146

Query: 140 TYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRV 199
           TYENVDLVLIRENTEGEYSGIEHIV PGVVQSIKLITR+ASE+VIRYA+EYA A+GRPR+
Sbjct: 147 TYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAVGRPRL 206

Query: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPN 259
           IVVHKSTIQRL DGLFV +A EL  EYP + LET+++DN+VL VV+NP+ Y DAVSVCPN
Sbjct: 207 IVVHKSTIQRLGDGLFVQIANELQSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSVCPN 266

Query: 260 LYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVM 319
           LYGDI                  ANIG K+SIFEAVHGSAPDIAGQ+KANPTALLLSSVM
Sbjct: 267 LYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 326

Query: 320 MLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           MLNHMGL  HA +I+NAVLSTIASGPE+RTGDL G+ATTSSFTE VIK+L
Sbjct: 327 MLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/351 (74%), Positives = 303/351 (86%)

Query: 19  KQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFV 78
           KQPSIG++TGKP+P TG Y VSFIEGDGIGPEISKSVK IF+AA VP+++ES  V PI V
Sbjct: 18  KQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFAAAKVPVDFESVVVKPILV 77

Query: 79  NGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFK 138
           NG+T+IP+ A +SI  NLVALKGPLATP+GKGHRS+NLTLRKTFGLFAN+RPAKS+EGFK
Sbjct: 78  NGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRKTFGLFANLRPAKSVEGFK 137

Query: 139 TTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR 198
           T Y+NV+LVLIRENTEGEY+GIEH + PGVVQSIKLITR+ASERVIR+A+EYARA  RPR
Sbjct: 138 TIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREASERVIRFAYEYARAAERPR 197

Query: 199 VIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCP 258
           +IVVHKSTIQRL+DGLFV+VAKEL  E+PD+ LETELIDN+VL  VT+P+ Y+DAVSVCP
Sbjct: 198 LIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVCP 257

Query: 259 NLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSV 318
           NLYGDI                   NIGHK+SIFEAVHGSAPDIAG+DKANPTALLLSSV
Sbjct: 258 NLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSV 317

Query: 319 MMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           MML+HMGL  HA QI+ AVL+TIA+GPE+RTGDL G+A+TSSFTEAVIK+L
Sbjct: 318 MMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  492 bits (1266), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/348 (67%), Positives = 276/348 (79%), Gaps = 1/348 (0%)

Query: 22  SIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGL 81
           SIG + GKPNP TG YTV FIEGDG+GPEISKSV+ IF AA VPI+W +CD+ P+ +NG 
Sbjct: 30  SIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNCDIGPLLINGE 89

Query: 82  TTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTY 141
           TTIP  AV  I  +L+ALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPAKSI    +TY
Sbjct: 90  TTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPAKSIPNLASTY 149

Query: 142 ENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV 201
           ENVDL++IRENTEGEYSGIEH + PGVVQSIKLITR ASE+VI+YAFEY R+IGR  +IV
Sbjct: 150 ENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYTRSIGRSNLIV 209

Query: 202 VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLY 261
           VHK+TIQR  DGLFV  A+E++ +YPD+ L+ ELIDN+VL  + NP  Y D+VSVCPNLY
Sbjct: 210 VHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYADSVSVCPNLY 269

Query: 262 GDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMML 321
           GDI                  ANIG  + ++EAVHGSAPDIAGQDKANPTALLLSSVMML
Sbjct: 270 GDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANPTALLLSSVMML 328

Query: 322 NHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           NHMGL  +AD I+ AVL+TI SG E RT DL G+ATT+SFT+AVI+ L
Sbjct: 329 NHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  278 bits (712), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 157/349 (44%), Positives = 212/349 (60%), Gaps = 9/349 (2%)

Query: 24  GRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTT 83
           GR    P    G+YTV+ I GDGIG E++ SV +IF A NVP++WES ++S +  N    
Sbjct: 17  GREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVPVDWESVELSALEENHEGV 76

Query: 84  IPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
               AV+S+ +N V LKG   TP  + GH SLN+  RK   +FANV   KS  G KT  +
Sbjct: 77  --QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQ 134

Query: 143 NVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVV 202
           +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    R  V  V
Sbjct: 135 DVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALKNNRKAVCAV 194

Query: 203 HKSTIQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLY 261
           HK+ I +L DGLF N   E+ +KEYP++ + + ++DN+ ++ V  P  +   V V PNLY
Sbjct: 195 HKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNASMQAVAKPHQFD--VLVTPNLY 252

Query: 262 GDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMM 320
           G I                  AN G + ++FE        DI GQD ANPTA++LSS +M
Sbjct: 253 GSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILSSTLM 311

Query: 321 LNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           L H+GL  +AD+I  A   TIA G    T D+ GTATT+ FT AVI +L
Sbjct: 312 LRHLGLNEYADRISRATYETIAEGKRT-TKDIGGTATTTEFTNAVIDKL 359

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  274 bits (700), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 213/343 (62%), Gaps = 9/343 (2%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAV 89
           P    G+YTV+ I GDG+G E++ SV  IF A NVPI+WES ++S +  N        AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEAENVPIDWESVELSGLEEN--MEGVQKAV 80

Query: 90  QSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVL 148
           +S+ +N V LKG  +TP  + GH SLN+  RK   +FANV   KS  G KT  ++VDLV+
Sbjct: 81  ESLKRNKVGLKGIWSTPADQTGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVI 140

Query: 149 IRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTIQ 208
           IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    R  V  VHK+ I 
Sbjct: 141 IRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALKNNRRSVCAVHKANIM 200

Query: 209 RLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXX 267
           +L DGLF N   E+ +KEYP+L +++ ++DN+ ++ V  P  +   V V PNLYG I   
Sbjct: 201 KLGDGLFRNTVNEIGAKEYPELEVKSIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 257

Query: 268 XXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGL 326
                          AN G + ++FE        DI GQD ANPTA++LSS +ML H+GL
Sbjct: 258 NVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGL 317

Query: 327 TNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            ++AD+I  A    IA G ++ T D+ G A+T+ FT+A++ +L
Sbjct: 318 NDYADRISKATYEVIAEG-KHTTKDIGGHASTTQFTKAIVDKL 359

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  273 bits (697), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 212/345 (61%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPD--P 87
           P    G+YTV+ I GDG+G E++ SV KIF   N+PI+WE+ D+S     GL    +   
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDIS-----GLENTENVQR 77

Query: 88  AVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDL 146
           AV+S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   KSI G KT   N+D+
Sbjct: 78  AVESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDM 137

Query: 147 VLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+AF++A    R  V  VHK+ 
Sbjct: 138 VIIRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKAN 197

Query: 207 IQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIX 265
           I +L DGLF N   E+ + EYP+L ++  ++DN+ ++ V  P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 266 XXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI GQ+ ANPTA++LSS +ML H+
Sbjct: 255 LGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHL 314

Query: 325 GLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           GL  +AD+I  A    I+ G ++ T D+ G+A+TS FT AVI++L
Sbjct: 315 GLNAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  270 bits (690), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 151/346 (43%), Positives = 218/346 (63%), Gaps = 15/346 (4%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPD--P 87
           P    G+YTV+ I GDG+G E++ SV  IF A NVP++W+  D+S     G+    D   
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVPVDWDRVDIS-----GVDRAEDVKS 76

Query: 88  AVQSITKNLVALKGPLAT-PIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVD 145
           AV+S+ +N + LKG   T P  + GH SLN+ LRK   ++ANV   KSI G +    +VD
Sbjct: 77  AVESLKRNRIGLKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVD 136

Query: 146 LVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKS 205
           LV+IRENTEGE+SG+EH   PGVV+S+K++T+D  ER+ R+AF+YA+   R +V+ VHK+
Sbjct: 137 LVVIRENTEGEFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYAKKNDRKQVVAVHKA 196

Query: 206 TIQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDI 264
            I ++ DGLF N+ +E+  KEYP+L +   ++DN+ ++ V NP  +   V V P++YG I
Sbjct: 197 NIMKMGDGLFKNLVQEVGEKEYPELQVGNIIVDNASMQTVANPHQFD--VLVTPSMYGTI 254

Query: 265 XXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNH 323
                             AN G  +++FE        DI GQ+ ANPTA++LSSV++LNH
Sbjct: 255 -LGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNH 313

Query: 324 MGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           +GL   AD+I  AV + IA G ++ T D+ GTA+T+ FTEAVI +L
Sbjct: 314 LGLNTSADRISKAVHAVIAEG-KSVTRDIGGTASTTEFTEAVINKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  263 bits (671), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 212/345 (61%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIP--DP 87
           P    G+YTV+ I GDG+G E++ SV  IF + NVPI+WE+ ++S     GL        
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEIS-----GLDNEEGVQK 76

Query: 88  AVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDL 146
           AV S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   K++ G  + + NVDL
Sbjct: 77  AVDSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDL 136

Query: 147 VLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  S+R+ R+AF++A    R  V  VHK+ 
Sbjct: 137 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKAN 196

Query: 207 IQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIX 265
           I +L DGLF N   E+ +KEYP++ ++  ++DN+ ++ V  P  +   V V PNLYG I 
Sbjct: 197 IMKLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 253

Query: 266 XXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI GQ+ ANPTA++LSS +ML H+
Sbjct: 254 LGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHL 313

Query: 325 GLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           GL ++AD+I  A    IA   +N T D+ G+A+T+ FT+A+I++L
Sbjct: 314 GLNSYADRISKATYDVIAEA-KNTTKDIGGSASTTDFTQAIIEKL 357

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  262 bits (670), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 211/344 (61%), Gaps = 12/344 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           P    G+YTV+ I GDG+G E++ SV  IF A NVPI+WE+ +++ +    G+      A
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINITGVDSEEGV----QKA 78

Query: 89  VQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLV 147
           V+S+ +N + LKG   TP  + GH SLN+  RK   +FANV   K++ G KT   N+DLV
Sbjct: 79  VESLKRNKIGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDLV 138

Query: 148 LIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTI 207
           +IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A    R  V  VHK+ I
Sbjct: 139 VIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFALKNNRKSVCAVHKANI 198

Query: 208 QRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXX 266
            +L DGLF N   E+ + EYP++ ++  ++DN+ ++ V  P  +   V V PNLYG I  
Sbjct: 199 MKLGDGLFRNTVNEVGASEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-L 255

Query: 267 XXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMG 325
                           AN G + ++FE        DI G+D ANPTA++LSS +ML H+G
Sbjct: 256 GNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLG 315

Query: 326 LTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           L  +AD+I  A    IA G ++ T D+ G+++T+ FT++VI +L
Sbjct: 316 LNGYADRISKATYDVIAEG-KHTTKDIGGSSSTTEFTKSVIDKL 358

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  262 bits (670), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 213/344 (61%), Gaps = 12/344 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           P    G++TV+ I GDG+G EI+ SVK IF A  +P++WE+ ++       G+      A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVDWETVNIKQTDHKEGVY----EA 77

Query: 89  VQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLV 147
           V+S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 148 LIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTI 207
           +IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 208 QRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXX 266
            +L DGLF N+  E+  KEYPD+ + + ++DN+ ++ V  P  +   V V P++YG I  
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-L 254

Query: 267 XXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMG 325
                           AN G   ++FE        DI GQ+ ANPTA++LSSV+MLNH+G
Sbjct: 255 GNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLG 314

Query: 326 LTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           L  +A +I  AV  TIA G ++ T D+ G+++T+ FT  +I +L
Sbjct: 315 LNEYATRISKAVHETIAEG-KHTTKDIGGSSSTTDFTNEIINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  262 bits (669), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 213/344 (61%), Gaps = 12/344 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           P    G++TV+ I GDG+G EI+ SV+ IF A N+PI+WE+ ++       G+      A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQTDHKEGVY----EA 77

Query: 89  VQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLV 147
           V+S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 148 LIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTI 207
           +IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANI 197

Query: 208 QRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXX 266
            +L DGLF N+  E+  KEYPD+ + + ++DN+ ++ V  P  +   V V P++YG I  
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-L 254

Query: 267 XXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMG 325
                           AN G   ++FE        DI GQ+ ANPTA++LSS +MLNH+G
Sbjct: 255 GNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLG 314

Query: 326 LTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           L  +A +I  AV  TIA G ++ T D+ G+++T+ FT  +I +L
Sbjct: 315 LNEYATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 357

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  261 bits (668), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 147/343 (42%), Positives = 211/343 (61%), Gaps = 10/343 (2%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAV 89
           P    G++TV+ + GDG+G EI+ SV  IF + NVPI+WE+ D+S +     T     AV
Sbjct: 21  PKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWETVDISGL---DHTEGVKAAV 77

Query: 90  QSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVL 148
            S+ +N + LKG   TP  + GH SLN+  RK   ++ANV   KSIEG KT   NVDLV+
Sbjct: 78  DSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 149 IRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTIQ 208
           IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A+   R  V  VHK+ I 
Sbjct: 138 IRENTEGEYSGLEHESVPGVVESLKIITKSKSERIARFAFDFAKRNNRKSVTAVHKANIM 197

Query: 209 RLADGLFVN-VAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXX 267
           +L+DGLF N V+K   +EYP++   + ++DN+ ++ V  P  +   V V P++YG I   
Sbjct: 198 KLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-VG 254

Query: 268 XXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGL 326
                           N G   ++FE        DI GQ+ ANPTA+LLS+ ++L+H+GL
Sbjct: 255 NIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSATLLLDHLGL 314

Query: 327 TNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
              A++I++AV   IA G    T D+ G+A+T+ FT+AVI +L
Sbjct: 315 EKSANRIKSAVYDVIAEGKAT-TQDIGGSASTTEFTQAVINKL 356

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  261 bits (667), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 210/345 (60%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIP--DP 87
           P    G+YTV+ I GDG+G E++ SV  IF + N+PI+WE+ ++S     GL        
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVEIS-----GLDNQEGVQK 77

Query: 88  AVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDL 146
           AV+S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   KS+ G  + + NVD+
Sbjct: 78  AVESLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 147 VLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    R  V  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVKNNRKSVCAVHKAN 197

Query: 207 IQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIX 265
           I +L DGLF N   E+ +KEYP++ ++  ++DN+ ++ V  P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNCINEVGAKEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 266 XXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI GQ+ ANPTA++LSS +ML H+
Sbjct: 255 LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHL 314

Query: 325 GLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           GL  +AD+I  A    IA   +  T D+ G+A+T+ FTEA+I +L
Sbjct: 315 GLNAYADRISKATYDVIAEA-KTTTQDIGGSASTTEFTEAIISKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  259 bits (661), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 213/344 (61%), Gaps = 12/344 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           P    G+YTV+ I GDG+G E++ SV  IF+A N+PI+WE  D+S +    G+    + A
Sbjct: 27  PKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENLPIDWERVDISGLDHEEGV----EAA 82

Query: 89  VQSITKNLVALKGPLATPIGKG-HRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLV 147
           V S+ +N + LKG   T  G+  H SLN+ LRK   ++ANV   K++ G KT   +VDLV
Sbjct: 83  VNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 148 LIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTI 207
           +IRENTEGEYSG+EH   PGVV+S+K+IT++ SER+ R+AF++A+   R  V  VHK+ I
Sbjct: 143 IIRENTEGEYSGLEHESVPGVVESLKIITKEKSERIARFAFDFAKRFDRKLVTAVHKANI 202

Query: 208 QRLADGLFVNVAKELSK-EYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXX 266
            +L DGLF N    + + EYPD+ + + ++DN+ ++ V  P  +   V V P++YG I  
Sbjct: 203 MKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASMQSVAKPHQFD--VLVTPSMYGTI-L 259

Query: 267 XXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMG 325
                           AN G + ++FE        DI GQ+ ANPTA++LSS ++L H+G
Sbjct: 260 GNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLKHLG 319

Query: 326 LTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           L N A +I++AV  TIA G +  T D+ G+A+T+ FT  +IK+L
Sbjct: 320 LNNEAKKIEDAVYKTIAEG-KVTTRDIGGSASTTEFTNEIIKKL 362

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  257 bits (657), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 140/344 (40%), Positives = 213/344 (61%), Gaps = 12/344 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           P    G++TV+ I GDG+G EI+ SV+ IF A  +P++WE+ ++       G+      A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVDWETINIKQTDHKEGVY----EA 77

Query: 89  VQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLV 147
           V+S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 148 LIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTI 207
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 208 QRLADGLFVNVAKELSK-EYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXX 266
            +L DGLF N+  E+ + EYPD+ + + ++DN+ ++ V  P  +   V V P++YG I  
Sbjct: 198 MKLGDGLFRNIITEIGQTEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-L 254

Query: 267 XXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMG 325
                           AN G   ++FE        DI GQ+ ANPTA++LSSV+MLNH+G
Sbjct: 255 GNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLG 314

Query: 326 LTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           L  +A +I  AV  TIA G ++ T D+ G+++T+ FT  VI +L
Sbjct: 315 LNENATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEVINKL 357

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  256 bits (655), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 207/345 (60%), Gaps = 13/345 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           PN   G+YTV+ + GDG+G E + SV  +F+A N+PI+WE  ++S +    G+      A
Sbjct: 20  PNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIVNISGLDHKEGVAA----A 75

Query: 89  VQSITKNLVALKGPLATPIG--KGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDL 146
           VQS+ +N + LKG   T      GH SLN+  RK   ++ANV   KS++G KT   +VDL
Sbjct: 76  VQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDL 135

Query: 147 VLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKST 206
           V+IRENTEGE+SG+EH    GVV+S+K+ T   +ER+ R+AF YA+  GR  V  VHK+ 
Sbjct: 136 VVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAFNYAQKNGRKAVCAVHKAN 195

Query: 207 IQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIX 265
           I +L DGLF N    +  KEYPD+   + ++DN+ ++ V  P  +   V V P++YG I 
Sbjct: 196 IMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI- 252

Query: 266 XXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI GQ+ ANPTA+LLSS +MLNH+
Sbjct: 253 IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHL 312

Query: 325 GLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           GLT    +I +AV   IA G + RT D+ G ATT+ FT+AVI++L
Sbjct: 313 GLTKSGKRISDAVREVIAEG-DVRTKDIGGDATTTEFTQAVIEKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  255 bits (651), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 205/345 (59%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPD--P 87
           P    G+YTV+ I GDG+G EI+ SV  IF A N+P++WE  D+S         I D   
Sbjct: 20  PKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIPVDWERVDIST-----SDNIQDVSQ 74

Query: 88  AVQSITKNLVALKGPLATPIG-KGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDL 146
           AV+S+ +N + LKG   T      H S N+ LRK   +FA+V   KS+ G KT   NVDL
Sbjct: 75  AVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDL 134

Query: 147 VLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A+   R  V  VHK+ 
Sbjct: 135 VVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFAKKYNRKSVCAVHKAN 194

Query: 207 IQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIX 265
           I ++ DGLF N   E+ + EYPD+   + ++DN+ ++ V  P  +   V V P++YG I 
Sbjct: 195 IMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI- 251

Query: 266 XXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHM 324
                            A+ G + ++FE        DI G++ ANPTA++LSS +ML H+
Sbjct: 252 IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHL 311

Query: 325 GLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           GLT  A +I  A    I+ G +  T D+ G+A+T+ FTEA+IKRL
Sbjct: 312 GLTESAKRIAKATHDVISLG-QVTTKDIGGSASTTEFTEAIIKRL 355

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  253 bits (645), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 216/361 (59%), Gaps = 18/361 (4%)

Query: 18  VKQPSIGRYTGK----PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDV 73
           V + SI  +T      P    G+YTV+ I GDGIG E++ SV KIF++  +PI+WE  DV
Sbjct: 6   VSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERIDV 65

Query: 74  SPIFVNGLTTIPD--PAVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRP 130
                 G++   +   AV+S+ +N + LKG   T   + G+ SLN+ LRK   +FANV  
Sbjct: 66  P-----GMSNENEVKKAVESLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVAI 120

Query: 131 AKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEY 190
            KS++G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+AF++
Sbjct: 121 FKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKPKTERIARFAFDF 180

Query: 191 ARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSA 249
           A    R  V  VHK+ I +L+DGLF N   E+  KEYPD+ + T ++DN+ ++ V  P  
Sbjct: 181 ALENNRSTVTAVHKANIMKLSDGLFKNTVAEVGEKEYPDIKVNTIIVDNASMQAVAKPHQ 240

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKA 308
           +   V V P++YG I                  AN G + ++FE        DI  Q+ A
Sbjct: 241 FD--VMVTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIA 297

Query: 309 NPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKR 368
           NPTA++LS+ +MLN +GL   + +I NAV + I  G +  T D+ G A+T+ FT+AVI +
Sbjct: 298 NPTAMILSATLMLNQLGLREESKRISNAVYAVIEEG-KTTTKDIGGNASTTEFTDAVIDK 356

Query: 369 L 369
           L
Sbjct: 357 L 357

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  251 bits (642), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 143/343 (41%), Positives = 204/343 (59%), Gaps = 11/343 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAV 89
           P    G+YTV+ + GDG+G EI+ SV  IF A N+PI+WE  ++S +    + T    AV
Sbjct: 22  PKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDWERVELSGLEQEDVHT----AV 77

Query: 90  QSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVL 148
           +S+ +N + LKG   T     GH S N+ LRK   ++ANV   KS +G  T   +VDLV+
Sbjct: 78  ESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVI 137

Query: 149 IRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTIQ 208
           IRENTEGEYSG+EH   PGVV+S+K++T   +ER+ R+AF+YA    R  V  VHK+ I 
Sbjct: 138 IRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYAMKYNRKSVTAVHKANIM 197

Query: 209 RLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXX 267
           +L DGLF N+  E+ +KEYP++ + + ++DN+ ++ V  P  +   V V P++YG I   
Sbjct: 198 KLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQFD--VMVAPSMYGTI-LG 254

Query: 268 XXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGL 326
                          AN G   ++FE        DI  Q+ ANPTA++LS+ +MLNH+G 
Sbjct: 255 NIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGF 314

Query: 327 TNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            N A +I  AV   IA G +  T D+ G+ATT+ FT AVI +L
Sbjct: 315 RNDAARISKAVHEVIAEG-KTTTRDIGGSATTTEFTNAVIAKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  249 bits (635), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 211/347 (60%), Gaps = 17/347 (4%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           P    G++ V+ I GDG+G E++ SV  IF A N+PI+W+  D+S +    G+      A
Sbjct: 22  PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDWDRVDISGLDHEEGVQA----A 77

Query: 89  VQSITKNLVALKG----PLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENV 144
           V S+ +N + LKG      A   GKG  SLN+ LRK   ++ANV   KS+ G KT   NV
Sbjct: 78  VDSLKRNKIGLKGIWHTSAADQAGKG--SLNVALRKELDIYANVALFKSVPGVKTKIPNV 135

Query: 145 DLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHK 204
           DLV+IRENTEGEYSG+EH   PGVV+S+K++T D +ER+ R+AF++A+   R  V  VHK
Sbjct: 136 DLVVIRENTEGEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHK 195

Query: 205 STIQRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGD 263
           + I +L DGLF NV   +  +EYPD+ + + ++DN+ ++ V  P  +   V V P++YG 
Sbjct: 196 ANIMKLGDGLFRNVVTRVGEQEYPDVKVGSIIVDNASMQTVAKPHQFD--VLVTPSMYGT 253

Query: 264 IXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLN 322
           I                  AN G + ++FE        DI  ++ ANPTA++LS+ +ML+
Sbjct: 254 I-LGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLD 312

Query: 323 HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           H+GL+  A +I NAV   IA G ++ T D+ G+A+T+ FT+AVI++L
Sbjct: 313 HLGLSTSATKISNAVHQVIAEG-KSTTPDIGGSASTTEFTQAVIEKL 358

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  248 bits (632), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 140/343 (40%), Positives = 204/343 (59%), Gaps = 11/343 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           P    G+ TV+ + GDG+G EI+ SV  IF A NVPI+WE+ D+S +   +G+    + A
Sbjct: 22  PKKYGGRMTVTLLPGDGVGKEITDSVVSIFQAENVPIDWETVDISQLDHEDGV----NAA 77

Query: 89  VQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLV 147
           V+S+ +N + LKG   T   + GH SLN+  RK   ++ANV   KSI G KT   NVDLV
Sbjct: 78  VESLKRNKIGLKGIWHTSADQVGHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLV 137

Query: 148 LIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTI 207
           +IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ ++AF++A    R  V  VHK+ I
Sbjct: 138 IIRENTEGEYSGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRHDRKMVTAVHKANI 197

Query: 208 QRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXX 267
            +L+DGLF N    + + YP +  ++ ++DN+ ++ V  P  +   V V P++YG I   
Sbjct: 198 MKLSDGLFRNTVARVGEAYPQIKNDSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-LG 254

Query: 268 XXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGL 326
                           N G + ++FE        DI GQ+ ANPTA++LSS ++L H+GL
Sbjct: 255 NIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLQHLGL 314

Query: 327 TNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            + A +I  AV   I  G    T D+ G A+T+ FT+AVI +L
Sbjct: 315 NDTASRISKAVYDVIKEGNAT-TKDIGGNASTTEFTKAVIDKL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  238 bits (608), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 139/342 (40%), Positives = 204/342 (59%), Gaps = 13/342 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAV 89
           P    G++ ++ I G+GIG E++ SV+ IF A N+PI+WE  ++     +G+ T    AV
Sbjct: 16  PKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLPIDWEIVNIES-HRDGIKT----AV 70

Query: 90  QSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
            SI +N +ALKG  ++    G  SLN+ LRK   +FANV   KS +   T   NVDLV+I
Sbjct: 71  DSIKRNKIALKGIWSSDPIDG--SLNVALRKQLDIFANVAIFKSFDNVNTRIPNVDLVVI 128

Query: 150 RENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTIQR 209
           RENTEGE+SG+EH    GVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I +
Sbjct: 129 RENTEGEFSGLEHESVDGVVESLKIVTKPKTERIARFAFDFAKKHNRNHVTAVHKANIMK 188

Query: 210 LADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXXX 268
           L DGLF N+   + + EYP++   + ++DN+ ++ V  P  +   V V P++YG I    
Sbjct: 189 LGDGLFKNIVAHIGNNEYPEIKNSSIIVDNASMQAVAKPHQFD--VLVSPSMYGTI-LGN 245

Query: 269 XXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLT 327
                         AN G   ++FE        DI GQ+ ANPTA++LS+  ML H+GLT
Sbjct: 246 IGAALIGGPGLVPGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLT 305

Query: 328 NHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + A++I NAV   IA G    T D+ GTA+T+ FT+AVI  L
Sbjct: 306 SPAERITNAVKHVIAQG-TTVTKDIGGTASTTEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  211 bits (537), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 173/286 (60%), Gaps = 11/286 (3%)

Query: 30  PNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPI-FVNGLTTIPDPA 88
           P    G++TV+ I GDG+G E++ SVK IF A N+PI+WE+ ++       G+    + A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQTDHKEGV----NEA 77

Query: 89  VQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLV 147
           V+S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 148 LIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTI 207
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 208 QRLADGLFVNVAKEL-SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXX 266
            +L DGLF N+  E+  KEYPD+ + + ++DN+ ++ V  P  +   V V P++YG I  
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-L 254

Query: 267 XXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPT 311
                           AN G   ++FE        DI GQ+ ANPT
Sbjct: 255 GNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  160 bits (405), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 122/355 (34%), Positives = 178/355 (50%), Gaps = 31/355 (8%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K++    N    ++++  D+   F   L T   +PD  VQ +
Sbjct: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86

Query: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     VD+V++
Sbjct: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVI 200
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSV 256
           V HKS +   +DGLF  + K++      +Y  +T   +++D+ V ++   P  +   V V
Sbjct: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316
            PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP A + S
Sbjct: 263 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321

Query: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369
           + +ML  +G  + A  I  AV + +    EN  +T DL G +TT   TE V+ RL
Sbjct: 322 TALMLEFLGHNDAAQDIHRAVEANMR---ENKIKTPDLGGNSTTQQVTEDVLARL 373

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 115/360 (31%), Positives = 183/360 (50%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGIGPEISKSVKKIFS--AANVPIEWESCDVSP---IFVNGLTTIP 85
           N +    T+  I GDGIG E+  + KK+         I+++  D+      F++    +P
Sbjct: 17  NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALP 76

Query: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
           D  V  + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T   
Sbjct: 77  DETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDR 134

Query: 143 NVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RA 193
            VD+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A    + 
Sbjct: 135 PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKN 194

Query: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDL----TLETELIDNSVLKVVTNPSA 249
            G+  + V HKS +   +DGLF  V +++ ++  DL    +   +++D+ V ++   P  
Sbjct: 195 TGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPEC 254

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKAN 309
           +   V V PNLYGDI                  AN+G  I I E  HGSAPDI+GQ  +N
Sbjct: 255 FD--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPDIIIGEPCHGSAPDISGQGISN 311

Query: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           P A + S+ +ML  +G    A  IQNAV   I SG + +T DL G ++T+  T+ ++ +L
Sbjct: 312 PVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 180/360 (50%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IP 85
           N +    T+  I GDGIG E+  + K++  + N    + ++  D+   F     T   +P
Sbjct: 19  NAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALP 78

Query: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
           D  VQ + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+EG  +   
Sbjct: 79  DETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG--SNER 136

Query: 143 NVDLVLIRENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RA 193
            VD++++RENTE  Y  IE           V ++ K I+  A++R+   A + A    + 
Sbjct: 137 PVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQN 196

Query: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSA 249
            G+  + V HKS +   +DGLF  V +E+      +Y  +T   +++D+ V ++   P  
Sbjct: 197 NGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPEC 256

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKAN 309
           +   V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  AN
Sbjct: 257 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 313

Query: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           P A + S+ +ML  +G    A  I  AV + +  G   +T DL G ATT +  + ++ RL
Sbjct: 314 PIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLV-KTADLGGNATTQNVVDDILARL 372

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  155 bits (393), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/354 (33%), Positives = 177/354 (50%), Gaps = 29/354 (8%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSP---IFVNGLTTIPDPAVQSI 92
           T+  I GDGIG E+  + K++    N    + +E  D+      F++    +P   V  I
Sbjct: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTV-DI 81

Query: 93  TKNLV--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVL 148
            KN    AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T  + +DLV+
Sbjct: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVI 139

Query: 149 IRENTEGEYSGIEHIVC-----PGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRV 199
           +RENTE  Y  IE           + ++ K IT  A++R+ + A + A    +  G   +
Sbjct: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199

Query: 200 IVVHKSTIQRLADGLFVNVAKELSKE----YPDLTLETELIDNSVLKVVTNPSAYTDAVS 255
            V HKS +   +DGLF  V KE+ +     Y  +    +++D+ V ++   P  +   V 
Sbjct: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VI 257

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLL 315
           V PNLYGDI                  AN+G  I I E  HGSAPDIAG+  ANP A + 
Sbjct: 258 VAPNLYGDILSDGAAALVGSLGLVPS-ANVGPNIVIGEPCHGSAPDIAGKGIANPIATIR 316

Query: 316 SSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           S+  ML ++G +N A  I  AV + I    + +T DL G +TT    + ++ +L
Sbjct: 317 STAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  155 bits (392), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 118/355 (33%), Positives = 179/355 (50%), Gaps = 30/355 (8%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K++    N    + ++  D+   F   L T   +PD  +Q +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQ-V 83

Query: 93  TKNLV--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVL 148
            KN    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG  TT + VD+V+
Sbjct: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVI 141

Query: 149 IRENTEG------EYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPR 198
           +RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  
Sbjct: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201

Query: 199 VIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
           + V HKS +   +DGLF  + K++      +Y  +    +++D+ V ++   P  +   V
Sbjct: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--V 259

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
            V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  +NP A +
Sbjct: 260 VVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATI 318

Query: 315 LSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            S+ +ML  +G    A  I  AV + +    + +T DL G +TT   TE V+ RL
Sbjct: 319 RSTALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  154 bits (389), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 175/360 (48%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IP 85
           N +    T+  I GDGIG E+  + K++    N    + +   D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
           D  V+ + +    AL G + +P  K  G+ S  + LR+  GLFANVRP KS+EG K   +
Sbjct: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--K 135

Query: 143 NVDLVLIRENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RA 193
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQT 195

Query: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSA 249
            G   + V HKS +   +DGLF  + KE+      +Y  +    +++D+ V ++   P  
Sbjct: 196 RGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKAN 309
           +   V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           P A + S+ +ML  +G  N A  I  AV + +  G   +T DL G A+T    E V+ RL
Sbjct: 313 PIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  154 bits (388), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/360 (34%), Positives = 171/360 (47%), Gaps = 41/360 (11%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAAN-----------VPIEWESCDVSPIFVNGLTTIPD 86
           T+  I GDGIG E+  + KKI  + N           +   WE+      F N    +PD
Sbjct: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75

Query: 87  PAVQSITKNLV--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
             +  I KN    AL G + +P  K  G+ S  + LRK  GLFANVRP KS++G K    
Sbjct: 76  ETI-DILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--R 132

Query: 143 NVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI--- 194
            VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A + A+     
Sbjct: 133 KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQ 192

Query: 195 -GRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSA 249
            G   + V HKS +   +DGLF  V +E       +Y  +    +++D+ V ++   P  
Sbjct: 193 NGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPEC 252

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKAN 309
           +   V V PNLYGDI                  AN+G  I I E  HGSAPDIAG+  +N
Sbjct: 253 FD--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPNIVIGEPCHGSAPDIAGKGISN 309

Query: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           P A + S+ +ML  +G    A  I  AV + I  G +  T DL G +TT    E V+ +L
Sbjct: 310 PIATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 117/359 (32%), Positives = 176/359 (49%), Gaps = 39/359 (10%)

Query: 38  TVSFIEGDGIGPEISKSVKKI-----------FSAANVPIEWESCDVSPIFVNGLTTIPD 86
           T+  I GDGIG E+  + K+I           F   ++   WE+      F N    +PD
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79

Query: 87  PAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYEN 143
             V+ + ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T    
Sbjct: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137

Query: 144 VDLVLIRENTEGEYSGIEHIVC-PG----VVQSIKLITRDASERVIRYAFEYA----RAI 194
           VD+V++RENTE  Y  IE     P     V ++ K I+  A+ R+   A + A    ++ 
Sbjct: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAY 250
           G   + V HKS +   +DGLF  + K++      +Y  +    +++D+ V ++   P  +
Sbjct: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257

Query: 251 TDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANP 310
              V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP
Sbjct: 258 D--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGRGIANP 314

Query: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            A + S+ +ML  +G    A  I  AV S I    + +T DL G +TT    + ++ ++
Sbjct: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  152 bits (384), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 118/381 (30%), Positives = 186/381 (48%), Gaps = 43/381 (11%)

Query: 16  ATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI-----------FSAANV 64
           +TV Q +   Y     P     T+  I GDGIG E+  + K +           F+  ++
Sbjct: 4   STVSQFARRSYASAAKP----LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDL 59

Query: 65  PIEWESCDVSPIFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKT 121
              W++      F++    +PD  ++ +  +   AL G + +P  K  G+ S  + LRK 
Sbjct: 60  QAGWQT------FLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKK 113

Query: 122 FGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLIT 176
            GL+ANVRP KS++G  T    VD++++RENTE  Y     + I+      V ++IK I+
Sbjct: 114 LGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRIS 171

Query: 177 RDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAK---ELSKE-YPD 228
             A+  + + A E +    +A G+  + V HKS +   +DGLF  V K   E +KE Y  
Sbjct: 172 ETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGA 231

Query: 229 LTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHK 288
           +    +++D+ V ++   P  +   V V PNLYGDI                  AN+GH 
Sbjct: 232 IGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGHD 288

Query: 289 ISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENR 348
             + E  HGSAPDIAG+  +NP A + S+ +ML  MG T  A  I  AV + I    + +
Sbjct: 289 FIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIK 347

Query: 349 TGDLAGTATTSSFTEAVIKRL 369
           T DL G +TT    + ++ ++
Sbjct: 348 TPDLGGKSTTQQVVDDILSKM 368

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  152 bits (383), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 112/353 (31%), Positives = 171/353 (48%), Gaps = 28/353 (7%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSA----ANVPIEWESCDVS-PIFVNGLTTIPDPAVQSI 92
           T+  I GDGIG E+  + +++  A     ++   +E  D     F+     +P   V+++
Sbjct: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81

Query: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T + VDLV++
Sbjct: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERV----IRYAFEYARAIGRPRVI 200
           RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSV 256
           V HKS +    DGLF  V +E+     K Y  +    +++D+ V ++   P  +   V V
Sbjct: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316
            PNLYGD+                   N+G+ I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 APNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315

Query: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
             +ML  +GL   A  I  AV   +    +  + DL G  TT    + ++ R+
Sbjct: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  151 bits (381), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 120/377 (31%), Positives = 185/377 (49%), Gaps = 44/377 (11%)

Query: 20  QPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI-----------FSAANVPIEW 68
           Q +IG  + K N      T+  I GDGIG E+  S +++           F+  ++   W
Sbjct: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66

Query: 69  ESCDVSPIFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLF 125
           ++      F++    +P   V+++ +N   AL G + +P  K  G+ S  + LRK  GL+
Sbjct: 67  QT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 126 ANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG-----VVQSIKLITRDAS 180
           AN+RP KS++      + VD+V++RENTE  Y  +E           V  + K I+  A+
Sbjct: 121 ANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVAT 178

Query: 181 ERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE----YPDLTLE 232
            R+ + A + A    +  G  ++ V HKS +   +DGLF  V KE+ +     Y D+   
Sbjct: 179 RRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYN 238

Query: 233 TELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIF 292
            ++ID+ V ++   P  +   V V PNLYGDI                  AN+G  I I 
Sbjct: 239 EQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPGIVIG 295

Query: 293 EAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDL 352
           E  HGSAPDIAG+  +NP A + S+ +ML  +G +  A  IQ AV S +    + +T DL
Sbjct: 296 EPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTPDL 354

Query: 353 AGTATTSSFTEAVIKRL 369
            G  +TS     VI+RL
Sbjct: 355 GGKNSTSDVVNDVIRRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  151 bits (381), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 175/360 (48%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IP 85
           N +    T+  I GDGIG E+  + K++    N    + +   D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
           D  V+ + +    AL G + +P  K  G+ S  + LR+  GLFANVRP KS+EG K   +
Sbjct: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--K 135

Query: 143 NVDLVLIRENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RA 193
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQT 195

Query: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSA 249
            G+  + V HKS +   +DGLF  + KE+      +Y  +    +++D+ V ++   P  
Sbjct: 196 RGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKAN 309
           +   V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           P A + S+ +ML  +G    A  I  AV + +  G   +T DL G A+T    + V+ RL
Sbjct: 313 PIATIRSTALMLEFLGHNEAAQDIYKAVDANLREG-SIKTPDLGGKASTQQVVDDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  150 bits (379), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 174/360 (48%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IP 85
           N +    T+  I GDGIG E+  + K+I    N    + +   D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
           D  ++ +      AL G + +P  K  G+ S  + LR+  GL+ANVRP KS+EG K   +
Sbjct: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135

Query: 143 NVDLVLIRENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RA 193
            +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195

Query: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSA 249
            G   + V HKS +   +DGLF  + K++      +Y  +    +++D+ V ++   P  
Sbjct: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKAN 309
           +   V V PNLYGDI                  AN+G  I I E  HGSAPDIAG+  AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVIGEPCHGSAPDIAGKGIAN 312

Query: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           P A + S+ +ML  +G  + A  I  AV + +  G    T DL G A+T    + V+ RL
Sbjct: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  149 bits (377), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 171/360 (47%), Gaps = 27/360 (7%)

Query: 31  NPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IP 85
           N +    T+  I GDGIG E+  + K++    N    + +   D+   F     T   +P
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77

Query: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
           D  V  + K    AL G + +P  K  G+ S  + LR+  GLFANVRP KS+EG +   +
Sbjct: 78  DETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--K 135

Query: 143 NVDLVLIRENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RA 193
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    + 
Sbjct: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQT 195

Query: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSA 249
            G   + V HKS +    DGLF  + KE+      +Y  +    +++D+ V ++   P  
Sbjct: 196 RGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKAN 309
           +   V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  AN
Sbjct: 256 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 312

Query: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           P A + S+ +ML  +G    A  I  AV + +  G    T DL G A+T    + V+ RL
Sbjct: 313 PIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  146 bits (369), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 108/352 (30%), Positives = 177/352 (50%), Gaps = 27/352 (7%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA--ANVPIEWESCDVSP---IFVNGLTTIPDPAVQSIT 93
           +  I GDGIG E+  + K++  A  +   ++++  D+      F      +PD  V+ + 
Sbjct: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82

Query: 94  KNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIR 150
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+E  K    NVD++++R
Sbjct: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140

Query: 151 ENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIV 201
           ENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G   + V
Sbjct: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200

Query: 202 VHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVC 257
            HKS +   +DGLF  + K++      +Y ++    +++D+ V ++   P  +   V V 
Sbjct: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258

Query: 258 PNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSS 317
           PNLYGDI                  AN+G +I I E  HGSAPDIAG+  +NP A + S+
Sbjct: 259 PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317

Query: 318 VMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +ML  +G    A  I  AV + +  G  N T DL G ATT    + ++ ++
Sbjct: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  145 bits (366), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 115/374 (30%), Positives = 180/374 (48%), Gaps = 42/374 (11%)

Query: 24  GRYTGKPNPSTGKYTVSFIEGDGIGPEI----SKSVKKI-------FSAANVPIEWESCD 72
           G+ + +   ++  +T+  I GDGIG E+     K ++KI       F   ++   W++  
Sbjct: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT-- 64

Query: 73  VSPIFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVR 129
               F++    +PD  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+R
Sbjct: 65  ----FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120

Query: 130 PAKSIEGFKTTYENVDLVLIRENTE-----GEYSGIEHIVCPGVVQSIKLITRDASERVI 184
           P KS++G  T    VDLV+ RENTE      E + I+      V ++IK I+  A+  + 
Sbjct: 121 PVKSVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178

Query: 185 RYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL---SKEYPDLTLETELID 237
             A E A    +  G   + V HKS +   +DGLF  + K +   +K++ ++    +++D
Sbjct: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVD 238

Query: 238 NSVLKVVTNPSAYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHG 297
           + V ++   P  +   V V PNLYGDI                   N+G  I I E  HG
Sbjct: 239 SMVYRLFKEPQCFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHG 295

Query: 298 SAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGT 355
           SAPDI GQ  ANP A + S+ ++L  +GL   A  I+  V   I    EN  +T DL G 
Sbjct: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGN 352

Query: 356 ATTSSFTEAVIKRL 369
           +T       ++ R+
Sbjct: 353 STGEQVANDILSRI 366

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  141 bits (355), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 172/353 (48%), Gaps = 29/353 (8%)

Query: 39  VSFIEGDGIGPEISKSVKKIFS--AANVPIEWESCDVSP---IFVNGLTTIPDPAVQSIT 93
           +  I GDGIG E+  + K++    +    + ++  D+      F      +P+  VQ + 
Sbjct: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQ-VL 82

Query: 94  KNLV--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
           KN    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG K     VD+V++
Sbjct: 83  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIV 140

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVI 200
           RENTE  Y  +E           V ++ K I+  A+ R+   A + A    +  G   + 
Sbjct: 141 RENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLT 200

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSV 256
           V HKS +   +DGLF  + K++      +Y  +    +++D+ V ++   P  +   V V
Sbjct: 201 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVV 258

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316
            PNLYGDI                  AN+G +I I E  HGSAPDIAG+  +NP A + S
Sbjct: 259 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRS 317

Query: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + +ML  +G    A  I  AV + +    + +T DL G +TT    E ++ +L
Sbjct: 318 TGLMLEFLGHNKPAQDIYRAVDANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  137 bits (346), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 177/354 (50%), Gaps = 29/354 (8%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFS--AANVPIEWESCDVSPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K++    ++   + +   D+   F   L T   +PD  V+ +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84

Query: 93  TKNLVA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +  + VD+V++
Sbjct: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143

Query: 150 RENTEGEYSGIEHIVCPG----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIV 201
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    +  G+  + V
Sbjct: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203

Query: 202 VHKSTIQRLADGLFVNVAKELSK----EYPDLTLETELIDNSVLKVVTNPSAYTDAVSVC 257
            HKS +   +DGLF  + K++ +    +Y  +    ++ID+ V ++   P  Y D + V 
Sbjct: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VA 261

Query: 258 PNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSS 317
           PNLYGDI                  AN+G  I + E  HGSAPDIAG+  ANP A + S+
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 318 VMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369
            +ML  +G    A  I  AV S +    EN  +T DL G ++T +  + V+++L
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNMR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  136 bits (342), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 109/365 (29%), Positives = 173/365 (47%), Gaps = 42/365 (11%)

Query: 33  STGKYTVSFIEGDGIGPEISKSVKKI-----------FSAANVPIEWESCDVSPIFVNGL 81
           +T   T+  I GDGIG E+  + K +           F+  ++   W++      F++  
Sbjct: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTG 70

Query: 82  TTIPDPAVQSITKNLV--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGF 137
             +PD  +  I KN    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   
Sbjct: 71  KALPDETI-DILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV--- 126

Query: 138 KTTYENVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA- 191
            +  + +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A 
Sbjct: 127 LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIAL 186

Query: 192 ---RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD----LTLETELIDNSVLKVV 244
              +  G   + V HKS +   +DGLF  + +++ +   D    +    +++D+ V ++ 
Sbjct: 187 QRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLF 246

Query: 245 TNPSAYTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAG 304
             P  +   V V PNLYGDI                  AN+G    + E  HGSAPDIAG
Sbjct: 247 REPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAG 303

Query: 305 QDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEA 364
           +  +NP A + S+ +ML  MG    A  I  AV + +      +T DL G +TT    + 
Sbjct: 304 KGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDD 362

Query: 365 VIKRL 369
           V+ R+
Sbjct: 363 VLSRM 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  135 bits (340), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 108/360 (30%), Positives = 168/360 (46%), Gaps = 42/360 (11%)

Query: 38  TVSFIEGDGIGPEISKSVKKI-----------FSAANVPIEWESCDVSPIFVNGLTTIPD 86
           T+  I GDGIG E+  + +++           F   ++   W++      F      +PD
Sbjct: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQT------FQETGKALPD 75

Query: 87  PAVQSITKNLV--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
             +  I +N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+        
Sbjct: 76  ETI-DILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQER 131

Query: 143 NVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RA 193
            VD++++RENTE  Y     + I+      V ++IK I+  A++ +   A E A    + 
Sbjct: 132 PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKV 191

Query: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD----LTLETELIDNSVLKVVTNPSA 249
            G   + V HKS +   +DGLF  V +++ +   D    +    +++D+ V ++   P  
Sbjct: 192 NGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPEC 251

Query: 250 YTDAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKAN 309
           +   V V PNLYGDI                  AN+G    + E  HGSAPDIAG+  +N
Sbjct: 252 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISN 308

Query: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           P A + S+ +ML  MG    A  I  AV + +      +T DL G +TT    E V+ R+
Sbjct: 309 PVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 89.4 bits (220), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 125/276 (45%), Gaps = 32/276 (11%)

Query: 116 LTLRKTFGLFANVRP----AKSIEGFK----TTYENVDLVLIRENTEGEYSG-IEHIVCP 166
           L +RK  GL+AN+RP    +KS+ G         +  D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAIGRP-------RVIVVHKSTIQRLADGLFVNVA 219
           GV    +  T    ER+ R     A     P       +  V+  S + R        V 
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRR------TVN 207

Query: 220 KELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXXXXXXXXXX---- 275
           + + +E+P L+++ +LID++ + ++ NP  + + + +  N++GDI               
Sbjct: 208 ETIKREFPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLL 266

Query: 276 -XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQI 333
                    +  +   ++E  HGSAPD+  + +ANP A +LS+ MML   + + +    I
Sbjct: 267 PSASLASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAI 325

Query: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           +NAV   I SG   RTGDL G  TT+   +AV   L
Sbjct: 326 ENAVKQVIESGI--RTGDLGGNNTTTEVGDAVTHAL 359

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 93/350 (26%), Positives = 152/350 (43%), Gaps = 34/350 (9%)

Query: 44  GDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGL------TTIPDPAVQSITKNLV 97
           GD IG E+ +   K+  A    +     D     V G       + +PD A+ +  +   
Sbjct: 12  GDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEADA 71

Query: 98  ALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRP----AKSIEGFK----TTYENV 144
            L G +  P  +G      + L L LR+  G++AN+RP    A S+            + 
Sbjct: 72  VLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIARDT 130

Query: 145 DLVLIRENTEGEYSGIEH-IVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR-VIVV 202
           D++++RE   G Y G  H     GV       T    +R+ R A   A     P  V  +
Sbjct: 131 DIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVWSL 190

Query: 203 HKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYG 262
            K+ +   +      V +    E+P++ L+ +LID++ + +V NP A+ + V V  N++G
Sbjct: 191 DKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTSNMFG 249

Query: 263 DIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDI-AGQDKANPTALLLS 316
           DI                        +      ++E  HGSAPD+ AG  KANP   +LS
Sbjct: 250 DIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPAG--KANPIGCILS 307

Query: 317 SVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAV 365
           + MML   + +    + ++ AV   + SG   RTGDL G+++TS   +A+
Sbjct: 308 AAMMLKLSLNMVAAGEAVEQAVQEVLDSG--VRTGDLLGSSSTSEVGDAI 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 94/363 (25%), Positives = 165/363 (45%), Gaps = 36/363 (9%)

Query: 33  STGKYTVSFIEGDGIGPEIS-------KSVKKIFSAANVPIEWESCDVSPIFVNGLTTIP 85
           ST K  V  + GD +G EI+       K++ ++ ++ N   ++     + I   G+  +P
Sbjct: 2   STKKIVV--LPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVP-LP 58

Query: 86  DPAVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEG 136
           D A+++   +   L G +  P  G G     + L L +RK  GL+AN+RP    ++S+ G
Sbjct: 59  DEALEASKNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLG 117

Query: 137 FKTTYENV----DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYA 191
                  +    D +++RE   G Y G  +     GV    +  +    +R+ R A   A
Sbjct: 118 LSPLRPEIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLA 177

Query: 192 RAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAY 250
                P  I  + K+ +   +      V + +  E+P LT++ +LID++ + +V NP+  
Sbjct: 178 LQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQNQLIDSAAMILVKNPTQL 237

Query: 251 TDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQ 305
            + + +  N++GDI                        +      ++E  HGSAPD+  +
Sbjct: 238 -NGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-K 295

Query: 306 DKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEA 364
            K NP A +LS+ MML   + L    D I+ AV   + +G   RTGDL G+ +T+   +A
Sbjct: 296 GKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAG--IRTGDLGGSNSTTEVGDA 353

Query: 365 VIK 367
           + K
Sbjct: 354 IAK 356

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 93/355 (26%), Positives = 162/355 (45%), Gaps = 32/355 (9%)

Query: 42  IEGDGIGPEISKSVKKIFSA-----ANVPIEWESCDVSPIFVNGL-TTIPDPAVQSITKN 95
           + GD +G EI+    K+  A     +NV  ++E+  +    ++     +PD A+++  K 
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKA 69

Query: 96  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTTY-E 142
              L G +  P  G G     + L L +RK   L+AN+RP          +   K  + +
Sbjct: 70  DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKPQFAK 128

Query: 143 NVDLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV 201
             D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P  I 
Sbjct: 129 GTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQHEPPLPIW 188

Query: 202 -VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNL 260
            + K+ +   +      V + +  E+P L ++ +LID++ + +V NP+ + + + +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIIITSNM 247

Query: 261 YGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPTALLL 315
           +GDI                    A++  K     ++E  HGSAPD+  ++K NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPVATIL 306

Query: 316 SSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           S+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV K +
Sbjct: 307 SAAMMLKLSLNLPEEGKAIEDAVKRVLDAG--IRTGDLGGSNSTTEVGDAVAKEV 359

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 94/356 (26%), Positives = 153/356 (42%), Gaps = 32/356 (8%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA-----ANVPIEWESCDVSPIFVNGL-TTIPDPAVQSI 92
           ++   GD IG EI +   K+  A      NV  ++    +    ++     + D A+Q  
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQVA 66

Query: 93  TKNLVALKGPLATPIGKGHRSLN-----LTLRKTFGLFANVRPAKSIEGF--------KT 139
             +   L G +  P   GH  +      L +RK  G++AN+RP + +           + 
Sbjct: 67  KNSDAILLGAVGGP-KWGHGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKRE 125

Query: 140 TYENVDLVLIRENTEGEYSGIEHIVCP-GVVQSIKLITRDASERVIRYAFEYARAIGRPR 198
             +  D V++RE   G Y G        GV    +  +    +R+ R A   A     P 
Sbjct: 126 IVQGTDFVIVRELVGGIYFGERQEAGDDGVAWDKESYSVPEIQRITRMAAFLALQHNPPL 185

Query: 199 -VIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVC 257
            V  + K+ +   +      V + +  E+P LT+   LID++ + +V NP+   + V + 
Sbjct: 186 PVWSLDKANVLATSRLWRKTVEETIKNEFPTLTINHHLIDSAAMTLVQNPTKL-NGVVIT 244

Query: 258 PNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPTA 312
            N++GDI                    A++  K   + ++E  HGSAPD+   D ANP A
Sbjct: 245 TNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPDLPA-DHANPIA 303

Query: 313 LLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
            +LS+ MM    + LT   + I+ AV  TI +G   +TGDL G  TT+    AV K
Sbjct: 304 TILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAGI--KTGDLGGKNTTTEVGNAVAK 357

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 96/364 (26%), Positives = 157/364 (43%), Gaps = 33/364 (9%)

Query: 33  STGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTT------IPD 86
           ST K  V  + GD +G EI++   K+  A +     +  +     + G         +PD
Sbjct: 2   STTKKIV-VLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPD 60

Query: 87  PAVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SI 134
            ++++  K+   L G +  P  G G     + L L +RK   L+AN+RP          +
Sbjct: 61  ASLEAAKKSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDL 119

Query: 135 EGFK-TTYENVDLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYAFEYAR 192
              K       D V++RE   G Y G  +     GV    +  +    +R+ R A   A 
Sbjct: 120 SPLKPECARGTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLAL 179

Query: 193 AIGRPR-VIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYT 251
               P  V  + K+ +   +      V + +  E+P LT++ +LID++ + +V NP+   
Sbjct: 180 QHSPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPTQL- 238

Query: 252 DAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQD 306
           + V +  N++GDI                        +      ++E  HGSAPD+  + 
Sbjct: 239 NGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KG 297

Query: 307 KANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAV 365
           K NP A +LS+ MML   + +      ++ AV   + SG   RT DL GT+TTS   EAV
Sbjct: 298 KVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG--VRTADLKGTSTTSEVGEAV 355

Query: 366 IKRL 369
           +K L
Sbjct: 356 VKAL 359

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 92/355 (25%), Positives = 162/355 (45%), Gaps = 32/355 (9%)

Query: 42  IEGDGIGPEISKSVKKIFSA-----ANVPIEWESCDVSPIFVNGL-TTIPDPAVQSITKN 95
           + GD +G EI+    K+  A     +NV  ++E+  +    ++     +PD A+++  K 
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKA 69

Query: 96  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTTY-E 142
              L G +  P  G G     + L L +RK   L+AN+RP          +   K  + +
Sbjct: 70  DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAK 128

Query: 143 NVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV 201
             D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P  I 
Sbjct: 129 GTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIW 188

Query: 202 -VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNL 260
            + K+ +   +      V + +  E+P L ++ +LID++ + +V NP+ + + + +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIIITSNM 247

Query: 261 YGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPTALLL 315
           +GDI                    A++  K     ++E  HGSAPD+  ++K NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATIL 306

Query: 316 SSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           S+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV + +
Sbjct: 307 SAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAEEV 359

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 159/359 (44%), Gaps = 40/359 (11%)

Query: 42  IEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGL----------TTIPDPAVQS 91
           + GD +G EI+    K+  A    I     DV+  F N L            +PD A+++
Sbjct: 10  LPGDHVGQEITAEAIKVLKA----ISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEA 65

Query: 92  ITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKT 139
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 140 TY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRP 197
            + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 198 RVIV-VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSV 256
             I  + K+ +   +      V + +  E+P L ++ +LID++ + +V NP+ + + + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPT 311
             N++GDI                    A++  K     ++E  HGSAPD+  ++K NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 312 ALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           A +LS+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV K +
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAKEV 359

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 93/352 (26%), Positives = 152/352 (43%), Gaps = 34/352 (9%)

Query: 44  GDGIGPEISKSVKKIFSA-------ANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNL 96
           GD +G EI++   K+  A       A    +      + I   G+  +PD A+++  K  
Sbjct: 10  GDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVP-LPDEALEASKKAD 68

Query: 97  VALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTTY-EN 143
             L G +  P  G G     + L L +RK   L+AN+RP          +   K  Y + 
Sbjct: 69  AVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLELSPLKAQYAQG 127

Query: 144 VDLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV- 201
            D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  I  
Sbjct: 128 TDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPIWS 187

Query: 202 VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLY 261
           + K+ +   +      V K + +E+P L++  +LID++ + +V NP+   + + +  N++
Sbjct: 188 LDKANVLASSRLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILVKNPTQL-NGIIITSNMF 246

Query: 262 GDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316
           GDI                        +      ++E  HGSAPD+A + K NP A +LS
Sbjct: 247 GDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA-KGKVNPVATILS 305

Query: 317 SVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           + MML   + +      I+ AV   +  G   RTGDL G+ +TS   +AV K
Sbjct: 306 AAMMLKLSLNMVEEGVAIEKAVKKVLDDG--IRTGDLGGSNSTSEVGDAVAK 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 138/307 (44%), Gaps = 26/307 (8%)

Query: 82  TTIPDPAVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK---- 132
           T +PD A+++  K    L G +  P  G G     + L L +RK  GL+AN+RP      
Sbjct: 54  TPLPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASD 112

Query: 133 ---SIEGFKTTY-ENVDLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYA 187
               +   K  Y +  D V++RE   G Y G  +     GV    +  +    +R+ R A
Sbjct: 113 SLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMA 172

Query: 188 FEYARAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTN 246
              A     P  I  + K+ +   +      V + +  E+P LT++ +LID++ + +V +
Sbjct: 173 AFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKS 232

Query: 247 PSAYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPD 301
           P+   + V +  N++GDI                        +      ++E  HGSAPD
Sbjct: 233 PTKL-NGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPD 291

Query: 302 IAGQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           +   +K NP A +LS+ MML   + L      ++ AV + + +G   RTGDL G+ +T+ 
Sbjct: 292 LPA-NKVNPIATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAG--VRTGDLGGSNSTTE 348

Query: 361 FTEAVIK 367
             +A+ K
Sbjct: 349 VGDAIAK 355

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 137/306 (44%), Gaps = 25/306 (8%)

Query: 84  IPDPAVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAKSIE--- 135
           +PD  +++  ++   L G +  P  G G     + L L +RK  GL+ N+RP K I    
Sbjct: 58  LPDETLEAAKQSDAVLLGAVGGPKWGTGKVRPEQGL-LKIRKELGLYGNLRPCKFISDKL 116

Query: 136 -GFKTTYENV----DLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYAFE 189
            G     E V    D V++RE   G Y G  +     GV    +  + +  +R+ + A  
Sbjct: 117 IGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGSGVAWDSEKYSIEEVKRITKMAAF 176

Query: 190 YARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSA 249
            +     P  I          +  L+     E   E+P+L ++ +LID++ + +V NP+ 
Sbjct: 177 LSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVKNPTQ 236

Query: 250 YTDAVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAG 304
             + + +  N++GDI                    A++  K     ++E  HGSAPD+A 
Sbjct: 237 L-NGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDLA- 294

Query: 305 QDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTE 363
           + K NP A +LS+ MML   + +    + I+ AV   +  G   RT DL G +TTS   +
Sbjct: 295 RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVLDRGI--RTADLGGNSTTSELGD 352

Query: 364 AVIKRL 369
           AV + L
Sbjct: 353 AVAQEL 358

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 121/268 (45%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SIEGFKTTY-ENVDLVLIRENTEGEYSG-IEHIVCP 166
           L +RK   L+AN+RP          +   K  + +  D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKE 225
           GV    +  T+   +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 226 YPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P L L  +LID++ + +V +P+   + + +  NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSPTQL-NGIVLTSNLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 281 XXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLS 339
              +      ++E  HGSAPD+  + K NP A++LS+ MML   + L+   + ++ AV  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIK 367
            + SG   RTGDL G+ +TS   +A+ K
Sbjct: 330 VLDSG--VRTGDLGGSNSTSEVGDAIAK 355

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 98/365 (26%), Positives = 164/365 (44%), Gaps = 35/365 (9%)

Query: 33  STGKYTVSFIEGDGIGPEISKSVKKIFSA-----ANVPIEWESCDVSPIFVNGLTTIP-- 85
           ST K  V  + GD +G EI++   K+  A      NV  ++E   +    ++  T +P  
Sbjct: 2   STTKKIV-VLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDA-TGVPLT 59

Query: 86  DPAVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------S 133
           D A+++  K    L G +  P  G G     + L L +RK   L+AN+RP          
Sbjct: 60  DEALEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLE 118

Query: 134 IEGFKTTY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYA 191
           +   K  +    D V++RE   G Y G  +     GV    +  T    +R+ R A   A
Sbjct: 119 LSPIKPQFARGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMA 178

Query: 192 RAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAY 250
                P  I  + K+ +   +      V + +  E+P L ++ +LID++ + +V NP+  
Sbjct: 179 LQHQPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTQL 238

Query: 251 TDAVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQ 305
            + + +  N++GDI                    A++  K     ++E  HGSAPD+  +
Sbjct: 239 -NGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-K 296

Query: 306 DKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEA 364
           +K NP A +LS+ MML   + +T     I++AV   + +G   RTGDL G+ +T    +A
Sbjct: 297 NKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAG--IRTGDLGGSNSTIEVGDA 354

Query: 365 VIKRL 369
           V K +
Sbjct: 355 VAKEV 359

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 158/359 (44%), Gaps = 35/359 (9%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSA--------ANVPIEWESCDVSPIFVNGLTTIPDPAV 89
           T+  + GD +G EI++   K+ +A         N   +      + I   G+  +PD A+
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVP-LPDEAL 64

Query: 90  QSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGF 137
           ++  K    L G +  P  G G     + L L +RK   L+AN+RP          +   
Sbjct: 65  EASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 138 K-TTYENVDLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIG 195
           K       D V++RE   G Y G  +     GV    +  +    +R+ R A   A    
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQHN 183

Query: 196 RPRVIV-VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAV 254
            P  I  + K+ +   +      V + +  E+P LT++ +LID++ + +V NP+ + + +
Sbjct: 184 PPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNPT-HLNGI 242

Query: 255 SVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKAN 309
            +  N++GDI                    A++  K     ++E  HGSAPD+  + K N
Sbjct: 243 IITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGKVN 301

Query: 310 PTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           P A +LS+ MML   + L    + I+ AV   + SG   RT DL GT +T+   +AV K
Sbjct: 302 PVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG--IRTADLKGTNSTTEVGDAVAK 358

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 89/351 (25%), Positives = 152/351 (43%), Gaps = 32/351 (9%)

Query: 44  GDGIGPEISKSVKKIFSA-----ANVPIEWESCDVSPIFVNGL-TTIPDPAVQSITKNLV 97
           GD +G EI+    K+  A     ++V  E++   +    ++     +PD ++++  K   
Sbjct: 12  GDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAAKKADA 71

Query: 98  ALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTTY-ENV 144
            L G +  P  G G     + L L +RK   L+AN+RP          +   K  +    
Sbjct: 72  VLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHARGT 130

Query: 145 DLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR-VIVV 202
           D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V  +
Sbjct: 131 DFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPVWSL 190

Query: 203 HKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYG 262
            K+ +   +      V + +  E+P LT++ +LID++ + +V NP+   + V +  N++G
Sbjct: 191 DKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPTQL-NGVIITNNMFG 249

Query: 263 DIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSS 317
           DI                        +      ++E  HGSAPD+  + K NP A +LS+
Sbjct: 250 DIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATILSA 308

Query: 318 VMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
            MML   + +      ++ AV   + SG   RTGDL G+ +T    +AV K
Sbjct: 309 AMMLELSLDMFEEGTAVEEAVRRVLDSG--IRTGDLRGSNSTQEVGDAVAK 357

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 92/361 (25%), Positives = 159/361 (44%), Gaps = 33/361 (9%)

Query: 34  TGKYTVSFIEGDGIGPEISKSVKKIFSA-----ANVPIEWESCDVSPIFVNGL-TTIPDP 87
           T K+ V  + GD +G EI++   K+ +A      NV  +++   +    ++     +PD 
Sbjct: 86  TTKHIV-VLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDE 144

Query: 88  AVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIE 135
           A+++  K    L G +  P  G G     + L L +RK   L+AN+RP          + 
Sbjct: 145 ALEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLS 203

Query: 136 GFK-TTYENVDLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYAFEYARA 193
             K    +  D+ ++RE   G Y G  +     GV    +  +    +R+ R A   A  
Sbjct: 204 PLKPEIVKGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQ 263

Query: 194 IGRPR-VIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTD 252
              P  V  + K+ +   +      V + +  E+P LT++ +LID++ + +V NP+ + +
Sbjct: 264 HNPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPT-HLN 322

Query: 253 AVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDK 307
            V +  N++GDI                        +      ++E  HGSAPD+  + K
Sbjct: 323 GVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGK 381

Query: 308 ANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVI 366
            NP A +LS  MML   + +T     ++ AV   + SG   RT DL G+ +TS   +A+ 
Sbjct: 382 VNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSGV--RTADLRGSNSTSEVGDAIA 439

Query: 367 K 367
           K
Sbjct: 440 K 440

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 158/366 (43%), Gaps = 40/366 (10%)

Query: 33  STGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGL----------T 82
           ST K  V  + GD +G EI++   K+  A     + ES  V   F   L           
Sbjct: 2   STTKKIV-VLPGDHVGGEITEEAIKVLKAIE---QVESSKVKFDFQYHLIGGAAIDAAGV 57

Query: 83  TIPDPAVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKS 133
            + D A+++  K    L G +  P  G G     + L L +RK  GL+AN+RP    ++ 
Sbjct: 58  PLTDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASEP 116

Query: 134 IEGFKTTYENV----DLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITRDASERVIRYAF 188
           + G       +    D +++RE   G Y G  +     GV    +  +    ER+ R A 
Sbjct: 117 LLGLSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGDGVAWDSEKYSVPEVERITRMAA 176

Query: 189 EYARAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNP 247
             A     P  I  + K+ +   +      V   +  E+P LT++ +LID++ + +V NP
Sbjct: 177 FLALQHNPPLPIWSLDKANVLASSRLWRKTVEATIKNEFPTLTVQNQLIDSAAMILVKNP 236

Query: 248 SAYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDI 302
           +   + + +  N++GDI                        +      ++E  HGSAPD+
Sbjct: 237 TQL-NGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDL 295

Query: 303 AGQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSF 361
             ++K NP A +LS+ MML   + +    + ++ AV   + +G   RTGDL G+ +T   
Sbjct: 296 P-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAG--VRTGDLGGSNSTQEV 352

Query: 362 TEAVIK 367
            +A+ K
Sbjct: 353 GDAIAK 358

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 120/268 (44%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SIEGFKTTY-ENVDLVLIRENTEGEYSG-IEHIVCP 166
           L +RK   L+AN+RP          +   K  Y +  D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKE 225
           GV    +  +    +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 226 YPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P LT++ +LID++ + +V +P+   + + +  N++GDI                     
Sbjct: 214 FPTLTVQHQLIDSAAMILVKSPTKL-NGIVITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 281 XXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLS 339
              +      ++E  HGSAPD+  ++K NP A +LS+ MML   + L    + ++ AV  
Sbjct: 273 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRR 331

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIK 367
            + +G   RT DL G  +TS   +AV+K
Sbjct: 332 VLDAG--IRTADLRGENSTSEVGDAVVK 357

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 92/363 (25%), Positives = 156/363 (42%), Gaps = 35/363 (9%)

Query: 33  STGKYTVSFIEGDGIGPEISKSVKKIF------SAANVPIEWESCDVSPIFVNGL-TTIP 85
           ST K  V  + GD +G EI     K+       S+  +  E++   +    ++   T +P
Sbjct: 2   STKKIVV--LPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLP 59

Query: 86  DPAVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEG 136
           D A+ +   +   L G +  P  G G     + L L +RK   L+AN+RP    + S+ G
Sbjct: 60  DEALDAAKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSDSLLG 118

Query: 137 FKTTYENV----DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYA 191
                E +    D  ++RE   G Y G  +     G     +  T    +R+ R A   A
Sbjct: 119 LSPLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLA 178

Query: 192 RAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAY 250
                P  I  + K+ +   +      V + +  E+P+L ++ +LID++ + +V +P   
Sbjct: 179 LQHDPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPNLKVQHQLIDSAAMILVKSPRQL 238

Query: 251 TDAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQ 305
            + + +  N++GDI                        +      ++E  HGSAPD+  +
Sbjct: 239 -NGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-K 296

Query: 306 DKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEA 364
            K NP A +LS+ MML   + L +    I+ AV   + +G   RT DL G+ +TS   +A
Sbjct: 297 GKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG--IRTADLKGSNSTSEVGDA 354

Query: 365 VIK 367
           V K
Sbjct: 355 VAK 357

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 85/353 (24%), Positives = 144/353 (40%), Gaps = 35/353 (9%)

Query: 44  GDGIGPEISKSVKKIFSA--------ANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKN 95
           GD +G E+++   KI  A             E+     + I   G   +PD ++++  + 
Sbjct: 12  GDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATG-NPLPDESLEASKRA 70

Query: 96  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTTY-E 142
              L G +  P  G G     + L L +RK   L+AN+RP          +   K  Y +
Sbjct: 71  DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKEKYAK 129

Query: 143 NVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV 201
             D  ++RE   G Y G  +     GV    +  +    +R+ R A   A     P  I 
Sbjct: 130 GTDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMAAFLAMQHNPPLPIW 189

Query: 202 -VHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNL 260
            + K+ +   +      V + +  E+P L +  +LID++ + +V NP+   + + +  N+
Sbjct: 190 SLDKANVLASSRLWRKTVEETIQNEFPSLKVSHQLIDSAAMILVKNPTQL-NGIIITNNM 248

Query: 261 YGDIXXXXXX-----XXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLL 315
           +GDI                        +      ++E  HGSAPD+  + K NP   +L
Sbjct: 249 FGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPDLP-KGKVNPIGTIL 307

Query: 316 SSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           S  MML   + L      ++ AV   + +    RT DL G+ +TS   +AV K
Sbjct: 308 SVAMMLKLSLNLKEEGIAVEEAVRRVLDNNI--RTADLGGSNSTSDIGDAVAK 358

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 319 MMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           +MLNH+GL   A +I  AV  TIA G ++ T D+ G+++T+ FT  +I +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 50

>ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR089W
          Length = 832

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%)

Query: 312 ALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           AL L    ML   G  +    ++N  +S +AS   N  G+L   ATT S T AV  R+
Sbjct: 121 ALELFMAWMLQRFGRHHFKVPVENLAMSIVASSLVNDRGELLSYATTCSVTYAVTTRI 178

>TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {ON}
           Anc_5.559 YDR443C
          Length = 1334

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 56/135 (41%), Gaps = 25/135 (18%)

Query: 77  FVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTL-RKTFGLFANVRPAKSIE 135
            ++ L+TI +P++                 + K H  +N++   + F  F NV+PAK I+
Sbjct: 869 LISSLSTIKEPSIY----------------VKKHHSMMNMSADSQVFSKFLNVKPAKGIK 912

Query: 136 GFK----TTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA 191
            F+    TT    D +         Y G E     G  + +KL + D+   +    F+ +
Sbjct: 913 NFRFLMLTTSYAEDCLSFVSTLCQTYIGYEF----GFCELLKLTSDDSQGLMQLPDFDKS 968

Query: 192 RAIGRPRVIVVHKST 206
           R +     IV + ST
Sbjct: 969 RLLLLAAQIVTYCST 983

>KLLA0F08459g Chr6 complement(787966..790479) [2514 bp, 837 aa] {ON}
           similar to uniprot|P12945 Saccharomyces cerevisiae
           YDL040C NAT1 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 837

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 5/63 (7%)

Query: 53  KSVKKIFSAANVPIEWESCDVSPIFVNGLT----TIPDPAVQSITKNLVALKGPLATPIG 108
           K+ KK     +  ++  S  V  I + GL     + P+ A   I K L  +KG L +PIG
Sbjct: 35  KNYKKSLKILDTILKKNSSHVDSIILKGLNLQFCSTPEEAASYIDKALSKIKGTLVSPIG 94

Query: 109 KGH 111
            GH
Sbjct: 95  -GH 96

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,520,709
Number of extensions: 1232755
Number of successful extensions: 3732
Number of sequences better than 10.0: 87
Number of HSP's gapped: 3533
Number of HSP's successfully gapped: 87
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)