Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR124C (UBP2)5.443ON1272127265810.0
Smik_15.3015.443ON1272127357140.0
Skud_15.2865.443ON1278127856500.0
Suva_8.1765.443ON1270127355200.0
NCAS0H021005.443ON1269124436010.0
ZYRO0G01606g5.443ON1305125935870.0
TDEL0D025805.443ON1272122935270.0
NDAI0C015505.443ON1295124734420.0
Kpol_1062.235.443ON1266123634010.0
KAFR0D050705.443ON1227125833740.0
KNAG0B041905.443ON1262123233730.0
SAKL0G02728g5.443ON1237123833380.0
TBLA0A064705.443ON1320127732390.0
KLTH0F15862g5.443ON1241121931800.0
Kwal_55.213935.443ON1233122931430.0
CAGL0K10252g5.443ON1267124831310.0
TPHA0E017105.443ON1283123331250.0
Ecym_45145.443ON1246125629300.0
KLLA0E02377g5.443ON1220122627780.0
ACL164C5.443ON138986118440.0
Kpol_1016.15.443ON1251124318060.0
TPHA0J026205.443ON1225125415630.0
KLLA0A10791g1.369ON4841091202e-05
KLTH0H13354g1.369ON495391192e-05
TBLA0C012001.369ON503361193e-05
SAKL0D10120g1.369ON492401183e-05
Ecym_27171.369ON483331183e-05
Kwal_34.162681.369ON449971148e-05
ZYRO0G01188g1.369ON500331131e-04
KAFR0C045201.369ON4991021131e-04
TDEL0D024001.369ON494331112e-04
AEL029W1.369ON446331093e-04
YER098W (UBP9)7.390ON7541731077e-04
Kpol_534.231.369ON496981030.002
Kpol_2001.541.137ON1223391030.003
TDEL0C056401.137ON1178391020.003
CAGL0K10494g1.369ON495961010.004
KNAG0C019401.369ON499421000.004
NCAS0D006001.369ON49396990.005
TDEL0B036708.742ON463112990.005
Skud_6.941.369ON49941990.006
YJL197W (UBP12)1.137ON125439990.006
Smik_10.371.137ON124739990.007
TPHA0A025101.369ON50534980.008
Smik_7.3141.369ON49933970.009
Suva_6.2761.137ON125658980.010
Skud_10.221.137ON125539980.010
ZYRO0C17908g1.137ON120456980.010
Smik_2.497.390ON74537970.010
Suva_6.831.369ON50096960.011
YFR010W (UBP6)1.369ON49933950.015
KNAG0J008003.270ON765127960.017
TPHA0A025401.137ON128628950.023
Kwal_33.136281.137ON116067940.025
Ecym_81401.137ON126447940.026
NDAI0H035501.369ON50234930.028
NDAI0B034302.307ON85639930.033
TBLA0E017605.712ON121242930.034
Ecym_46857.390ON77831930.035
SAKL0E07106g2.307ON79139930.036
KLTH0F03674g1.137ON119839930.041
Kwal_27.108427.390ON71131920.044
CAGL0H06721g5.712ON108153920.047
Kwal_26.95985.18ON119190920.050
NCAS0B005808.742ON466166900.059
Skud_5.2237.390ON748170910.061
TDEL0G004105.18ON118644910.065
TDEL0B020805.712ON102545900.069
CAGL0H10582g2.307ON79039900.070
YBL067C (UBP13)7.390ON74733900.072
KNAG0A054502.307ON76440900.073
Kwal_27.114442.307ON75739900.073
NCAS0B061302.307ON77039900.073
AGR389C2.307ON77538900.079
ZYRO0D07062g5.18ON119341900.083
Smik_4.1152.307ON79039890.087
KLTH0G10934g2.307ON75839890.087
YDL122W (UBP1)2.307ON80939890.096
AGR370W7.390ON74036890.10
KAFR0I026005.18ON121338890.10
Suva_4.1252.307ON79339890.10
KAFR0A069102.307ON67839890.11
Skud_4.1332.307ON78739890.11
KNAG0C035807.390ON77641880.12
CAGL0M13783g5.18ON119638880.13
TPHA0P006807.390ON72792880.13
NCAS0A143707.390ON72931880.13
Kpol_1003.532.307ON78840880.13
Suva_2.507.390ON75057880.14
Smik_13.5215.18ON1231123880.14
KAFR0F015601.137ON117129880.15
KLLA0A00396g5.712ON101230870.16
KNAG0B023707.390ON75331870.17
ZYRO0A02420g2.307ON74539870.17
KAFR0L017307.390ON701181870.17
TPHA0E008707.390ON71531870.18
KNAG0E012905.18ON119631870.19
KNAG0G029308.742ON459170860.20
TBLA0C070205.18ON124744870.20
SAKL0C04246g1.137ON129739860.21
Suva_5.2177.390ON754174860.22
Ecym_40095.712ON151730860.23
NCAS0I031401.137ON120139860.24
KAFR0D021605.712ON84648860.26
Kwal_55.196455.712ON97026860.26
Smik_5.2447.390ON74931850.26
Kpol_513.255.18ON119041860.26
NCAS0D023905.18ON121138860.27
TBLA0D006207.390ON117175850.27
KAFR0A042108.742ON440129850.27
TPHA0G008502.307ON78239850.28
NDAI0B004801.137ON125369850.28
KAFR0C004103.270ON76963850.28
TPHA0L022905.18ON119341850.29
TBLA0B060802.307ON82439850.30
KLTH0B09944g5.18ON1189121850.30
Suva_13.4955.18ON1230123850.31
SAKL0F12430g7.390ON75431850.31
TDEL0G023702.307ON74739850.32
TPHA0D046605.712ON104526850.33
NCAS0G001705.712ON103026840.37
KNAG0L022005.712ON116126840.41
Klac_YGOB_Anc_5.18b5.18ON1166124840.41
YMR304W (UBP15)5.18ON1230115840.42
Skud_13.4785.18ON123131840.42
Skud_2.387.390ON74831830.46
KLTH0C06732g7.390ON71431830.46
KLLA0C03476g1.137ON125236840.47
CAGL0G02563gsingletonON63129830.49
AFR627C1.137ON128737830.52
YIL156W (UBP7)5.712ON107126830.53
NDAI0F002005.712ON110526830.55
Smik_9.135.712ON106026830.59
KLLA0E20351g7.390ON69731820.60
TBLA0J006001.137ON146247820.63
NCAS0E026107.390ON71731820.66
SAKL0D03322g3.270ON76557820.66
Suva_9.305.712ON106226820.67
Kpol_397.98.361ON49174810.70
AFR296C5.712ON116930820.74
TBLA0D010708.742ON48339810.77
NDAI0A016707.390ON84631810.78
CAGL0L01639g1.137ON114730810.80
KLTH0E00814g5.712ON97430810.81
Skud_9.125.712ON106426810.82
SAKL0H00418g5.18ON119031810.93
KNAG0C021801.137ON123129801.1
NDAI0I025305.18ON119729801.1
SAKL0E15136g5.712ON103726801.1
NDAI0F034102.69ON87066801.2
Kpol_1045.417.390ON71236791.3
Kpol_1064.488.742ON466124791.4
CAGL0A04477g7.390ON77031791.4
Kpol_1018.937.390ON75531791.5
AGL357W5.18ON116631791.7
ZYRO0B03300g7.390ON81331781.8
Ecym_56715.18ON117629791.8
TDEL0C015707.390ON76531781.9
KLLA0E08801g2.307ON77139782.1
CAGL0I05522g7.390ON72431782.1
NDAI0E008108.742ON49340772.1
Skud_11.3385.712ON71226772.2
ZYRO0B16544g5.712ON104426782.3
NCAS0C021108.540ON494108772.4
KAFR0H001505.712ON65667772.4
KLTH0C07326g3.270ON76230772.6
CAGL0I06765g8.188ON88754763.0
Skud_2.1773.270ON78224763.6
TBLA0F011503.115ON112284763.8
Suva_4.2953.270ON782130753.9
KAFR0J029003.570ON381130753.9
KAFR0K018107.390ON71433754.5
ZYRO0F01276g3.270ON77663754.8
KLTH0G11330g8.361ON50173745.0
ZYRO0A05962g8.742ON46547745.3
Suva_11.3355.712ON72440746.3
NCAS0G036802.307ON48239736.4
Smik_6.1294.189ON296119727.2
YKR098C (UBP11)5.712ON71737737.8
TBLA0E025703.270ON78525738.5
CAGL0M11198g8.742ON461130728.9
Suva_13.4078.742ON47165729.1
CAGL0G05247g8.188ON94750729.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR124C
         (1272 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  2539   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  2205   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  2180   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  2130   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1391   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1386   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1363   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1330   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1314   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1304   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1303   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1290   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1252   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1229   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1215   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1210   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1208   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1133   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1074   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   714   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   700   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   606   0.0  
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    51   2e-05
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    50   2e-05
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    50   3e-05
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    50   3e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    50   3e-05
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    49   8e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    48   1e-04
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    48   1e-04
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    47   2e-04
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    47   3e-04
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    46   7e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    44   0.002
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    44   0.003
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    44   0.003
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    44   0.004
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    43   0.004
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    43   0.005
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    43   0.005
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    43   0.006
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    43   0.006
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    43   0.007
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    42   0.008
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    42   0.009
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    42   0.010
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    42   0.010
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    42   0.010
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    42   0.010
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    42   0.011
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    41   0.015
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    42   0.017
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    41   0.023
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    41   0.025
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    41   0.026
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.028
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     40   0.033
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    40   0.034
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    40   0.035
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    40   0.036
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    40   0.041
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    40   0.044
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    40   0.047
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    40   0.050
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       39   0.059
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    40   0.061
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    40   0.065
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    39   0.069
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    39   0.070
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    39   0.072
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    39   0.073
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    39   0.073
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    39   0.073
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    39   0.079
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    39   0.083
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    39   0.087
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    39   0.087
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    39   0.096
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    39   0.10 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    39   0.10 
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    39   0.10 
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    39   0.11 
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    39   0.11 
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    39   0.12 
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    39   0.13 
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    39   0.13 
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    39   0.13 
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    39   0.13 
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    39   0.14 
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    39   0.14 
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    39   0.15 
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    38   0.16 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.17 
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    38   0.17 
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    38   0.17 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    38   0.18 
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    38   0.19 
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    38   0.20 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    38   0.20 
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    38   0.21 
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    38   0.22 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    38   0.23 
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    38   0.24 
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    38   0.26 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    38   0.26 
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    37   0.26 
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    38   0.26 
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    38   0.27 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    37   0.27 
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    37   0.27 
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    37   0.28 
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    37   0.28 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    37   0.28 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    37   0.29 
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    37   0.30 
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    37   0.30 
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    37   0.31 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    37   0.31 
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    37   0.32 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    37   0.33 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      37   0.37 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    37   0.41 
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    37   0.41 
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    37   0.42 
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    37   0.42 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    37   0.46 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    37   0.46 
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    37   0.47 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    37   0.49 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    37   0.52 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    37   0.53 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      37   0.55 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    37   0.59 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    36   0.60 
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    36   0.63 
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    36   0.66 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    36   0.66 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    36   0.67 
Kpol_397.9 s397 complement(27399..28373,28377..28877) [1476 bp, ...    36   0.70 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    36   0.74 
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    36   0.77 
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    36   0.78 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    36   0.80 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    36   0.81 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    36   0.82 
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    36   0.93 
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    35   1.1  
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    35   1.1  
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    35   1.1  
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    35   1.2  
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    35   1.3  
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    35   1.4  
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    35   1.4  
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    35   1.5  
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    35   1.7  
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    35   1.8  
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    35   1.8  
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    35   1.9  
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    35   2.1  
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    35   2.1  
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    34   2.1  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    34   2.2  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    35   2.3  
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    34   2.4  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    34   2.4  
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    34   2.6  
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    34   3.0  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    34   3.6  
TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3....    34   3.8  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    33   3.9  
KAFR0J02900 Chr10 (552553..553698) [1146 bp, 381 aa] {ON} Anc_3....    33   3.9  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    33   4.5  
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    33   4.8  
KLTH0G11330g Chr7 complement(956495..958000) [1506 bp, 501 aa] {...    33   5.0  
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    33   5.3  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    33   6.3  
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    33   6.4  
Smik_6.129 Chr6 complement(208819..209709) [891 bp, 296 aa] {ON}...    32   7.2  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    33   7.8  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    33   8.5  
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    32   8.9  
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    32   9.1  
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    32   9.4  

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 2539 bits (6581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1239/1272 (97%), Positives = 1239/1272 (97%)

Query: 1    MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL 60
            MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL
Sbjct: 1    MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL 60

Query: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120
            YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR
Sbjct: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120

Query: 121  PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH 180
            PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH
Sbjct: 121  PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH 180

Query: 181  LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK 240
            LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK
Sbjct: 181  LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK 240

Query: 241  LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG 300
            LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG
Sbjct: 241  LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG 300

Query: 301  PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD 360
            PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD
Sbjct: 301  PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD 360

Query: 361  YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF 420
            YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF
Sbjct: 361  YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF 420

Query: 421  HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY 480
            HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY
Sbjct: 421  HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY 480

Query: 481  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK 540
            FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK 540

Query: 541  YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600
            YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
Sbjct: 541  YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600

Query: 601  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ 660
            DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ
Sbjct: 601  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ 660

Query: 661  EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL 720
            EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL
Sbjct: 661  EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780

Query: 781  XXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV 840
                                 QFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNE 900
            EFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNE
Sbjct: 841  EFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNE 900

Query: 901  SNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIR 960
            SNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIR
Sbjct: 901  SNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIR 960

Query: 961  YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSY 1020
            YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSY
Sbjct: 961  YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSY 1020

Query: 1021 FKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDR 1080
            FKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDR
Sbjct: 1021 FKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDR 1080

Query: 1081 YADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIK 1140
            YADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIK
Sbjct: 1081 YADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIK 1140

Query: 1141 KTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFI 1200
            KTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFI
Sbjct: 1141 KTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFI 1200

Query: 1201 HRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQ 1260
            HRGEASYGHYWIYIKDRNRNGIWRKYNDETIS            GNTATPYFLVYVKQGQ
Sbjct: 1201 HRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQ 1260

Query: 1261 EGDIEPLKRILK 1272
            EGDIEPLKRILK
Sbjct: 1261 EGDIEPLKRILK 1272

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 2205 bits (5714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1072/1273 (84%), Positives = 1143/1273 (89%), Gaps = 2/1273 (0%)

Query: 1    MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL 60
            M NED ELQ AIE+H ++  NQDK N+  NG+VIE+ PLY TS + QS P D DDGKHLL
Sbjct: 1    MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL 60

Query: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120
            YPDIAT+LPLKTSDRLLDDILCDTIFLNSTDP V++KGLQ+ GIL+ESMLSYS+FRSSIR
Sbjct: 61   YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR 120

Query: 121  PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH 180
            PN LGS+TDQVV QTK EYDS SCPKYNKIHVFQAVI NPSL EQ +S+FDDIVKIPIYH
Sbjct: 121  PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH 180

Query: 181  LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK 240
            LKV+VK+RQELERLKKHVGVTQFHS+D LHEYDRVD STFDSSDPNL+DYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK 240

Query: 241  LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG 300
            LILIEIFKPEF+SPEEHESFT +AIK+RY+ MC+ NESLDK+ TPSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG 300

Query: 301  PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD 360
            PLTRKSK EP KTIDSGNLALNTHLNPEWLTSKYGFQ SSEIDEETNE FTEY+PPDMVD
Sbjct: 301  PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD 360

Query: 361  YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF 420
            YV+DL+ RKIRESFVRKCLQL+FWGQLSTSLLAPNSPLKNTKSVKG+S LQTSFS+LPWF
Sbjct: 361  YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF 420

Query: 421  HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY 480
            HLLGESR+RILLNSNE +HSPLDAEPHF+NLSVSHYYTDRDIIRNYESLSSLDP+NIGLY
Sbjct: 421  HLLGESRSRILLNSNE-SHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLY 479

Query: 481  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK 540
            FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALL+FKI PKECNI+ELNEATLLSIYK
Sbjct: 480  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYK 539

Query: 541  YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600
            +ETSNKSQVTS HLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
Sbjct: 540  FETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 599

Query: 601  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ 660
            DIIKTAYSVKINDSPGLKLDCDRALYTIAISK+SLDLFNFLT+ECPQF  YYG E+LDYQ
Sbjct: 600  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQ 659

Query: 661  EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL 720
            EALKLLQVNENASDETILKIFKQKWFDE+VYEPDQFL L+AALTKISIERNS LI+NFLL
Sbjct: 660  EALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLL 719

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY+L+YQKTVENFNDHLSN
Sbjct: 720  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSN 779

Query: 781  XXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV 840
                                 QFIYQLRNLFYAMVH+RERCVTPSKELAYLAFAPSN+EV
Sbjct: 780  SGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEV 839

Query: 841  EFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTD-ANRKKN 899
            EFEVEGNK  D   +    K+E T ++ TTK  D   I  +MED  N D   + +N +KN
Sbjct: 840  EFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKN 899

Query: 900  ESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959
            E N+ ++   +DTT L S TRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI
Sbjct: 900  EPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959

Query: 960  RYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019
            +YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS
Sbjct: 960  KYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019

Query: 1020 YFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMD 1079
            YFKDEYLTMEEYGDV RTVAVTTFPTILQVQIQRVYYDRER MPFKSIEPLPFKEVIYMD
Sbjct: 1020 YFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1079

Query: 1080 RYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTI 1139
            RYADTENPLLLAKK ETEEMKQKL+VMKNRQRELLSRD+SGLTRKDAFLESIKLLES  +
Sbjct: 1080 RYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVV 1139

Query: 1140 KKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVF 1199
            +KT LK E   DVI TLR NV NIDNELM LYN+IN+LEEKISHQFDDFKEYGYSLFSVF
Sbjct: 1140 EKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVF 1199

Query: 1200 IHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQG 1259
            IHRGEASYGHYWIYIKDRN NG+WRKYNDET+S            GNTATPYFLVYVKQG
Sbjct: 1200 IHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQG 1259

Query: 1260 QEGDIEPLKRILK 1272
            QE DIEPLKRIL+
Sbjct: 1260 QEADIEPLKRILQ 1272

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 2180 bits (5650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1064/1278 (83%), Positives = 1137/1278 (88%), Gaps = 6/1278 (0%)

Query: 1    MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL 60
            MP EDNELQ AIE H +QL NQ+K N   + + I+D PLYGT  + QS P  VDDGKHLL
Sbjct: 1    MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL 60

Query: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120
            YPDIAT+LPLKTSDRLLDD+LCDTIFLNSTDP V++KGLQ+ GIL+ESMLSYS+FRSSIR
Sbjct: 61   YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR 120

Query: 121  PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH 180
            PN LGSLTDQV  QTK+EYDSISCP+YNKI+VFQAVI NPSL+EQQIS+FDDIV+IPIYH
Sbjct: 121  PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH 180

Query: 181  LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK 240
            LKV+VK+RQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDP L+DYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK 240

Query: 241  LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG 300
            LILIEIF+PEFNSPEEHESFT DAIKKRYN +C+KNESL+K E PSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG 300

Query: 301  PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD 360
            PLTRKSK EP KTIDSGNL LNTHLN EWLTSKYGFQASSEIDEETN+ FTEYVPPDMV 
Sbjct: 301  PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG 360

Query: 361  YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF 420
            YV D   RKIRESFV+KCLQLIFWGQLS SLL PNS LKNTKSVKG+SSLQTSFST PWF
Sbjct: 361  YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF 420

Query: 421  HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY 480
            HLLGESRARILLNSNEQ HSPLDAE HFINLSVSHYYTDRDIIRNYE+LSSLDP+NIGLY
Sbjct: 421  HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY 480

Query: 481  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK 540
            FDALTYIANRKGAYQLIAYCGKQ+IIGQEALENAL+ FKI+PKE NI+ELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK 540

Query: 541  YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600
            +ETSNKS+VTSNHLTN KNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
Sbjct: 541  FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600

Query: 601  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ 660
            DIIKTAYS+KINDSPGLKLDCDRALYTIAISKRSLDLFNFLT+ECPQF  YYGPEKL YQ
Sbjct: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ 660

Query: 661  EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL 720
            EALKLLQVNENASDET+LKIFKQKW+DE+V+EPDQFLILRAALT+ISIERNS LITNFLL
Sbjct: 661  EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY+LEYQKT++NFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780

Query: 781  XXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV 840
                                 QFIYQLRNLFYAMVH+RERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKVVDQTGVLS-DSKKETTDDAFTT-KIKDTSLIDLEMEDGLNGDVGTDANRKK 898
            EFEVEGNKV      +S DSK E T +A TT + KD SLIDLEMED  N DV  D    K
Sbjct: 841  EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIENVK 900

Query: 899  ----NESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIES 954
                NE+ND E++  E+ T L SPTRVAKI SDQLENALEMGRQQDVTECIGNVLFQIES
Sbjct: 901  ANEANEANDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES 960

Query: 955  GSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIY 1014
            GSEPIRYDEDNEQYDL+KQLFYGTTKQSIVPLSAT+KVRTKVERFLSLL+NIGDHPKDIY
Sbjct: 961  GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1020

Query: 1015 DAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKE 1074
            DAFDSYFKDEYLTMEEYGDV RTVAVTTFPTILQVQIQRVYYDRER MPFKSIEPLPFKE
Sbjct: 1021 DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1080

Query: 1075 VIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLL 1134
            VIYMDRY+DTENPLLLAKK+ETE+MKQ LKVMKNRQRELL RD+SGLTRKDAFLESIKLL
Sbjct: 1081 VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL 1140

Query: 1135 ESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYS 1194
            ES+ +       E   DVI+ L++N+ +IDNELM LYNDINSLE+KISHQFDDF+EYGYS
Sbjct: 1141 ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200

Query: 1195 LFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLV 1254
            LFSVFIHRGEASYGHYWIYIKDRN  G+WRKYNDETIS            GNTATPYFLV
Sbjct: 1201 LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNEGNTATPYFLV 1260

Query: 1255 YVKQGQEGDIEPLKRILK 1272
            YVKQGQE DIEPLKRIL+
Sbjct: 1261 YVKQGQESDIEPLKRILE 1278

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 2130 bits (5520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1040/1273 (81%), Positives = 1121/1273 (88%), Gaps = 4/1273 (0%)

Query: 1    MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL 60
            MPNEDNELQ AIE   N L N +K +   N + I+D PLY  S +QQST  DVDDGKHLL
Sbjct: 1    MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL 60

Query: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120
            YPDIAT LPLKTSDRLLDDILCDT F NSTDP V+++GLQ+ GILK+SMLSYS FRS IR
Sbjct: 61   YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR 120

Query: 121  PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH 180
            P+ LGSLTDQVV QTK+EYDSISCP+YNKI V QAVIFNPSL EQQI+ FDDIVKIPIYH
Sbjct: 121  PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH 180

Query: 181  LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK 240
            LKV+VK+RQELERLKKHVGVTQFH+LDHLHEYD  DLSTFDSSDPNL DYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK 240

Query: 241  LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG 300
            LILIEIF PEF+SPEE +SFT  AI+KRYN +C+KNESL+++ETPSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG 300

Query: 301  PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD 360
            PL RKS A+P KTIDSGN+ LNTHLNPEWLTSKYGFQASSEIDEETNE FTEYVPPDMVD
Sbjct: 301  PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD 360

Query: 361  YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF 420
            YV D + RKIRES+VRKCLQLIFWGQLS SLLAPNS LKNTKSVKG+SS+QTSFS LPWF
Sbjct: 361  YVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGLSSIQTSFSILPWF 420

Query: 421  HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY 480
             LLGESRARILLN NEQ HSPLDAEPHFINLSVSHYYTDRDIIRNYE+LSSLDPENIGLY
Sbjct: 421  QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480

Query: 481  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK 540
            FDALTYIANRKGAYQ+IAYCGKQDIIGQEALENAL++FKI+PK+ +I+ELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK 540

Query: 541  YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600
            +ETSNK++  SNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL+IDESVDE
Sbjct: 541  FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE 600

Query: 601  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ 660
            DIIKTAYS+KINDSPGLKLDCDRALYTIAISKRSLDLFNFLT+ECPQF NYYGPEKLDYQ
Sbjct: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ 660

Query: 661  EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL 720
            EALKLLQVNENASDETILKIFK KWFDENVYEPDQFLIL+AALTKISIERNS LITNFLL
Sbjct: 661  EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR Y+L YQKT+ NFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN 780

Query: 781  XXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV 840
                                 QFI+QLRNLFYAMVH+RERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDA-NRKKN 899
            EFEVEGNK  +   +L   K+E T  A     +D  LID E+++  NGDV  D  N +K 
Sbjct: 841  EFEVEGNKESNDATIL---KEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKT 897

Query: 900  ESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959
            ESND E+   +D T L SPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI
Sbjct: 898  ESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 957

Query: 960  RYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019
            RYDEDNEQYDL+KQLFYGTTKQ IVPLSAT+KVRTKVERFLSLL+NIGDHPKDIYDAFDS
Sbjct: 958  RYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDS 1017

Query: 1020 YFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMD 1079
            YF+DEYLTM EYGDV RTVAVTTFPTILQVQIQRVYYDRER MPFKSIEPLPFKEVIYMD
Sbjct: 1018 YFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1077

Query: 1080 RYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTI 1139
            RYADT+N  LLAKK+ETE++KQK K MKNRQRELL+RD SGLTRKDAFLE+IKLLES  +
Sbjct: 1078 RYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIV 1137

Query: 1140 KKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVF 1199
            + T L IE   ++IKTL+N V +IDNELM LY+DINSLE+KISHQFDDFKEYGYSLFSVF
Sbjct: 1138 ENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVF 1197

Query: 1200 IHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQG 1259
            IHRGEASYGHYWIYIKDRN+NG+WRKYNDETIS            GNTATPYFLVYVKQG
Sbjct: 1198 IHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYFLVYVKQG 1257

Query: 1260 QEGDIEPLKRILK 1272
            QE DIEPLKRIL+
Sbjct: 1258 QEADIEPLKRILE 1270

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1391 bits (3601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1244 (55%), Positives = 903/1244 (72%), Gaps = 37/1244 (2%)

Query: 53   VDDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKG----LQSRGILKES 108
             DDGK LLYP++  + P+KT++RL+DDI+ D  FL         +G    +   GILK+S
Sbjct: 35   ADDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDIDTMLGNGILKQS 94

Query: 109  MLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQIS 168
            ML+YS  ++      +GSL DQV  QTK EY S++CP+ NK+ VF  V+FN S    QI+
Sbjct: 95   MLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFNNS---TQIT 151

Query: 169  TFDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLL 228
              D++ + PIYHLKV+VK R  LE  KKH GVTQFH +D LH YD+ D+ TF+  DPNLL
Sbjct: 152  NLDEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDIPTFNPEDPNLL 211

Query: 229  DYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQV 288
            DY IYVS+DTNKLILIE+FKPEF S +E ESF ++ I +RY   C + ++L+ +E P+Q+
Sbjct: 212  DYAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEPPTQL 271

Query: 289  DCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNE 348
            DC  TLFK+FKGPL+RKS  EP+KTIDS N  LN+H+NPEWLTSKYGF    + D    +
Sbjct: 272  DCLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNIVVDEDLPNAQ 331

Query: 349  IFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMS 408
               EY PP++V+YV D E R++RE+++R+CLQLIFWG+LS +L   +  LKN+KS K ++
Sbjct: 332  QSVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKSYKSIN 391

Query: 409  SLQTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYES 468
            +LQT+F+  P   L   S    L+    ++ SPLD   HFINLS  ++YTDRD+IRNYE 
Sbjct: 392  ALQTNFTITPLLQLFKGSGQNFLMGP--ESRSPLDFNFHFINLSACYHYTDRDVIRNYER 449

Query: 469  LSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNIS 528
            L  LDP+N+G+YFDAL YIAN KG+YQLIAYCGKQDI+GQEAL+ AL  F ++P E +I+
Sbjct: 450  LCHLDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEVDIT 509

Query: 529  ELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQA 588
            ++N++ LL++YK    N+ +++++ + NLKNA+RL AK   S KLKFY+DHEPYR ++QA
Sbjct: 510  KINDSVLLTLYK----NELKISTSDIPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQA 565

Query: 589  YDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQF 648
            Y+TL IDESVD+DI++TAY +K+ DSPGL +DCDRALYTIAI KRSL LF FL E CP F
Sbjct: 566  YETLDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDF 625

Query: 649  SNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISI 708
              YY P++  Y +AL + QVNENA+DE I+K F+ +WF+E+V+EP+ F+I   AL +I +
Sbjct: 626  QEYYCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGL 685

Query: 709  ERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQ 768
            +RNS+LI+NFL TG IDPN LP ++WP GINNIGNTCYLNSLLQYYFSIAPLR YVL+Y 
Sbjct: 686  QRNSSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYS 745

Query: 769  KTVENFNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKEL 828
            KT+E+F    +N                     QFIYQLR+LF+AMV++ ERCVTP +EL
Sbjct: 746  KTIEDFKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRREL 805

Query: 829  AYLAFAPSNVEVEFEVEGNKVVDQT----------GVLSDSKKETTDDAFTTKIKDTSLI 878
            AYLAFAPSN+EVEFE   N+   Q           G   D K+ + D    +   + +  
Sbjct: 806  AYLAFAPSNIEVEFETNENQPATQQDNPEVTTAELGQDKDEKERSVDSGDISMSDNITPK 865

Query: 879  DLEMEDGLNGDVGTDANRKKNES-------NDAEVSENEDT--TGLTSPTRVAKISSDQL 929
            D E E+    D   ++N+ ++ S        D  +++N DT  +   + T+VAKISSDQL
Sbjct: 866  DAEEEE----DQVAESNKNQDVSAIVSSPTKDIIMTDNTDTVVSNEGTSTKVAKISSDQL 921

Query: 930  ENALEMGRQQDVTECIGNVLFQIESGSEPIRYDE-DNEQYDLVKQLFYGTTKQSIVPLSA 988
            ENALEMGRQQDVTECIGNVLFQ+ESGSEP+   E DNEQ DLVKQLFYG  +Q+IVPL+ 
Sbjct: 922  ENALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLFYGELEQTIVPLAN 981

Query: 989  TNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQ 1048
             ++ R K+ERFLSLL+NIGDHP+DIYDA D YFKDEYL MEEYGDV RTVAVT FPTILQ
Sbjct: 982  PDQRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDVKRTVAVTKFPTILQ 1041

Query: 1049 VQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKN 1108
            +QIQRVYYDRE+ MPFKSIEPLPF+E IYMDRY+ T+NP L+A+K ET  MK+KL  +K 
Sbjct: 1042 IQIQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNETLLMKEKLVELKK 1101

Query: 1109 RQRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELM 1168
            +QR+LLSR+  GL++KD+++E  KLL SD+++   + +   ++++ +L+     ID+EL 
Sbjct: 1102 KQRDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVSSLKTLTAGIDDELN 1161

Query: 1169 KLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYND 1228
            +LY +I+ LEE I+ QF++FK  GYS+F+VFIHRGEASYGHYWIYIKDR++NGIWRKYND
Sbjct: 1162 QLYAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYND 1221

Query: 1229 ETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKRILK 1272
            ET+S            GNTATPYFLVYVK+G+E +IEPLKRI++
Sbjct: 1222 ETVSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRIIE 1265

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1386 bits (3587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/1259 (55%), Positives = 893/1259 (70%), Gaps = 54/1259 (4%)

Query: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113
            D GK  LYP+ A   P KT+DRLLDDIL D  F+NS D  ++   L S GILK  +LSYS
Sbjct: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDL-SNGILKSPVLSYS 116

Query: 114  TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDI 173
                  R   LGSL DQVV QTK EYDS+SCP++N + VF  V+ +  + +Q ++TF+++
Sbjct: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID--VTQQNVATFNNL 174

Query: 174  VKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPNLLDYG 231
              +PI+HLKV+VK R  LER KK  G+T +HSLD   +H YD+ DL TFDS DP LLDY 
Sbjct: 175  ATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYA 234

Query: 232  IYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCF 291
            IYVS D+NKLILIEIFKPEF+S EE ++F  ++I  RY   C + +SLD +  P+Q DC 
Sbjct: 235  IYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCI 294

Query: 292  YTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFT 351
             TLFKIFKGPL RKS  EP KTI+  N++LN+H++P WLTSKYGF+   E DEET E   
Sbjct: 295  NTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDIL 354

Query: 352  EYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQ 411
            EY PPD+ +Y  D + R++RESF R+CL+LIF G++S  LL+  +  +N K  +  S +Q
Sbjct: 355  EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQ 414

Query: 412  TSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSS 471
            T+FST+ WF LLGE RA      + ++ SPLD++ HFI+LS  + Y DRDIIRNYE+  +
Sbjct: 415  TNFSTMFWFQLLGEYRAIF----STESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCT 470

Query: 472  LDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELN 531
            LDPEN+G+Y DAL +IANRKGAYQLIAYCGKQD +GQEAL++AL +F+I+ KE +   LN
Sbjct: 471  LDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLN 530

Query: 532  EATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591
            ++ LLSIYK E++  S    N    LKN+LRLLAK+ KS KLKFY D+EPYR ++QAY+ 
Sbjct: 531  DSVLLSIYKNESA--STRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588

Query: 592  LSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNY 651
            L +DESVD+DII+TAY+VK+NDSPGLK+DCDRALYTIA+  RSL LFNFL ++  +F  Y
Sbjct: 589  LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648

Query: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERN 711
            +GP++  YQ+AL +LQVNENA D+TIL+IF++KW+ E V++ DQFL L+ AL+KI  ERN
Sbjct: 649  FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708

Query: 712  STLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTV 771
            S LI++F+ TGT+D + LP ENWPTG+NNIGNTCYLNSLLQYYFSI+ LR+YVL+Y+ TV
Sbjct: 709  SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768

Query: 772  ENFNDHLSNXX-XXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAY 830
            ++F   L+N                      QF+YQLR+LF +M+H ++RCVTP KELAY
Sbjct: 769  QHF---LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAY 825

Query: 831  LAFAPSNVEVEFEV------EGNKVVDQTGVLS-DSKKETTDDAFTTKIKDTSLIDLEME 883
            LAF PS + VEFE+        N  V++   ++ DS+     +     I      D    
Sbjct: 826  LAFVPSGLGVEFELPNASQANANAPVEKENYVNIDSEPSPPPNDEPLLIDLDDDSDPNNH 885

Query: 884  DGLNGDVGTDANRKKNESNDAEVSENE------------------------------DTT 913
              LN +   D   K NE ++++  EN+                                 
Sbjct: 886  SKLNKNSNDDG--KINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAV 943

Query: 914  GLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQ 973
             + + TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI   +DNEQ DLVKQ
Sbjct: 944  AMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQ 1003

Query: 974  LFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGD 1033
            LFYG  KQ+I+PL    +VRTK ERFLSLL+NIGDHPKDIYDA D YF+DEYL +EEYGD
Sbjct: 1004 LFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGD 1063

Query: 1034 VIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKK 1093
            V RTVAVT FPTILQ+QIQRVYYDRER MPFKS+ PLPF E IYMDRY+DT NP+L+ +K
Sbjct: 1064 VKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRK 1123

Query: 1094 KETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVI 1153
            +ETE++ Q+L  +K RQRELLS+++ GL+RK A +E+   L+SD ++   ++I+    + 
Sbjct: 1124 RETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLA 1183

Query: 1154 KTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIY 1213
            + L N V  I++EL +LY++I  LE KISHQFDDFK  GYSLF+VFIHRGEASYGHYWIY
Sbjct: 1184 QELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIY 1243

Query: 1214 IKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKRILK 1272
            IKDR ++GIWRKYNDETI+            GNTATPYFLVYVKQG E +IEPLKR+L+
Sbjct: 1244 IKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1363 bits (3527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1229 (55%), Positives = 885/1229 (72%), Gaps = 29/1229 (2%)

Query: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113
            D GK +LY +++T  P KTSDRLLDD++ D  F+NS D  ++   L + GILK  +L+YS
Sbjct: 59   DSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHN-GILKAPVLAYS 117

Query: 114  TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFN-PSLAEQQISTFDD 172
               S + P   G+L DQ+  QT  EY SISCP +NK++V+  V+ + P   +   ST  +
Sbjct: 118  RRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSE 177

Query: 173  IVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPNLLDY 230
                 +YHLKV+VK R  LE  KK  GVT +H +    LH++DR DL  FD +DP L+D+
Sbjct: 178  NT---VYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLE-FDPTDPRLVDH 233

Query: 231  GIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDC 290
             IYVS DTNKL+LIE+F PEF+  E+ E ++  AIK RY+  C + ++LD SE P+Q DC
Sbjct: 234  AIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADC 293

Query: 291  FYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIF 350
              TL KIF+GPL R++  EP KTI+S N+ LN+ +NP WLTSKYGF+   E DE T E +
Sbjct: 294  INTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESY 353

Query: 351  TEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSL 410
             E+ PP++ +Y+ D + R++RESF+RKC++LIF G+ +  LL  ++    +K  +  +++
Sbjct: 354  FEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTSKVYRTFNAI 412

Query: 411  QTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLS 470
            Q +FS   WF +LGE R+     S     SPLDA  +FINLS   YY DRDII+NYE+  
Sbjct: 413  QIAFSKTTWFKMLGEHRSIFSFESA----SPLDANYNFINLSACFYYIDRDIIKNYEAQC 468

Query: 471  SLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISEL 530
            +LDPEN G+YFDALTYIANRKGAYQL+AYCGKQD++GQEAL+ AL +F I+ K+ +++ +
Sbjct: 469  ALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATI 528

Query: 531  NEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYD 590
            +++ L+SIYK ET   +    N  T+LKNALRLLAKY KSDKLKF+ D+EPY+ +S+AY+
Sbjct: 529  DDSLLVSIYKSET--MANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYE 586

Query: 591  TLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSN 650
             L +DESVD+DII+TAYS+ INDSPGLK+DCDRALYTI + KRSL L N+L ++CP F  
Sbjct: 587  ILEVDESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQL 646

Query: 651  YYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIER 710
            YYGP  L Y EAL +LQ+NENA DET+L++F++KW  E  +E D  L L+AALTKI IER
Sbjct: 647  YYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIER 706

Query: 711  NSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKT 770
            NS LI +F+ TGTID + LP +NWPTG+NNIGNTCYLNSLLQYYFS+APLRRYVLEYQ+T
Sbjct: 707  NSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQET 766

Query: 771  VENFNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAY 830
            +E+F  H  N                     QF+YQLR+LF AM++++ERCVTP KELAY
Sbjct: 767  MEHFRHHTGNELRRIGGREVSEAEVERSV--QFVYQLRDLFQAMIYSKERCVTPRKELAY 824

Query: 831  LAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFT---TKIKD---TSLIDLEMED 884
            LAFAPSN EVEFE      V+    +S   + T +D      T   D   T  I+L+ + 
Sbjct: 825  LAFAPSNFEVEFE---PTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDS 881

Query: 885  GLNGDVGTDANRKKNE--SNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVT 942
            G N D+     ++ +E    D  +S+ E    +++ TRVAKISSDQLENALEMGRQQDVT
Sbjct: 882  G-NEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVT 940

Query: 943  ECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSL 1002
            ECIGNVLFQ+ES S+PI  DEDNEQ DLVKQLFYG  KQ+I+PL+ + +++TK+ER+LSL
Sbjct: 941  ECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSL 1000

Query: 1003 LINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLM 1062
            L+NIGDHPKDIYDA DSYF DE LTM EYGDV RTVAVT FPTILQ+QIQRVYYDRER M
Sbjct: 1001 LVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFM 1060

Query: 1063 PFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLT 1122
            PFKSIEPLPF EV+YMDRY+D+++P ++ KKKE+E++K +L  +K RQ+ELLS ++ GL+
Sbjct: 1061 PFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLS 1120

Query: 1123 RKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKIS 1182
            RK A++E+I  L+SD IK   LK    + +I+ L+ ++ +ID EL  LY+DI  LE  I 
Sbjct: 1121 RKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTID 1180

Query: 1183 HQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXX 1242
             QF++FK+ GYSLF+VFIHRGEASYGHYW+YIKDR++NG WRKYNDETI+          
Sbjct: 1181 KQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF 1240

Query: 1243 XXGNTATPYFLVYVKQGQEGDIEPLKRIL 1271
              GNTATPYFLVYV+QG E DIEPLKRI+
Sbjct: 1241 TEGNTATPYFLVYVRQGHEHDIEPLKRII 1269

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1330 bits (3442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/1247 (54%), Positives = 858/1247 (68%), Gaps = 47/1247 (3%)

Query: 49   TPGDVDDGKHLLYPDIAT-NLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKE 107
            T  D+D G  LLYPD+ T N P+KTS+R++DDILCD  F+N   P +  K     GIL+E
Sbjct: 71   TTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFING--PNLSFKN----GILQE 124

Query: 108  SMLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFN-PSLAEQQ 166
            SM+ YS  R + +    GS+ DQV  QTK EY+S++CP  NK+ V   ++ N PS     
Sbjct: 125  SMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPS----N 180

Query: 167  ISTFDDIV-KIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSS 223
            I+  D+I+ K+PIYHLK++VK RQ LE  KK  G+TQ+H LD   LH +D+ DL TFD  
Sbjct: 181  ITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPD 240

Query: 224  DPNLLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSE 283
            +P+LLDY IYVS DTN+LILIEIF  EF+S EE ESF    IK RY   C K ++LD   
Sbjct: 241  NPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEA 300

Query: 284  TPSQVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEID 343
             P+ +DC  T+ K+ K PLTRK+  +  +T+ S N  L++H NPEWL  KY F      D
Sbjct: 301  VPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATD 360

Query: 344  EETNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNS--PLKNT 401
            E T +   EY PPD++ YV   + R +RE ++R+CLQLIFWG+    L    S   L+ +
Sbjct: 361  ETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGS 420

Query: 402  KSVKGMSSLQTSFSTLPWFHLLGESRARILLNS-NEQTHSPLDAEPHFINLSVSHYYTDR 460
            KS +  + L T+ ST P + LL +S++  L ++ N+     LD   HFINLS S YYTDR
Sbjct: 421  KSYRAFNLLNTTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDR 480

Query: 461  DIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKI 520
            DII+NYE L +LDP NIG YFDAL+YIANRKG+YQLIAYCGKQD++GQE +  AL  F I
Sbjct: 481  DIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNI 540

Query: 521  NPKECNISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHE 580
            +P   N+  ++++ LLSIYK    N+S        NLKNA+RL AK   S +LKFYVDHE
Sbjct: 541  DPNVVNLESIDDSLLLSIYK----NESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHE 596

Query: 581  PYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNF 640
            PYR ++QAY+TL ID SVD+DII+TAYS+K  D+PGLK+DCDRALYTIAI +RS+ LFNF
Sbjct: 597  PYRNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNF 656

Query: 641  LTEECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILR 700
            L E C +F  YY   + DY++AL +LQVNENA+DE ILK F+ KWF+E ++E DQFL  +
Sbjct: 657  LLENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYK 716

Query: 701  AALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPL 760
             AL K+ +ERNS LI NFL+ G IDP+ LP ENWPTGINNIGNTCYLNSLLQYYFSI+PL
Sbjct: 717  CALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPL 776

Query: 761  RRYVLEYQKTVENFNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRER 820
            R YVL Y KT E+F D   N                     QFIYQLR+LFYAM++T +R
Sbjct: 777  REYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKR 836

Query: 821  CVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDD-------------- 866
            CVTP +ELAYLAFAPSNVEVEFE   N V D    +S    + T D              
Sbjct: 837  CVTPRRELAYLAFAPSNVEVEFE---NGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGE 893

Query: 867  AFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNESNDAEVSENEDTTGLTSPTRVAKISS 926
            A  T+   T  I +  +D L     TD   K++ES        E+   +   T+VAKISS
Sbjct: 894  AERTEASPTEDIYMTDDDMLGAAKATDGINKEDEST-------ENGIDILPSTKVAKISS 946

Query: 927  DQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYD-EDNEQYDLVKQLFYGTTKQSIVP 985
            DQLENALEMGRQQDVTECIGNVL+Q+ESGSEP++ + EDNEQ DLVKQLFYG  KQ I+P
Sbjct: 947  DQLENALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIP 1006

Query: 986  LSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPT 1045
            LS   + R K+ERFLSLL+N+GDHP+DIYDA D YFKDE+LTM+EYG+V RTVA+T FPT
Sbjct: 1007 LSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPT 1066

Query: 1046 ILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKV 1105
            ILQVQIQRVYYDRER MPFKSIEPLPF   IYMDRY DT +P +L  ++ T +MK +L  
Sbjct: 1067 ILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQ 1126

Query: 1106 MKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDN 1165
            +K RQ+ELLSR++ GL+RK+A+ E++  L+S+ ++   +  E  +++   L+    +ID+
Sbjct: 1127 LKKRQQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDD 1186

Query: 1166 ELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRK 1225
            EL  +YN I  LEE ISHQF+ FK+ GYSLF+VFIHRGEASYGHYW+YIKD N+NGIWRK
Sbjct: 1187 ELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRK 1246

Query: 1226 YNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKRILK 1272
            YNDET+S            GNTATPYFLVYVK+G E DIEPLKRI++
Sbjct: 1247 YNDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1314 bits (3401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/1236 (53%), Positives = 877/1236 (70%), Gaps = 39/1236 (3%)

Query: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDT--IFLNSTDPKVMQKGLQSRGILKESMLS 111
            DDGK LLYPD     P KTS+RLLD+I+C    I L+  D    +    S G+LK+ +LS
Sbjct: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEF---SNGLLKKQLLS 108

Query: 112  YSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFD 171
            YS  R +++P  +G++ DQ++ QTK EY S +CP++N I+V   V+ + +   Q +STFD
Sbjct: 109  YSKSRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTN--HQPLSTFD 166

Query: 172  DIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYG 231
            D+  + IYHLK++VKVR  LER K+HVGV ++H LD LH +D+ DL  FD  DP L+D+ 
Sbjct: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226

Query: 232  IYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCF 291
            IYVSDDTNKL+L+EIF+PEF+S EE  S T  AIK+R+     K ++LDK E P+Q+DC 
Sbjct: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286

Query: 292  YTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFT 351
             T+FKIFKGPLTRKS  EP KT+ S N+ LN+ +NP+WL +KYGFQ   E +EET E   
Sbjct: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIETEEETEEQLI 346

Query: 352  EYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQ 411
            +Y+PP++VD+  D + RK RE+  RKCL+LI+ G++S SL+ P      +KS++  + LQ
Sbjct: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406

Query: 412  TSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSS 471
            TSFSTL W  +L E++    +  N Q    ++ + H I+LS S++YTDRDII+NYE    
Sbjct: 407  TSFSTLFWSQILDENKNIATMKENPQ----MNLDYHLIDLSASYHYTDRDIIQNYELQCK 462

Query: 472  LDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELN 531
            LDP NIG+YFD+L +IAN +G+Y LI YC KQDI+GQEALE AL  F ++P   ++S+ N
Sbjct: 463  LDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTN 522

Query: 532  EATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591
            +A  ++IYK E           LTNL+NALR+LAK+  S +LKFYVD+EPY ++ +A++ 
Sbjct: 523  DAIFMTIYKNEVKLHGN-DPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNI 581

Query: 592  LSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNY 651
            L +DESVD+DII+TAYS+K+ND+PGLK+DCDRALYT+A+SKRS+ L NFL +ECP F ++
Sbjct: 582  LEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDF 641

Query: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERN 711
            YGP++  Y EAL+ LQVNENA+D+TIL+IF+++W  ++V + D+ L L++ LTKI+ ERN
Sbjct: 642  YGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERN 701

Query: 712  STLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTV 771
            S LI+++L TG ++P  LP +NWP G+NNIGNTCYLNSLLQYYF I+PLR YV +YQKT+
Sbjct: 702  SKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTL 761

Query: 772  ENFNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYL 831
            E   + L +                     QF+YQLR+LF  M+H+  RCVTP+KELAYL
Sbjct: 762  EAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYL 821

Query: 832  AFAPSNVEVEFE------------VEGNKVVDQTGVLSDSKKETTDDAFTTKIKDT---S 876
            AFAPSNVEVEF+            V+G+ V     +     K    D   +K++++    
Sbjct: 822  AFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQ 881

Query: 877  LIDLEMEDGLNGDVGTDANRKKNESNDAEVSENEDTTGLT-SPTRVAKISSDQLENALEM 935
            LI+++       D    +  KK E    E+S+N      T + TRVAKIS DQLENALE+
Sbjct: 882  LIEID-------DSSDSSGHKKVE----EISQNPCFGKSTDTSTRVAKISFDQLENALEL 930

Query: 936  GRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTK 995
            GRQQDVTECIGNVLFQ+ES S PI  +ED+EQYDL+K+LFYG TKQSI+PL   N++R K
Sbjct: 931  GRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNK 990

Query: 996  VERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVY 1055
            +ERF+SLL+N+ DHPKD+YDA D YF DEYLTM+EYG+V +++AVT FPTILQ+QIQRVY
Sbjct: 991  IERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVY 1050

Query: 1056 YDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLS 1115
            YDRER MPFKSIEPLPF E IYMDRY +T +  LL KK ET E+K++L  M+ RQ+ELLS
Sbjct: 1051 YDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLS 1110

Query: 1116 RDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDIN 1175
            R++ GL+RK+AF+E+ K L SD ++K  ++ E    +I  L   +++ID+EL KLYNDI 
Sbjct: 1111 RNELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIV 1170

Query: 1176 SLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXX 1235
            ++E KI  QFD F+  GYSLF+VFIHRGEASYGHYW+YIKD  +NGIWRKYNDETI+   
Sbjct: 1171 NIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVP 1230

Query: 1236 XXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKRIL 1271
                     GNTATPYFLVYVKQ    +IEPLKRI+
Sbjct: 1231 EAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1304 bits (3374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/1258 (53%), Positives = 886/1258 (70%), Gaps = 39/1258 (3%)

Query: 19   LLNQDKENA-DRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLLYPDIATNLPLKTSDRLL 77
            +L QD E + + +    ++  +  T+ +++S P + DDGK LLYP +  NLP KT DRL+
Sbjct: 1    MLQQDTEQSIEAHAGDSDEQSVSSTTADEKSLPPN-DDGKQLLYPAVGLNLPFKTPDRLI 59

Query: 78   DDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIRPNC-LGSLTDQVVFQTK 136
            DDI+ D  F+N +D        + +GILK S L+YS  R  +RP+  LG+  DQ+  QTK
Sbjct: 60   DDIVYDLAFINDSDLSS-----EFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTK 114

Query: 137  SEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYHLKVSVKVRQELERLKK 196
             EY+SISCP +N+I+VF  V+ + ++  +  ++FD + + PIYHLKV+VK R +LE LKK
Sbjct: 115  YEYESISCPDHNRINVFFGVLIDSNM--ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKK 172

Query: 197  HVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNKLILIEIFKPEFNSPEE 256
            HVG++ +H +  LH +D+ DL TFD SD NL+D+  YVS DTNKLILIEIFKPEF+S EE
Sbjct: 173  HVGISHYHLITELHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILIEIFKPEFSSEEE 232

Query: 257  HESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKGPLTRKSK-AEPTKTID 315
             ESF  + I  RY  +C + +SL+    PSQVDCF TLF++FKGPL RKS   +P KTI+
Sbjct: 233  IESFKTEHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTIN 292

Query: 316  SGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVDYVNDLETRKIRESFV 375
            + N ALN+H++ +WL SKYGFQ +S  + E N+   EY PPD++D+ ND + RK+R+S+ 
Sbjct: 293  ATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYT 352

Query: 376  RKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWFHLLGESRARILLNSN 435
            RKCLQL FWG+LS  LL+  +  K  KS +  + + T  ST   F +  +S  R  L  +
Sbjct: 353  RKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARR--LQQD 410

Query: 436  EQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQ 495
            + + SPLD   HFINLS S+YYTDRDII+NYE+L ++D  N G+YFDALTYIAN KG+YQ
Sbjct: 411  DTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQ 470

Query: 496  LIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYKYETSNKSQVTSNHLT 555
            LI+YCGKQD++GQE L+N+L +  ++    +I  LN++ L SIYK E  N S+     LT
Sbjct: 471  LISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQE-QNASRGDMQRLT 529

Query: 556  NLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSP 615
             LK+A+R++ K  +S KL+F++DHEPY  +  AY+ L IDESVD+DI++TAY+++INDSP
Sbjct: 530  ELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSP 589

Query: 616  GLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQEALKLLQVNENASDE 675
            GLK+DCD+ALYTIAI  RS+ LFNFL E+CP F  YYGP+ L +Q+AL LLQVNENA+DE
Sbjct: 590  GLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDE 649

Query: 676  TILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLLTGTIDPNSLPPENWP 735
             ++KIF+Q+W  + + E DQ LIL+AALTKI+ E+NS LI+ FL TG ID N L PENWP
Sbjct: 650  LVIKIFQQRWGQKILNEYDQLLILKAALTKIASEKNSKLISYFLETGVIDANLLQPENWP 709

Query: 736  TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFN-DHLSNXXXXXXXXXXXXXX 794
             G+NNIGNTCYLNSLLQYYFSIAPLR Y+L Y+ ++ N+  D  SN              
Sbjct: 710  IGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNKRRIGGREVSENEV 769

Query: 795  XXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTG 854
                   QF+YQLR+LF  M++++ RC+TP  ELAYLAFAPSN+EVEF            
Sbjct: 770  ERSI---QFMYQLRDLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEFAA---------- 816

Query: 855  VLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNESNDAEVSENEDTTG 914
              S+ ++ T D  F  K  D  L+DL   D LN       N  +  ++D  V+  ED   
Sbjct: 817  --SEVERTTVDLPFD-KEGDIDLVDLS-NDNLNT-----TNNAQEVTSDISVA-TEDKVM 866

Query: 915  LTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQL 974
              + T+ AKISSDQLENALEMGRQQDVTECIGNVL+Q+ES S+PI+ DED EQYDL+K+L
Sbjct: 867  TNTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKEL 926

Query: 975  FYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDV 1034
            FYG TKQ IVPLS  +K RTK E F SLL+NI DHP+DIYDA +S F  E+L M+EYGDV
Sbjct: 927  FYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDV 986

Query: 1035 IRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKK 1094
             RTV++T FP ILQ+QIQRVYYDRER MPFKSIEPLPF   IYMDRYA  +N LL  KK 
Sbjct: 987  QRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKN 1046

Query: 1095 ETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESD-TIKKTPLKIEAANDVI 1153
            ET+E++ KLK +K RQ ELL+R++ GL+RK+++LE+I  L  + T+    L +     +I
Sbjct: 1047 ETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQII 1106

Query: 1154 KTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIY 1213
            + LR  + NID+EL ++Y++IN +E KI HQFD+F++ GYSLF+VFIHRGEASYGHYW+Y
Sbjct: 1107 EKLRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVY 1166

Query: 1214 IKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKRIL 1271
            IKD  R+GIWRKYNDET++            GNTATPYFLV+VK   +GDIEPLKRI+
Sbjct: 1167 IKDPERSGIWRKYNDETVTEVNEEEVFNFTEGNTATPYFLVFVKDYYKGDIEPLKRII 1224

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1303 bits (3373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/1232 (53%), Positives = 868/1232 (70%), Gaps = 40/1232 (3%)

Query: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113
            DDGKHLLY D+    P+KTSDRL+DDILCD + LN     ++ +  QS+GILK   + YS
Sbjct: 52   DDGKHLLYTDLKNGSPMKTSDRLIDDILCD-LSLNGQSQCLLSE--QSQGILKLLPIIYS 108

Query: 114  TFRSSIR-PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDD 172
              R  ++  + LGSL DQV+FQTK EY S+SCP++NK+ VF  V+ N S       + DD
Sbjct: 109  KQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLGVLLNVS---SSFESTDD 165

Query: 173  IVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGI 232
            +V+ P++HLKV+VK R +LE  KKH GV+QF S+D LH YD+ DL TFD  D  L+DY I
Sbjct: 166  VVRSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSYDKEDLGTFDPEDTRLIDYAI 225

Query: 233  YVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFY 292
            YVS DTNKL+LIEIF PEFN+ EE ESFT D I+KRY   C + +SL+  + P+Q DC  
Sbjct: 226  YVSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLN 285

Query: 293  TLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTE 352
            TL+K FK P+ +   + P +TI + N  LN+H+N  WLT +YGF   + +  E  +   E
Sbjct: 286  TLYKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGF---TLLPGENEDDEDE 342

Query: 353  YVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLK---NTKSVKGMSS 409
            Y PP+   Y+ D + RK++E ++RKCLQLIFW +L   ++      K   ++KS K +S 
Sbjct: 343  YEPPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSG 402

Query: 410  LQTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESL 469
            +    ++ P + L GES+    LNSN+Q +   D   HFI LS S++Y DRDII NYE+ 
Sbjct: 403  IAVQNTSKPLYQLFGESK-NAFLNSNDQNYM-WDTNYHFIALSASYHYNDRDIIMNYETY 460

Query: 470  SSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISE 529
            S +D  NIG+YFDA+ +IANRKG+YQL+AYCGKQ+I+G EALE A+  FK++P   +I++
Sbjct: 461  SVIDKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINK 520

Query: 530  LNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAY 589
            L+ + LLS+YK+E    S   ++HL++LKNALR+LAK+  +  +KFYVDHEPY+ +SQAY
Sbjct: 521  LDISLLLSMYKHE--QISNQNTSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQAY 578

Query: 590  DTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFS 649
            + L +DESVD+DII+TAYS+K+NDSPGLK++C RALYTIAI+KRS+ LFN+L EECP+F 
Sbjct: 579  NELEVDESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEECPEFQ 638

Query: 650  NYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIE 709
            ++YGPEK  Y++AL ++QVNENASDE IL+IF++KW DE + E DQFL L+AAL K+ IE
Sbjct: 639  DFYGPEKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCIE 698

Query: 710  RNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQK 769
            +NS LI++FL TG IDP+ LP ENWP G+NNIGNTCYLNSLLQYYF+IAPLR Y+  YQ 
Sbjct: 699  KNSKLISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQS 758

Query: 770  TVENFNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELA 829
            T E+F    ++                     QF YQLR+LF  M+ +  RCV+P++ELA
Sbjct: 759  TTESFEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQELA 818

Query: 830  YLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKET---------TDDAFTTKIKDTSLIDL 880
            YLAF+PSN+EVEF+       +  G  S + K+T          +D   T+  +  L D 
Sbjct: 819  YLAFSPSNIEVEFDAGSGIASESGGTFSLNGKDTDAPLTDMPLNEDVTMTEAGEPQLDDT 878

Query: 881  EMEDGLNGDVGTDANRKKNESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQD 940
             +   +  DV  D  +   E              + S T+VAKI SDQLENALE+GRQQD
Sbjct: 879  GLLAPVEADVPVDQMKLAKEV-------------INSSTKVAKIGSDQLENALELGRQQD 925

Query: 941  VTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFL 1000
            VTECIGNVL+Q+ES S+PI+ DEDNEQYDL+K LFYG T+Q IVPLS +  VR+K ERFL
Sbjct: 926  VTECIGNVLYQLESASDPIKLDEDNEQYDLIKHLFYGKTRQDIVPLSNSTDVRSKYERFL 985

Query: 1001 SLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRER 1060
            SLL+N+ DHPKDIYDA DSYF +EYLT+EEYGDV RTVA+T FPTILQ+QIQRVYYDRER
Sbjct: 986  SLLVNVSDHPKDIYDALDSYFMEEYLTLEEYGDVRRTVAITEFPTILQIQIQRVYYDRER 1045

Query: 1061 LMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSG 1120
             MPFKSIEP+PF   +YMDRYA T++P++L K++ET E+K +L+  K RQ+ELLSR+D G
Sbjct: 1046 FMPFKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETSELKTRLRECKVRQQELLSRNDMG 1105

Query: 1121 LTRKDAFLESIKLLESDTIKKTP-LKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEE 1179
            L+RK+A+ E++K+L+SD +++ P ++ E    V+  L + V +ID EL++LY +I  LE 
Sbjct: 1106 LSRKEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEELVQLYTEIGQLET 1165

Query: 1180 KISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXX 1239
            +I HQFD F++ GYSLF+VFIHRGEASYGHYW+Y+KD   +GIWRKYNDET+S       
Sbjct: 1166 QIDHQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEV 1225

Query: 1240 XXXXXGNTATPYFLVYVKQGQEGDIEPLKRIL 1271
                 GN ATPYFLV VKQ  E DIEPL RI+
Sbjct: 1226 FNFTEGNNATPYFLVLVKQTHEQDIEPLHRII 1257

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1290 bits (3338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1238 (52%), Positives = 858/1238 (69%), Gaps = 40/1238 (3%)

Query: 47   QSTPGDVDDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILK 106
            Q  P  +DDGK LLYP +  N P KTSDRLLDDI  D  FLNS +  ++   L + G+L+
Sbjct: 27   QEVPPVIDDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHN-GVLR 85

Query: 107  ESMLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQ 166
              ML YS  + + +P  +G L DQV  +TK EY+S +CP+ NKI+VF  V+ +  +  + 
Sbjct: 86   LPMLEYSR-KKTTQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVDQHIRPE- 143

Query: 167  ISTFDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPN 226
              + DD++ +PIYHLK++VK R  LER+KKHVGVT +H +D LH +D+ D+     S+  
Sbjct: 144  --SLDDVINVPIYHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDIFMTTESE-Q 200

Query: 227  LLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPS 286
            L+D   YVS DTN+L+ IEIFKPEF + E+   F+ + +K+RY + C K + LD +  P+
Sbjct: 201  LVDSATYVSSDTNRLLRIEIFKPEF-TKEDLAIFSQEKVKERYASACEKFQDLDPTSVPT 259

Query: 287  QVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEET 346
            QV+C  TLFKIFKGPL R+S  +  KTI + N  LN+ ++P WLT KY F+     DEET
Sbjct: 260  QVECLNTLFKIFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEET 319

Query: 347  NEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKG 406
             E+  E+ PPD+ DYV D   R  RES+ RKCL+LIF G+ S  LL  +   K++KS + 
Sbjct: 320  GELIREFEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKS-RS 378

Query: 407  MSSLQTSFSTLPWFHLLGESRARILLNSNEQTHS---PLDAEPHFINLSVSHYYTDRDII 463
             +  QT+FST  WFHLLG+ R       N Q H+   P D + HFINLS S YY+D+DII
Sbjct: 379  FNLYQTNFSTSFWFHLLGDGR-------NFQDHNLQQPFDNDYHFINLSASSYYSDKDII 431

Query: 464  RNYESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPK 523
            +NYE+  SLDPEN+G+YFDAL YIAN KG YQLIAYCGKQ+I+G+EAL+ AL +F I+ K
Sbjct: 432  KNYETQISLDPENVGIYFDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSK 491

Query: 524  ECNISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYR 583
            + ++  + +  LLSIYK E    S       T+LKNALRLLAK+ +S KLKF+VD+EPY 
Sbjct: 492  DTDVKSITDELLLSIYKNELKAAS---VQKRTDLKNALRLLAKFKESKKLKFHVDYEPYT 548

Query: 584  ALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTE 643
            + S+AY  L I ESVD DII+TAY++++ D+PGLK+DCDRALYT+A++KRSL LFNFLT+
Sbjct: 549  STSKAYQLLEIGESVDLDIIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQ 608

Query: 644  ECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAAL 703
            ECP F  +Y  +   Y+EAL LLQVNENA+D+ IL+IF++KW  E +  PDQFLIL+ AL
Sbjct: 609  ECPIFQEFYNIDNWSYKEALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTAL 668

Query: 704  TKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY 763
            TK+ IERNS LI NF+ TG +D + LP  NWPTG+NNIGNTCYLNSLLQYYFSI+PLR Y
Sbjct: 669  TKLGIERNSKLINNFIDTGIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDY 728

Query: 764  VLEYQKTVENFND---HLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRER 820
            VL YQK +  F D                            QF+YQLR+LF  MVHT+ER
Sbjct: 729  VLNYQKMLNCFRDIEDATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKER 788

Query: 821  CVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSL--- 877
             VTP+KELAYLAFAPSN+EVEFE      V    +          D  T K+    L   
Sbjct: 789  FVTPTKELAYLAFAPSNIEVEFEAPTITTVAPEDL----------DERTNKLDIIDLAAD 838

Query: 878  -IDLEMEDGLNGDVGTDANRKKNE--SNDAEVSENEDTTGLTSPTRVAKISSDQLENALE 934
             ID E E G    +    N++K E  + D  +   ++   + +  RVAKISSDQLEN LE
Sbjct: 839  GIDNETEKGSKSSLLDVHNQQKPEEQTEDIIMGGTQEEEAVNASMRVAKISSDQLENTLE 898

Query: 935  MGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRT 994
            +GRQQDVTECIGNVLFQ+ES S+P   +EDNEQ+DL+K+LFYG  KQ ++P+   +K+RT
Sbjct: 899  LGRQQDVTECIGNVLFQLESASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRT 958

Query: 995  KVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRV 1054
            K+ERF+SLL+NIGDHPKDIYDA D YFKD+ L ++E G+V RTVAVT  P ILQ+QIQRV
Sbjct: 959  KIERFVSLLVNIGDHPKDIYDALDLYFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQRV 1018

Query: 1055 YYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELL 1114
            YYDRER MPFKSIEPLPF E IYMDRY DT++P++LAK+ +T+++K++L+ +K+RQ +LL
Sbjct: 1019 YYDRERFMPFKSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLL 1078

Query: 1115 SRDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDI 1174
            S++D+GL+ K + L++ K L+S+ + K  + +E    ++  + + +  ID EL  LY  I
Sbjct: 1079 SKNDTGLSFKGSLLQTKKFLQSEVLDKHEIAVENKGALVCHIDSMITKIDGELSSLYQKI 1138

Query: 1175 NSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXX 1234
             +LE +I++QF++F + GYSLF+ FIHRGEASYGHYWIYIKDR +NGIWRKYNDE+++  
Sbjct: 1139 TALEVQIANQFNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEV 1198

Query: 1235 XXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKRILK 1272
                      GNTATPYFLVY+K+G E +IEPLKR++K
Sbjct: 1199 PQSEVFNFTEGNTATPYFLVYIKEGHEDEIEPLKRVIK 1236

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1252 bits (3239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1277 (50%), Positives = 871/1277 (68%), Gaps = 76/1277 (5%)

Query: 52   DVDDGKHLLYPDIATNLPLKTSDRLLDDILCD---TIFLNSTDPKVMQKGLQS------- 101
            +VDDGKH+LY   + +   KT+DRLLDD++ D    +F NS++                 
Sbjct: 60   EVDDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNN 119

Query: 102  ----------------RGILKESMLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCP 145
                             GIL+     YS  R S     +G++ DQ+  QT+ E+ S++CP
Sbjct: 120  NTSNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCP 179

Query: 146  KYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFH- 204
            ++N +HV   V+ + + ++  + TF     +P+YH K++VK R  LE+ KKHVG++ FH 
Sbjct: 180  EFNDVHVLLGVLMD-NRSQAPLGTF-----LPVYHFKITVKTRSYLEKTKKHVGISHFHL 233

Query: 205  -SLDHLHEYDRVDL--STFDSSDPNLLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFT 261
               D LHE+D+ DL  +  D +  +LLD  I++S+DTNKL+++EIFKPEFN  EE ESF+
Sbjct: 234  IDFDDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFS 293

Query: 262  ADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLAL 321
             ++I +RY   C +  +LD+ + P+Q++C  T+FKIFKGPL  K+  EP K I++ N  L
Sbjct: 294  QESIAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLL 353

Query: 322  NTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQL 381
            N+H NP WL +KYGF  + + + +T E F EY+PP++ DY+ND+ TR +RES++RKCL+L
Sbjct: 354  NSHWNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLEL 413

Query: 382  IFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWFHLLGESRARILLNSNEQTHSP 441
            IF  + + SL+ PN    N+K+++  + LQT F+T  W   L E + ++       T++ 
Sbjct: 414  IFISKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKPQL------DTYNK 467

Query: 442  LDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCG 501
            LD E H+INL  S YYT+RDIIRNY  L++LDP NIG+Y+DAL YIA  K +YQLI++  
Sbjct: 468  LDYEYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVS 527

Query: 502  KQDIIGQEALENALLMFKI-NPKECNISELNEATLLSIYKYETSNKSQVTSNHLTNLKNA 560
            KQD+IGQEAL  AL +F I N     IS L E+ + +IYK E   ++ ++S  L  +KNA
Sbjct: 528  KQDVIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERK-QANISSARLAEMKNA 586

Query: 561  LRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLD 620
            LRLLAKY  SD+LKFY D+EPY + SQ Y+TL +DESVD+DII+TAY++K+ND+PGLK+D
Sbjct: 587  LRLLAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKID 646

Query: 621  CDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKI 680
            CDRAL T+A  ++SL LF FL +ECPQF+ +YG ++ DY +AL  LQVNENA+DETIL+I
Sbjct: 647  CDRALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEI 706

Query: 681  FKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINN 740
            F+Q+W ++   + D  L L++AL+KI+ E+NS LI+NF+ TG +DP  LP ENWP G+NN
Sbjct: 707  FQQRWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNN 766

Query: 741  IGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHL---SNXXXXXXXXXXXXXXXXX 797
            IGNTCYLNSLLQYYFSI PLR ++L+YQ T+++F + +                      
Sbjct: 767  IGNTCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEV 826

Query: 798  XXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEVEFEVE------GNKVVD 851
                QFIYQ+R+LF  M+ ++ RCV+P +ELAYLAF PSN+EVEFE        G+K   
Sbjct: 827  ERSVQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNA 886

Query: 852  QTGV-LSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNG----------DVGTDANRKKNE 900
            Q  V L D  K  TD   T    + +LIDLE    ++           ++ T+++ K  E
Sbjct: 887  QDAVVLQDEAKNDTDINLT----EVNLIDLEPATKVSTSNDQPTMDAIEILTNSDNKSKE 942

Query: 901  SNDA----EVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGS 956
             +      EVS NED   +T  TRVAKISSDQLENA EMGRQQDVTECIGNVLFQ+E+G 
Sbjct: 943  LSKTNPFREVSPNED---ITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGF 999

Query: 957  EPIRYD-EDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYD 1015
            +PI  D EDNEQYDLVK+LFYG TKQSI+PL+  +  R KVERFLSLL+NI DHPKDIYD
Sbjct: 1000 DPISLDNEDNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYD 1059

Query: 1016 AFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEV 1075
            A + YF DE+LTMEEYGDV +T+++T +P ILQ+QIQRVYYDRER MPFKSIEPLPF++V
Sbjct: 1060 ALNQYFADEFLTMEEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQV 1119

Query: 1076 IYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLE 1135
            IYMDRYA++ +P L++KK+ET ++K KLK  + RQ+ELLS+++ GL+RK+A +E+IK L+
Sbjct: 1120 IYMDRYAESSDPELISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLK 1179

Query: 1136 SDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSL 1195
            S  I +  +     + +++ L+  V  I+NEL  LYN IN L+ +I HQFDDFK+  YSL
Sbjct: 1180 SPVILENGIDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSL 1239

Query: 1196 FSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLVY 1255
            F+VFIHRGEASYGHYW+YIKD ++NGIWRKYNDE+++            GNTATPYFLVY
Sbjct: 1240 FAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVY 1299

Query: 1256 VKQGQEGDIEPLKRILK 1272
            VKQ    DIEPLKRI++
Sbjct: 1300 VKQDSLSDIEPLKRIIQ 1316

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1229 bits (3180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/1219 (50%), Positives = 828/1219 (67%), Gaps = 21/1219 (1%)

Query: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113
            D+GK LLYPD  +  P KTS+RLLD+I  +  + NS    ++   L S G+LK  +L YS
Sbjct: 36   DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHS-GVLKLPVLEYS 94

Query: 114  TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDI 173
              +    P  +G L DQVV +T+ EY+S +CP  NK+ VF  V+ +PS+  ++    +D+
Sbjct: 95   R-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIVPREP---EDL 150

Query: 174  VKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIY 233
               PIYHLK++VK R  LE  +K  GV Q+H L  LH  D+ DL   + SDP+LLD  +Y
Sbjct: 151  AAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMY 210

Query: 234  VSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYT 293
            VS DTNKL+ IEIFKPEF S E+  +F+ D+I++R+   C K   LD  + PSQ +CF T
Sbjct: 211  VSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECFST 269

Query: 294  LFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEY 353
            L KIFKGPL R+S  +  KTI + N  LN+ + P WLT ++ FQ       E  E   EY
Sbjct: 270  LLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEY 329

Query: 354  VPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTS 413
             PPD+ DYVN+L  RK+RE + RKCL+L+F G+++ +L++ +   +++++ +     Q S
Sbjct: 330  QPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRA-RSFHLYQIS 388

Query: 414  FSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLD 473
            +S   +FHLLGE+R  +   + E     +D   HFINLS  HYY+D+DII+NYE+ + LD
Sbjct: 389  YSPSFFFHLLGETRGVMDYGTQE-----IDKNYHFINLSACHYYSDKDIIKNYETQARLD 443

Query: 474  PENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEA 533
            PENIG+YFDAL +IAN KG+YQLI YC KQD++G+EAL++AL +F I+  + ++S + + 
Sbjct: 444  PENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDD 503

Query: 534  TLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLS 593
             LL IY+ E+S  SQ      ++LKN+LRL+AK  KS  L+FY  +EPY    QAY  L 
Sbjct: 504  LLLGIYRKESSQASQ---QKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLE 560

Query: 594  IDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYG 653
            ++ESVD DII+TAY+VK+ DSPGLK+DCDRA+YTIA+S+RS+ LFNFL E+CP F+ +Y 
Sbjct: 561  VNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYS 620

Query: 654  PEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNST 713
             +KL YQEAL LLQVNENASD+ IL++F++KW  E V  PDQFLI  +ALTKI   RNS 
Sbjct: 621  ADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSL 680

Query: 714  LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
            LI  +L TG ID + LP  NWPTG+NNIGNTCYLNSLLQYYF I+PLR+ ++EYQKT+  
Sbjct: 681  LINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSE 740

Query: 774  FNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAF 833
            F+  + +                     QF+YQLR+LF  MVHT  R VTP+KELAYLAF
Sbjct: 741  FHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAF 800

Query: 834  APSNVEVEFE--VEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVG 891
            APSN+EVEFE       V +       + KETT+    T + +    D+EM D +  +  
Sbjct: 801  APSNIEVEFEGTPSSGSVGEAEDEEEGAIKETTEVIDLTSVPNAEQ-DIEMLDPVPSESE 859

Query: 892  TDANRKKNESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQ 951
                +  +   D +  +  +  G +  TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ
Sbjct: 860  MIVEQFVDSPKDDKKQDAAEAIGTS--TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ 917

Query: 952  IESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPK 1011
            +ES SEP   D D EQ DL+KQLF+G  +Q + PL+   KVRTK+ERF+SLL+N+GDHPK
Sbjct: 918  LESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPK 977

Query: 1012 DIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLP 1071
            D+YDA D YFK++ L +E+ GDV R+VA+   P +LQ+QIQRVYYDRER MPFKSIEPLP
Sbjct: 978  DVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLP 1036

Query: 1072 FKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESI 1131
            F++ IYMDRY DTE+P++L K++E   +K++L  +K +QR LL ++ SG++ K + LE+ 
Sbjct: 1037 FEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKEKQRSLLDKNGSGMSFKSSLLETK 1096

Query: 1132 KLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEY 1191
            + L+SD ++   ++       I+T+ + +  ID EL  +Y+ I  LE+K+S  FDDFK+ 
Sbjct: 1097 RFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQE 1156

Query: 1192 GYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPY 1251
            GYSLF+VFIHRGEASYGHYWIYIKD  +NGIWRKYNDE+++            GNTATPY
Sbjct: 1157 GYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPY 1216

Query: 1252 FLVYVKQGQEGDIEPLKRI 1270
            FLVYVK GQE  IEPL R+
Sbjct: 1217 FLVYVKNGQESQIEPLHRV 1235

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1215 bits (3143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 621/1229 (50%), Positives = 830/1229 (67%), Gaps = 47/1229 (3%)

Query: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113
            D GK LLY D     P KTS+RLLDDI  +  + NS +  ++   L  +G+L+  +L YS
Sbjct: 36   DTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDILYSELH-KGVLRLPILEYS 94

Query: 114  TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDI 173
               +    N +G L DQVV +T+ EYDS +CP  NKI VF  V+ N S   Q    +DD+
Sbjct: 95   RKPTDDVYN-IGHLVDQVVLKTRYEYDSKTCPGLNKITVFMGVLLNSS---QMPKIYDDV 150

Query: 174  VKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIY 233
             +  +YHLKV+VK R  LER +K  GV Q+H L  LH +D+ DL   D+ DP+L+D  +Y
Sbjct: 151  TQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPELHPFDKEDLLLTDAEDPHLIDSVMY 210

Query: 234  VSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYT 293
            VS DTNKLI IEIFKPEF+  +  E F  DAIKKRY++ C K   LD    PSQ +CF T
Sbjct: 211  VSSDTNKLICIEIFKPEFSQADLTE-FCPDAIKKRYSSACDKYPDLDPDMIPSQAECFST 269

Query: 294  LFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEY 353
            L KIFKGPL R+   +  KTI + N  LN+ L+P+WLT K+ F+     D +      E+
Sbjct: 270  LLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKWLTEKFAFKLCQANDTDEAGSAMEF 329

Query: 354  VPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTS 413
             PPD+ +YV+D+  R++RES+ RKCL+LIF G++S+SL+      K++++ +     QTS
Sbjct: 330  QPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIAKDSRA-RSFQLYQTS 388

Query: 414  FSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLD 473
             S   +FHLL E+R  +   S E     +D   +F+NLS  +YYTD+DII+NYE+ + LD
Sbjct: 389  NSLSFFFHLLNETRGVMDYGSQE-----IDRNYNFMNLSSCYYYTDKDIIKNYETQALLD 443

Query: 474  PENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEA 533
             ENIG+YFDALTYIAN KG+Y LIAYC KQD++G+EAL++AL +F I+P + ++  + + 
Sbjct: 444  RENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGIDPSDTSLMTIPDE 503

Query: 534  TLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLS 593
             LL +Y+ E S  S  T  H T LKNALRLLAK   S  L+FY  +EPY  + QAY  L 
Sbjct: 504  LLLGVYRKECSQGS--TQKHAT-LKNALRLLAKAKNSSTLQFYAAYEPYDNVHQAYSLLE 560

Query: 594  IDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYG 653
            +DESVD D+I+TAY++K+ DSPGLK+DCDRA+YT+A++KRS+ LFNFL E+CP F  +Y 
Sbjct: 561  VDESVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNFLVEQCPVFEEFYS 620

Query: 654  PEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNST 713
             +KL Y +AL LLQVNENASD+ IL++F++KW  E V  PDQFL   +ALTKI   RNS 
Sbjct: 621  ADKLTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSSSALTKIGQVRNSL 680

Query: 714  LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
            LI  +L TGTID   LP  NWPTG+NNIGNTCYLNSLLQYYF I+PLR+++++YQKT+  
Sbjct: 681  LINRYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFIVDYQKTLAE 740

Query: 774  FNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAF 833
            F+D + N                     QF+YQLR+LF  M+HT  R VTP KELAYLAF
Sbjct: 741  FHDSIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESRFVTPRKELAYLAF 800

Query: 834  APSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTD 893
            APSN+EVEF  EG   V+         KE +++       D  +IDL  E    G+   D
Sbjct: 801  APSNIEVEF--EGTPTVEPA-------KENSEN-------DVEVIDLTAE----GEASED 840

Query: 894  ANRKKNESNDAEVSE---NEDTT--------GLTSPTRVAKISSDQLENALEMGRQQDVT 942
             +  K   ++ +V     NEDT          + S TRVAKIS+DQLENALEMGRQQDVT
Sbjct: 841  VDMLKPAESETQVVTTQLNEDTVMNDVIATEPMVSSTRVAKISTDQLENALEMGRQQDVT 900

Query: 943  ECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSL 1002
            ECIGNVLFQ+ES S+PI  D D EQ DL+K+LF+G  KQ + PL   +K+RTK+ERF+SL
Sbjct: 901  ECIGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLKDPSKIRTKIERFVSL 960

Query: 1003 LINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLM 1062
            L+N+GDHPK++YDA D YFKD+ L +E+ GDV RT+A+   P +LQ+QIQRVYYDRE+ M
Sbjct: 961  LVNVGDHPKNVYDALDQYFKDDVLQLED-GDVKRTLAIKELPVVLQIQIQRVYYDREKFM 1019

Query: 1063 PFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLT 1122
            PFKSIEPLPF++ IYMDRY DT++  +  K++E  + K +L+ +K RQ+ LL ++ +G++
Sbjct: 1020 PFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLKLRQKALLEKNGNGMS 1079

Query: 1123 RKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKIS 1182
             K + LE+ + LES  +++  ++I+  +  +K + + +  IDNEL ++Y+ I +L++K+S
Sbjct: 1080 FKTSLLETERFLESGVLEQNAIEIQKKDSALKAIESMLLKIDNELSEIYSRITALDQKLS 1139

Query: 1183 HQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXX 1242
              FD+FKE GYSLF+VFIHRGEASYGHYW+YIKD NRNGIWRKYNDET++          
Sbjct: 1140 SHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFNF 1199

Query: 1243 XXGNTATPYFLVYVKQGQEGDIEPLKRIL 1271
              GNTATPYFLVYVK G E +I+PL R++
Sbjct: 1200 TEGNTATPYFLVYVKNGHESEIQPLHRVI 1228

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1210 bits (3131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/1248 (50%), Positives = 861/1248 (68%), Gaps = 50/1248 (4%)

Query: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113
            DDG+ LLYP+I T+LPLKTSDRLLDDILC   FL S D         ++ IL  + L YS
Sbjct: 39   DDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSGD---------NKSILNSNTLEYS 89

Query: 114  TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQ----QIST 169
              R  I+ + +G   DQV+ QTK EY S SCP++NKI V   ++      E+    QIS 
Sbjct: 90   KQRPHIKGSAVGFFQDQVIIQTKYEYPSKSCPEHNKIFVIMGILIGTDYLEKAEKKQIS- 148

Query: 170  FDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLD 229
              ++ +IPIYH+K+SVKVR  LE  KK VGV++++ LD LH+YDRVD  ++D +D  LLD
Sbjct: 149  --EVTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQLHDYDRVDFPSYDPTDSKLLD 206

Query: 230  YGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVD 289
              +Y +DDTNK++LIEI+KPEF+  ++  S ++  IK R+     K   L K E+P+Q+D
Sbjct: 207  SALYATDDTNKIVLIEIYKPEFDPEDKDLSVSSVQIKNRFAQAKEKFPQLAKEESPTQLD 266

Query: 290  CFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEI 349
               TLFK+FKGPL RKS   P K+I++ +  L +++NP  L + +GF  ++E     N  
Sbjct: 267  SINTLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTYTNE-----NIP 321

Query: 350  FTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPN--SPLKNTKSVKGM 407
              EY+ PD+V+Y+ D   +K+R++F RKCL+LI +G +  S L  N  S  + +K  + +
Sbjct: 322  GGEYMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFSKKYRIL 381

Query: 408  SSLQTSFSTLPWFHLLGESRAR--ILLNSNEQT------------HSPLDAEPHFINLSV 453
             ++Q  FS   W  LLG+ ++R   LLN NE              +SP D + +F NLSV
Sbjct: 382  RTIQPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSV 441

Query: 454  SHYYTDRDIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALEN 513
              +Y +RDII+NYE L +LD  NIG+YFD+L+ +ANRKG+YQL++YCGKQD+IGQEAL+N
Sbjct: 442  CLHYAERDIIQNYERLITLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIGQEALQN 501

Query: 514  ALLMFKINPKECNISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKL 573
            +L +F I+  +  +  L+E  LLS+YK+E   K    +N +++LKNALRLLAKY  SD L
Sbjct: 502  SLAVFGIDYTKVTLESLDENLLLSVYKHEW--KENPDNNRISDLKNALRLLAKYFTSDYL 559

Query: 574  KFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKR 633
            KFYVD+EPYR + +AYD L IDESVDEDII+TAY++KIND+PGLK+DCDRALYTIA S+R
Sbjct: 560  KFYVDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTIAYSRR 619

Query: 634  SLDLFNFLTEECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEP 693
            SL LFNFL ++CP+F  YYG + L Y ++ ++LQ+NEN ++  +L +F+QKW +  + EP
Sbjct: 620  SLMLFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNTLLEEP 679

Query: 694  DQFLILRAALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQY 753
            DQ L  RAALTKI++ERNS L+ NFL TG I+PNSLP ENWPTGINNIGNTCYLNSLLQ+
Sbjct: 680  DQLLKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLNSLLQF 739

Query: 754  YFSIAPLRRYVLEYQKTVENFNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYA 813
            YF+I+PLR Y+++YQKT+ + + +  +                     QF+YQLR+L+  
Sbjct: 740  YFAISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQVGKNEIERSVQFLYQLRDLYND 799

Query: 814  MVHTRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIK 873
            M+ + +RCVTP +ELAYLAFAPS+++VEFE    K        S+S  ++     T +  
Sbjct: 800  MIFSSQRCVTPKRELAYLAFAPSSIDVEFENAKTKSPISNIEGSNSTTDSQPMPSTGENI 859

Query: 874  DTSLIDLEMEDGLNGDVGTDANRKKNE--SNDAEV------SENEDTTGLT-SPTRVAKI 924
            D ++ D+E E+  N ++ +  N + N+  SN+ ++       ENE    +  +  +VAKI
Sbjct: 860  DHNM-DIEQEERNNEEINSTNNIESNDLVSNNHDIEMLDTDKENEGNMEIEDTAIKVAKI 918

Query: 925  SSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIV 984
              +QLENALE+GRQQDVTECIGNVLFQ+ES S P    ED+EQ DL+K+LF+G T Q I 
Sbjct: 919  DPEQLENALELGRQQDVTECIGNVLFQLESSSSPTSLSEDHEQNDLIKELFFGETNQHIK 978

Query: 985  PLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFP 1044
            PL A +  RTKVERF+SLL+NI DHPKD+YDA D YFK+EYLTMEEYG+V R +A+  FP
Sbjct: 979  PLKADSVTRTKVERFVSLLVNIADHPKDVYDALDLYFKEEYLTMEEYGEVKRELAIKKFP 1038

Query: 1045 TILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLK 1104
            TILQ+QIQRVYYDRER MP+KSIEPLPF+  IY+DRYADT++  LL K++ET E+K++L+
Sbjct: 1039 TILQIQIQRVYYDRERFMPYKSIEPLPFESDIYLDRYADTDDVKLLQKREETAELKRQLR 1098

Query: 1105 VMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNID 1164
              K RQ+ELLSR++ GL+R+DA+ E+   L S+ ++ T + I   + +   L  +   + 
Sbjct: 1099 SFKERQKELLSRNELGLSRRDAYKETANFLRSEVLQNTNISISDPDLLATKLEESASKVA 1158

Query: 1165 NELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWR 1224
            +EL  LY  I +LEEKI+HQFDDF E+GY+LF+VFIHRGEASYGHYW+YIKD   N IWR
Sbjct: 1159 DELSDLYVKITNLEEKINHQFDDFTEHGYTLFAVFIHRGEASYGHYWVYIKDF-VNSIWR 1217

Query: 1225 KYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKRILK 1272
            KYNDET++            GNTATPYF+V+VK+G E DIEPLKR+++
Sbjct: 1218 KYNDETVTEVPEEEVMNFTEGNTATPYFIVFVKKGHEKDIEPLKRMIE 1265

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1208 bits (3125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/1233 (51%), Positives = 840/1233 (68%), Gaps = 30/1233 (2%)

Query: 51   GDVDDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQ-----SRGIL 105
             ++DDG  LLY ++    PLKTS+R+LDDIL +   +   + K     L+     +  IL
Sbjct: 65   NELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSIL 124

Query: 106  KESMLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQ 165
            K+ M+ YS  R+++ P+ +GS+ DQ+V Q+K EY S++CP +NKI VF  V+ + +   Q
Sbjct: 125  KQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST---Q 181

Query: 166  QISTFDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDP 225
            + +T DD+  I I H+K++VK R  LER ++ +G+++FH +  LH +D+ DL TFD +  
Sbjct: 182  KANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAA 241

Query: 226  NLLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETP 285
            NL+D+ IYVS+DTNKLILIEIF PEF+S EE   FT + I +RY     + E     + P
Sbjct: 242  NLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIP 301

Query: 286  SQVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEE 345
            + ++C  TLFK+FKGPLTRKS  +P K I+S N  L  H+NPEWL SKYGF    E D E
Sbjct: 302  TGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVE 361

Query: 346  TNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVK 405
            T + FTEY PPD+ DYV++ +TRKIRES  RKCL+LIF+G++  +LL+     K++KS++
Sbjct: 362  TGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLLSKEELEKSSKSLR 421

Query: 406  GMSSLQTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRN 465
              + LQTSFST  +F LL + R   L   N+  +   + + HFINLSVS++Y++RDII+ 
Sbjct: 422  TFNLLQTSFST-SFFKLLIQERGVGLPIENQSNY---NIDYHFINLSVSYHYSERDIIQM 477

Query: 466  YESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKEC 525
            +E +S +DP+NIG Y+D+L +IAN KG+YQLIAYC K DI+GQE+LE A+  F ++    
Sbjct: 478  FEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVT 537

Query: 526  NISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRAL 585
             +S L ++ ++SIY+ E  NKS     H+ NL+NAL++LA Y KS KLKF+VD+EPY   
Sbjct: 538  ALSSLEDSVIMSIYQAELKNKSLSQERHV-NLRNALQVLASYKKSKKLKFFVDYEPYLNT 596

Query: 586  SQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEEC 645
              AY+ L IDES+D+DII+TAYS+K+ND+PGLKLDCDRALYTIAI++RS+ LFNFL E  
Sbjct: 597  RTAYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLLENN 656

Query: 646  PQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTK 705
              F  YY  +   Y  AL LLQVNENASDE IL++F++KWF+E +   D  L L+AALTK
Sbjct: 657  LIFQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAALTK 716

Query: 706  ISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
            I+ +RNS LI+NFL TG IDP+ LP ENWPTG+NNIGNTCYLNSLLQYYF+I+PLR  ++
Sbjct: 717  IAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEII 776

Query: 766  EYQKTVENFNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPS 825
             Y KTV++  ++L                       QF+YQLR+LF  M+++  RCVTP 
Sbjct: 777  NYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPK 836

Query: 826  KELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDG 885
            KELAYLAFAPSNVEVEF+ E  K   Q   +S    ET D     K  D  L+D +   G
Sbjct: 837  KELAYLAFAPSNVEVEFDSEDGK--SQRDNIS---TETVDVGADGK-NDNLLVDFDSNIG 890

Query: 886  LNG-------DVGTDANRKKNESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQ 938
             NG       D+ ++ + K  E    ++    +T    + TRVAKIS DQLENALEMGRQ
Sbjct: 891  ANGRDEKLLVDLDSNISDKIKEEEVKKI----NTLKPVTSTRVAKISPDQLENALEMGRQ 946

Query: 939  QDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVER 998
            QDVTECIGNVL Q+ES S P+  D+D EQ DL+K  F   TKQSI+PL  +   R K+ER
Sbjct: 947  QDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIER 1006

Query: 999  FLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDR 1058
            FLSLL+NIGDHPK+IYDA D YF DE L MEEYG+V +T+++T FP+ILQ+QIQRVYYDR
Sbjct: 1007 FLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDR 1066

Query: 1059 ERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDD 1118
            E+ +PFKSIEPLPF  V+YMDRYA+ +N  L+  K +   MK++L  MK RQ+ELLSR++
Sbjct: 1067 EKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNE 1126

Query: 1119 SGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLE 1178
             GL+RK++ +E+ +LL SD +    + +     +I  +  N+  ID EL  L+N+I  +E
Sbjct: 1127 LGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDME 1186

Query: 1179 EKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXX 1238
              IS+ F +F+   Y+LF+VFIHRGEASYGHYW YIKD  +N IWRKYNDETI+      
Sbjct: 1187 LNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSE 1246

Query: 1239 XXXXXXGNTATPYFLVYVKQGQEGDIEPLKRIL 1271
                  GNTATPYFLVYVK     DIEPLKRI+
Sbjct: 1247 VFNFIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1133 bits (2930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1256 (48%), Positives = 810/1256 (64%), Gaps = 51/1256 (4%)

Query: 39   LYGTSINQQSTPGDVDDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKG 98
            L G  + +  + G  + GK +LYP ++ N P KTSDRLLDDI     F        + +G
Sbjct: 13   LVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF--------VLEG 64

Query: 99   LQSRGILKESMLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCP------KYNKIHV 152
            ++  G+LK  ML YS  R  +R   +G L DQV+ QT  EY S+         K++KI+V
Sbjct: 65   VRGNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINV 124

Query: 153  FQAVIFNPSLAEQQISTFDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEY 212
            F  ++ +P +   ++ + DDIV    YHL+V+VK R  LER K+  G+ Q+H ++ LH  
Sbjct: 125  FMGLLCDPMV---KLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPA 181

Query: 213  DRVDLSTFDSSDPNLLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAM 272
            D+ DL  F+  D  ++D   YVS  TN+L+ IEI KPEF + EE   FT D+I+KRY ++
Sbjct: 182  DKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTA-EEWSEFTPDSIRKRYLSI 240

Query: 273  CVKNESLDKSETPSQVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTS 332
            C K   L++   P+Q +C  TLFK+FK PL+R+   +  KTI + N  LN+ L+P WL  
Sbjct: 241  CEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVD 300

Query: 333  KYGFQASSEIDEETNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLL 392
            K+GF+   E+ EE      EY PPD  +YVND   R +RE ++RK L+L+F G+ S  LL
Sbjct: 301  KFGFELC-EVQEEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL 359

Query: 393  APNSPLKNTKSVKGMSSLQTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLS 452
             P   +  +  ++     QT FS   WF LLGE       + N+Q   P D  PHFINLS
Sbjct: 360  -PKEVVAASSKLRSFQLYQTHFSHTFWFQLLGEFDRN---DFNQQQQHPYDTNPHFINLS 415

Query: 453  VSHYYTDRDIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALE 512
            V++YY DRDIIRNYES   LDP+N G+Y+D LT+IAN KG++QL+ +  KQ+I+GQEAL 
Sbjct: 416  VNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALN 475

Query: 513  NALLMFKINPKECNISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDK 572
            +AL +F I+P E +  ++ +  LLS YK E   K   T  H  +L+NALRLLAKY +S+K
Sbjct: 476  SALRLFHIDPSETDPKQIPDEMLLSCYKEEC--KYGNTRQH-ADLRNALRLLAKYKQSEK 532

Query: 573  LKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISK 632
            LKFYV+ EP++  SQAY  L IDESVD DII+TAY++K++D+PGLK+DCDRALYT+AI+K
Sbjct: 533  LKFYVELEPFQQESQAYSILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAK 592

Query: 633  RSLDLFNFLTEECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYE 692
            RS+DLFN+L + CP+F  +Y      Y  AL+ LQVN NA+D+ IL+IF++KW +E V  
Sbjct: 593  RSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVIS 652

Query: 693  PDQFLILRAALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQ 752
            PDQFL L+ AL KI+ ERNS LI +FL TG ID N L   NWPTG+NNIGNTCYLNSLLQ
Sbjct: 653  PDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQ 712

Query: 753  YYFSIAPLRRYVLEYQKTVEN--FNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNL 810
            YYF+I+PLR Y+  Y+ T  +   N + S                      QF+YQLR+L
Sbjct: 713  YYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDL 772

Query: 811  FYAMVHTRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTD-DAFT 869
            F  M H++ERCVTPS+ELAYL+F+PS   VEFE         T +L + +    D + F 
Sbjct: 773  FNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFD 832

Query: 870  TKIKDTSL--------------IDLEMEDGLNGDVGTDANRKKNESNDAEVSENEDTTGL 915
              I+ +++              ID + E        + ++ +K  S    V ENE  T  
Sbjct: 833  ISIEGSNVETEAAAEDIIADDNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEPITS- 891

Query: 916  TSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLF 975
               T VAKIS DQLEN LE+GRQQDVTECIGNVL+QIES S P+ +DE +EQYDLVKQLF
Sbjct: 892  ---TCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLF 948

Query: 976  YGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTM-EEYGDV 1034
            YG  KQ ++P+    K RTK ERF+SLL+N+GDHPKDIYDA D YF+D+ L + ++   V
Sbjct: 949  YGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARV 1008

Query: 1035 IRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKK 1094
             R+VAV   PTILQ+QIQRVYYDRE+LMPFKS EPLPF E +YMDRY  +    LLAKK+
Sbjct: 1009 RRSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQ 1068

Query: 1095 ETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKT--PLKIEAANDV 1152
            E+ ++ + L+ +K R++++LS++D+GLT KD+  E+   LES  + ++   ++IE  N +
Sbjct: 1069 ESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRN-L 1127

Query: 1153 IKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWI 1212
            IK L +    ID EL  L + I  +E  ISH+FD F  +GY+LF+VFIHRGEASYGHYW+
Sbjct: 1128 IKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWV 1187

Query: 1213 YIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLK 1268
            YIKDR  +GIWRKYNDE+++             NTATPYFLVY+K G E +IEPLK
Sbjct: 1188 YIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1074 bits (2778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1226 (46%), Positives = 773/1226 (63%), Gaps = 52/1226 (4%)

Query: 53   VDDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSY 112
            VDDGK LLY DI+ + P KT DR+LDDI     FL      VM          K+ ML Y
Sbjct: 38   VDDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLKKFGSSVM----------KQPMLQY 87

Query: 113  STFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDD 172
            S  R  ++P  L  L DQV  +++ +YDS++CP  N I V  A++ +P+      + FDD
Sbjct: 88   SRERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNFTP---NDFDD 144

Query: 173  IVKIP--IYHLKVSVKVRQELERLKKHVGVTQFHSLD--HLHEYDRVDLSTFDSSDPNLL 228
            I K P   +HLK++VK R  LE   +HVG+T +H L+   LH +D+ D+   +  D  L+
Sbjct: 145  IDKFPEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCRLV 204

Query: 229  DYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQV 288
            D  I+VS DTNKLIL+EI KPEFNS    E  TA  I++RY   C + + L+  + PSQ 
Sbjct: 205  DQSIFVSADTNKLILVEIIKPEFNSENLAEYRTA-KIEERYKNACQEFDLLNPDDIPSQA 263

Query: 289  DCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNE 348
            +C  TLF IFK PL RKS     K I   ++ALN+ +N +WLT+ + F       E+  +
Sbjct: 264  ECLKTLFMIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDNVQ 323

Query: 349  IFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSV-KGM 407
               EY PPD+VDY+ D + R IRE++ RK ++++  G+   S+L  N      K+V K  
Sbjct: 324  SGEEYKPPDLVDYITDFKVRGIREAYTRKSMEVVLIGK--QSMLLENELGTEKKTVAKCF 381

Query: 408  SSLQTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYE 467
            S+   S S   WF++L                 P D   HFINLSV+  Y D+DII+NYE
Sbjct: 382  SNQHFSASHTWWFNILNHQHIEPF---------PYDINYHFINLSVAFKYIDKDIIKNYE 432

Query: 468  SLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNI 527
            +  +LD ENI  YFDAL Y+ N KG+YQLIAYCGKQD++G E L NAL +F ++P + + 
Sbjct: 433  TQIALDQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDA 492

Query: 528  SELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQ 587
            S L+  T++   +Y  S+  + + N   +L+NALR+L KY  S K+ F V++EPY  + Q
Sbjct: 493  SLLDANTMI---EYYNSHLLRSSDNQRKDLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQ 549

Query: 588  AYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQ 647
            AY  L +DE+VD+DII+TAY++ I D+PGLK D DRA++TIA+ +RS+ L N LT+ECP+
Sbjct: 550  AYTLLKVDETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPE 609

Query: 648  FSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKIS 707
            F+ YY    + Y EAL +++++ NASD+ IL++F++KW    +  PD  L L+ AL  I 
Sbjct: 610  FAQYYNCTDISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIG 669

Query: 708  IERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
              RNS LI +FL TG +D + LP   WP GINN+GNTCYLNSLLQ++F+I PLR ++L Y
Sbjct: 670  FTRNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNY 729

Query: 768  QKTVENFNDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKE 827
                    D  S                      QF+Y LR+LF  M+HT  RCVTP+KE
Sbjct: 730  DDDSAKLLD-ASEYHSRRRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKE 788

Query: 828  LAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLN 887
            L YLAFAPSNVEVEF   G+  V Q  ++  +     D   TT+   +   D+ M     
Sbjct: 789  LVYLAFAPSNVEVEF---GDDTVAQKELIDLTTDVVEDPTDTTRHLASCDDDIIM---CQ 842

Query: 888  GDVGTDANRKKNESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGN 947
              V    ++  +E+   + S            +VAKIS+DQLEN LE+GRQQDVTECIGN
Sbjct: 843  SPVALPEHKTSSEAGTQQYS-----------VQVAKISADQLENTLEIGRQQDVTECIGN 891

Query: 948  VLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIG 1007
            VL Q+E  SEP+  ++D EQ DLVKQLFYG  KQ ++P++    VRTK ERFLSLL+N G
Sbjct: 892  VLAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNTG 951

Query: 1008 DHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSI 1067
            DHPKDIYDA D YF+++YL +EEYGDV RTV+++  P +LQ+QIQRVYYDRE+ MPFKSI
Sbjct: 952  DHPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKSI 1011

Query: 1068 EPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAF 1127
            EPLPF E +YMDRY  TE+P LLA+ ++  E+KQKL+ +K RQR+LLS+++ GLT K + 
Sbjct: 1012 EPLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSSL 1071

Query: 1128 LESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDD 1187
            +E+ K L+S T+K   +  +     I  +   + NID EL  L+N I  LE  IS QF +
Sbjct: 1072 IETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFSE 1131

Query: 1188 FKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNT 1247
            FK  GYSLF+VFIHRGEASYGHYW+YIKD  +NGIWRKYND++++            GNT
Sbjct: 1132 FKHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNT 1191

Query: 1248 ATPYFLVYVKQGQEGD-IEPLKRILK 1272
            ATPYFLVYV++GQE + IEPLKRIL+
Sbjct: 1192 ATPYFLVYVREGQEQETIEPLKRILQ 1217

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/861 (44%), Positives = 549/861 (63%), Gaps = 54/861 (6%)

Query: 54  DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113
           DDG+ +LY ++A   P+KTSDRLLDD+   T+ L+           + R +L+  ML Y+
Sbjct: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRV-TVSLSE----------EGREVLRAPMLEYA 69

Query: 114 TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDI 173
             R++ R   +G L DQVV QT  EY S +C + N++HVF  V+ +P    Q+ ++ D++
Sbjct: 70  RQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG---QRFASQDEL 125

Query: 174 VKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIY 233
           V   IYHL+V+VK+R +LER ++H GV Q+H +D LH +D+ D   F+  DP ++D   Y
Sbjct: 126 VNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATY 185

Query: 234 VSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYT 293
           V+  TN+L+ IE+ +PEF  P+E + FT + I+ RY  +C ++  LD S+ PSQ +C  T
Sbjct: 186 VASGTNRLVRIEVLRPEFG-PDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNT 244

Query: 294 LFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEY 353
           LFK+FK PL+R+   +  KTI + N  LN+ L   WL +K+GF+   EI+E+  +I+ EY
Sbjct: 245 LFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC-EIEEDGQKIY-EY 302

Query: 354 VPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTS 413
            PPD  ++V + E R+ RES++RK L+LIF G+ S  L+  +  + N+K ++     QT 
Sbjct: 303 KPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTH 361

Query: 414 FSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLD 473
           FS   W+HL+GE       + N+Q H P D   HF++LS ++YY+DRDII+NYE+  +LD
Sbjct: 362 FSHSFWYHLMGEYDHN---DFNQQMH-PYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALD 417

Query: 474 PENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEA 533
           P N  +Y+D L+++AN KG+ QL+ Y  KQ+++G EAL +AL +F ++P   +  +L++ 
Sbjct: 418 PANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDE 477

Query: 534 TLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLS 593
            LL  YK E    S    +   +L+NALRLLA+Y +SDKLKFYV+ EP+    QAY  L 
Sbjct: 478 FLLESYK-EVCKDSGPQKH--ADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLE 534

Query: 594 IDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYG 653
           IDESVD DII+TAYS+K++D+PGLK+DC RALYT+A++KRS+ LFN L ++CP+F  +Y 
Sbjct: 535 IDESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYH 594

Query: 654 PEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNST 713
              L YQ AL+ L VN NA+D+ IL+IF++KW  + +  P+Q L L+ ALTKI  ERNS 
Sbjct: 595 MSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSK 654

Query: 714 LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
           LI +FL TG +D N LP  NWPTGINNIGNTCYLNSLLQYYF+I+PLR Y+L Y  T  N
Sbjct: 655 LINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASN 714

Query: 774 F--NDHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYL 831
              N   S+                     QF+YQLR+LF+ MVH+RER VTP++EL YL
Sbjct: 715 LLNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYL 774

Query: 832 AFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDG------ 885
           +F+PS+ EVEFE     V    G  S++     ++ +    +DT +ID+ ME+       
Sbjct: 775 SFSPSSTEVEFE----PVPPAVGTASNAL--VANEVYN---EDTEVIDISMEECDEDSAI 825

Query: 886 -----------LNGDVGTDAN 895
                      L+ D+GTD+N
Sbjct: 826 NELGASNISVKLDSDIGTDSN 846

 Score =  377 bits (969), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/406 (50%), Positives = 268/406 (66%), Gaps = 20/406 (4%)

Query: 883  EDGLNGDVGTDANRKKNESNDAEVSENEDT----TGLTSP--------TRVAKISSDQLE 930
            E GL+               D +  EN+D+    T + SP        T VAKISSDQLE
Sbjct: 986  ESGLSDSAANAEYTSAGPLEDRQAVENDDSGKDITMVGSPEAEGPETSTYVAKISSDQLE 1045

Query: 931  NALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATN 990
            N LE+GRQQDVTECIGNVL+QIES S P+  DE+ EQ+DLVKQLFYG  KQ ++PL   +
Sbjct: 1046 NTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPD 1105

Query: 991  KVRTKVERFLSLLINIGDHPKDIYDAFDSYFK-DEYLTMEEYGDVIRTVAVTTFPTILQV 1049
            + RTK+ERF+SLL+NIGDHPKDIYDA DSYFK D     E+ G V R+VAV   P +LQ+
Sbjct: 1106 RKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQI 1165

Query: 1050 QIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNR 1109
            QIQRVYYDRE+ MPFKS EPLPF E +YMDRY  T+N  L AKK++   ++++L+ ++ R
Sbjct: 1166 QIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGLREELERLRER 1225

Query: 1110 QRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIE----AANDVIKTLRNNVQNIDN 1165
            +R LL+++D G+T   A  ++ + L++  +     +++    A    +  LR     +D 
Sbjct: 1226 RRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHLDALR---VALDE 1282

Query: 1166 ELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRK 1225
            EL  L   I S+++ I+H+FD F  YGYSL +VFIHRGEASYGHYW+YIKD    GIWRK
Sbjct: 1283 ELAALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRK 1342

Query: 1226 YNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKRIL 1271
            YNDE+++             NTATPYFLVYVK+  E DIEPLKR+L
Sbjct: 1343 YNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLL 1388

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1243 (38%), Positives = 685/1243 (55%), Gaps = 132/1243 (10%)

Query: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120
            Y  +  N   KTSDR++DDIL D  F+NS+  ++ + GL ++GIL+     YS FRSS  
Sbjct: 97   YDQLIENAVFKTSDRIIDDILIDLSFINSSADEIKELGL-NKGILRLPTTDYSKFRSSFS 155

Query: 121  PNCLGSLTDQV-VFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKI--- 176
               + +L+++  +   + EY+S +  + NKI  F +++  P  A      ++ + K    
Sbjct: 156  EYKIINLSNKNNLINYRFEYESKTNHQDNKILEFFSILHKPKDASNL--DYESMAKFWSQ 213

Query: 177  -PIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVS 235
               YHLKVS+K R +LE  KKH  +  F+ +D  +E D++D   F+  +PNLLDY I++S
Sbjct: 214  NEFYHLKVSIKTRNQLELSKKHTPIQHFYVIDEFNEEDKLDFINFNPDNPNLLDYAIFIS 273

Query: 236  DDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLF 295
             +TNK++L+EIFK EFN  ++      D ++   N    KN S  K + P+Q D    L 
Sbjct: 274  SNTNKVVLVEIFKSEFNLNDK--LIILDDLQVLNNYEKYKN-SNHKLKLPTQTDVLLVLM 330

Query: 296  KIFKGPLTR---KSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTE 352
              F          S  +  K  DS   A+   LNP WLT ++  +      E+ + IF  
Sbjct: 331  YCFNKQQNFDNIHSSEDEIKLKDSK--AIKISLNPSWLTERFSLK----FQEDESLIFM- 383

Query: 353  YVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLST--SLLAPNSPLKNTKSVKGMSSL 410
                ++ + +N ++  K R     +CL  +F    S    L+  NS  K+T  +K + ++
Sbjct: 384  ----NLRNNLNLIKKEKRRFDVFTRCLLELFVLIKSAPQKLVKCNS--KDTNIIKVVDTI 437

Query: 411  QTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLS 470
              + S   W  +LGE ++ IL  +N   +S       FINLS+   YT+ +I++NYE L+
Sbjct: 438  SINSSLSFWSQILGEYKS-ILSQNNFNQYS---KHAEFINLSILPTYTESEIVKNYEILT 493

Query: 471  SLDPENIGLYFDALTYIANRKGAYQLIA-YCGKQDIIGQEALENALLMFKINPKE---CN 526
             L+P+ IG+YFD+L +++     Y+ +A Y  K +IIG E    +L +FK++  E   C+
Sbjct: 494  ILNPDKIGVYFDSLKFVSQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDKLEFTNCS 553

Query: 527  ISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALS 586
             S L E  L     YE  N      NH   L+N+++ L+    S  LKF   +EPY+   
Sbjct: 554  DSVLWEKYLTY---YEDKN---FDYNHAI-LRNSIKSLSIVKNSPILKFLCKYEPYKNPD 606

Query: 587  QAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECP 646
             A+ TL+I ESVD D I  +Y+ KIND    K   D+AL TIAI ++ L LF+ L E C 
Sbjct: 607  NAFVTLNIHESVDSDTIIVSYTTKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLYENCK 666

Query: 647  QFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQF-------LIL 699
             F N Y    ++Y+ AL+ +  +E  SD  ++  FK++W+  +V   D F       L L
Sbjct: 667  DFVNLYHSMNIEYKTALQAIDSSELNSDNELILSFKKRWYRIDV-NNDTFGDDTVNLLTL 725

Query: 700  RAALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAP 759
            R  +  IS  RNS L+ N++  G ++P  LP ++WP G+NNIGNTCYLNSLLQYYF+I+P
Sbjct: 726  RKVMMVISSNRNSLLLNNYIEYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISP 785

Query: 760  LRRYVLEYQKTVENFND------HLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYA 813
            LR Y++       NFND       + N                     QF+YQLR+L+  
Sbjct: 786  LREYLI-------NFNDIELDGREMKNLEKRRVGGRNLSIAEFHRSI-QFVYQLRDLYGE 837

Query: 814  MVHTRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIK 873
            MVH+  R V+P  +LAYLAFAPS+  +EF       + +    SD   +T   + ++ IK
Sbjct: 838  MVHSSSRKVSPRLQLAYLAFAPSDTPIEFRDGIQNAIGKNDYYSD---KTNGGSESSSIK 894

Query: 874  DTSLIDLEMEDGLNGDVGTDANRKKNESNDAEVSENE-------DTTGLTSPTRVAKISS 926
                       GLN ++ +D++   +  +D+E S           T+    PT + KISS
Sbjct: 895  -----------GLNSNLNSDSDADSSLDSDSESSLLTFDNLPIIKTSTTNLPTLIPKISS 943

Query: 927  DQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPL 986
             QLE  LEMG QQDVTECI NVLFQIE+ S PI  DEDNEQ DLVKQLF+G T+Q I P 
Sbjct: 944  SQLETTLEMGSQQDVTECIENVLFQIEAASNPISIDEDNEQVDLVKQLFFGKTEQKIKPF 1003

Query: 987  SATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTI 1046
            +  +KV  K ERFLSLL+++ D P+DIYDA D+YFKDE   MEEYG V +++ +++FPTI
Sbjct: 1004 NEVSKVHPKRERFLSLLVSVSDKPRDIYDALDTYFKDEVFDMEEYGKVKKSLTISSFPTI 1063

Query: 1047 LQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVM 1106
            LQVQIQRVYYD E+ +PFK +EPL F E +Y+DRYA+  +  L  KK E   +K++LK  
Sbjct: 1064 LQVQIQRVYYDIEKGVPFKDLEPLRFSESLYLDRYANDIDEKLAEKKIEVASLKKRLK-- 1121

Query: 1107 KNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNE 1166
                         GL                TIKK   ++E  ND +            E
Sbjct: 1122 -------------GLI---------------TIKK---ELEKKNDNV------------E 1138

Query: 1167 LMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKY 1226
            +  +  +IN +E KI   F +F ++GYSLF+VFIHRG+A++GHYWIYIKD   +G WRKY
Sbjct: 1139 IRTISKEINDVETKIDTAFSEFHKHGYSLFAVFIHRGQATFGHYWIYIKDFKNHGTWRKY 1198

Query: 1227 NDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKR 1269
            ND  ++            GN++TPYFLVY+K G E D+EPLKR
Sbjct: 1199 NDHEVTEILPIEVFNFSEGNSSTPYFLVYIKNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1254 (32%), Positives = 640/1254 (51%), Gaps = 123/1254 (9%)

Query: 45   NQQSTPGDVDDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGI 104
            N +     +DDG HLLY +I      KTS R+LDDIL D  F++    K      +  G+
Sbjct: 60   NVEKNDTSIDDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFMSLDSEKSDDIDFKD-GV 118

Query: 105  LKESMLSYSTFRSSIRP-NCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLA 163
            L    + YS +R  I+P   +   T+  V   K ++ S++ PK N I     ++      
Sbjct: 119  LNLPTIKYSLWRKYIKPFKIILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLVPKIPR 178

Query: 164  EQQISTFDDIVKI-PIYHLKVSVKVRQELERLKKHVGVTQFHSLD---HLHEYDRVDLST 219
              +++TFD+ ++  P+Y ++++VK R  LE  KKH+ +T +  LD    LHE D+ D   
Sbjct: 179  RSELNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPK 238

Query: 220  FDSSDPNLLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESL 279
            F+    +LLD+ IY+S DTNK+ILIEIFKP FN  E     ++ ++  R N +   +E L
Sbjct: 239  FNKDSKDLLDFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEEL 298

Query: 280  ----DKSETPSQVDC----FYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLT 331
                + +    Q+D      + + +  KG   R+ + + T  + S ++ L T+++ +WL 
Sbjct: 299  QPDYNDAIVEEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLE 358

Query: 332  SKYGFQASSE---------IDEETNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLI 382
              +  +   +         +DE     F +  P +   +          +   R  ++L+
Sbjct: 359  ENFDIKVKEQKRKDHVSITLDEALKLSFDDPNPKNQAKF----------DKITRYAMELM 408

Query: 383  FWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWFHLLGESRARILLNSNEQTHSPL 442
            + G++  S  +    ++          ++   +T  W  +L E ++   + S+++T S  
Sbjct: 409  YLGKVLQSFYSNEEEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQS---IFSSQKT-STR 464

Query: 443  DAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQLI-AYCG 501
              + HFINL +    +++DII NYE     DP+N   YF++L Y++ +   Y ++  YC 
Sbjct: 465  CVDEHFINLCIDSNVSEKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCK 524

Query: 502  KQDIIGQEALENALLMFKINPKECNISELNEATLLSIYKYETSNKSQVTSNHLTNLKNAL 561
            +  II + A  +AL +FK + +  N  E + + +   Y     + +     +  +L ++ 
Sbjct: 525  ENVIISKAAYLHALEIFKYSEEYFNAIE-HVSEIWDKYTELVQSNNNNDDQYRVDLVDSF 583

Query: 562  RLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDC 621
              LA   KS  L +   +EP+     AY  L++D  +D + I  AY+++I + P  K+  
Sbjct: 584  YSLATVKKSSPLIYITKYEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQF 643

Query: 622  DRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKIF 681
            DRAL+ IAI +  L L   L + C  F+       L   +A +++ + + +S+ +I+  F
Sbjct: 644  DRALFAIAIQRHDLSLLYVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTF 703

Query: 682  KQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNI 741
             + W + +   P  F++  AAL ++S  R S L+ +F   G ++P  +  E WPTGINNI
Sbjct: 704  TKYWKETDDSNPVNFILASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNI 763

Query: 742  GNTCYLNSLLQYYFSIAPLRRYVLEYQKT---VENFNDHLSNXXXXXXXXXXXXXXXXXX 798
            GNTCYLNSLLQYYFSI   R ++  YQ     + N N  +S                   
Sbjct: 764  GNTCYLNSLLQYYFSITLFREFIENYQSIESDLLNSNAEMSKRRVGGREIQNNEINRSV- 822

Query: 799  XXXQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSD 858
               QFIYQ+++LF  MVHT+ R VTPS +LAYLAFAP+N E++F+               
Sbjct: 823  ---QFIYQVQDLFKLMVHTKSRKVTPSNQLAYLAFAPNNAEIKFK-------------HK 866

Query: 859  SKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNESNDAEVSENEDTTGLTSP 918
            S+ E++++   T     +L              T  +    ++ D ++S N  +    S 
Sbjct: 867  SELESSEEHQLTTSHSIAL-----------SSATSISHSDIDTQDHDISLNSTSY---SN 912

Query: 919  TRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGT 978
              VA ++ D LE  LE+G QQDVTECI  VL+Q+E+GS P+  D DNEQ DLVK+LFYG 
Sbjct: 913  RLVAMVTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYGE 972

Query: 979  TKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTV 1038
            T Q I P+    K   K E + SLL+NI D P D+Y+  D YF DEY++MEEYG+V +T+
Sbjct: 973  TIQEICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSMEEYGEVKKTL 1032

Query: 1039 AVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKET-- 1096
            ++T  PTIL +QIQRVYYD+E+L+P+K    LPFK  I++DRY       +   KKE   
Sbjct: 1033 SITKLPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRY-------IKGNKKENDV 1085

Query: 1097 -EEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKT 1155
             E+ + +LK+ K + REL+S              S+    SD I  T  +IE  N VI  
Sbjct: 1086 LEKARLELKLAKVKYRELVSE-----------YNSVNKSISDRIITTYDRIEELNAVI-- 1132

Query: 1156 LRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIK 1215
                                  EE+++       +  YSLF+VFIHRG+AS+GHYW+YI+
Sbjct: 1133 ----------------------EEEVTKD----AKIRYSLFAVFIHRGQASFGHYWVYIR 1166

Query: 1216 DRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEGDIEPLKR 1269
            D   NGIWRKYND  ++            G+ +TPYFL YV   ++  ++PL R
Sbjct: 1167 DF-ENGIWRKYNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVKPLVR 1219

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 44/109 (40%), Gaps = 25/109 (22%)

Query: 716 TNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFN 775
           T FL   T     +  +  P G+ N+GNTCY N+ LQ  + I PLR  VL Y +   + +
Sbjct: 86  TKFLEDLTDKERLMQEDTIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLH 145

Query: 776 DHLSNXXXXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHTRERCVTP 824
                                     Q + QLRN F A    +E+  TP
Sbjct: 146 G-------------------------QLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y+L  V  H+G  S  GHY  +++D      W KYND+ +
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKV 454

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
           P G+ N+GNTCY+NS LQ  + I PLR  +L +Q   EN
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKEN 143

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ +S
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVS 466

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 26/36 (72%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKT 770
           P G+ N+GNTCYLN+ LQ  F I PLR  +L Y+++
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  +  H+G  S  GHY  +I+DR    IW K+ND+ ++
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVT 474

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 26/40 (65%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENF 774
           P G+ N+GNTCY+N+ LQ  + I PLR  +L + K   NF
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVS 463

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 24/33 (72%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           P GI N+GNTCY+N+ LQ  F I PLR  VLE+
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 42/97 (43%), Gaps = 21/97 (21%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSNXXXXXXXXXXXXXX 794
           P G+ N+GNTCY+NS LQ  + I PLR  VL Y+   E  ++   +              
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQHH-------------- 104

Query: 795 XXXXXXXQFIYQLRNLFYAMVHTRERCVTPSKELAYL 831
                  Q + +LR  F  +    +  VTP   LA L
Sbjct: 105 -------QLVSELRRCFQQLKDKPQESVTPMLLLAML 134

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ +S
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVS 420

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 22/33 (66%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           P G  N+GNTCYLNS LQ  + I PLR  +L Y
Sbjct: 107 PIGFQNMGNTCYLNSTLQALYRIKPLRELILSY 139

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVS 471

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 23/102 (22%)

Query: 695 QFLILRAALTKISIERNSTLI---TNFLLTGTIDPN-------------SLPPE------ 732
           Q  +++  LT  SI+  S +I   +N +L GT D N              L PE      
Sbjct: 43  QKYMVKGGLTDDSIKNLSEIIKPGSNIMLLGTPDANLVSKPKSQNHFIEDLTPEQQVQQF 102

Query: 733 -NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
            + P G  N+GNTCYLN+ LQ  + I  LR  VL +  ++ N
Sbjct: 103 NDIPIGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINN 144

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y L  +  H+G  S  GHY  +I+D N   IW K+ND+ +S
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVS 470

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           P G  N+GNTCYLN+ LQ  + I PLR  +L+Y
Sbjct: 108 PIGFQNMGNTCYLNATLQALYRIEPLRDMILDY 140

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           P GI N+GNTCY+N+ LQ  + I PLR  +L +
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAF 91

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y L  V  H+G  S  GHY  +++D   +  W K+ND+ ++
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVT 417

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 75/173 (43%), Gaps = 21/173 (12%)

Query: 906  VSENEDTTGLTSPTRVAKISSDQLENAL-EMGRQQDVTECIGNVLFQ----IESGSEPIR 960
            ++EN   TG+ SPT   KI   + EN L     QQD  E +  +L      I+  +  +R
Sbjct: 402  ITENLSLTGIVSPTEFVKIL--KKENVLFNTMMQQDAHEFLNFLLNDFSEYIQRNNPRMR 459

Query: 961  YD---EDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINI-GDHPKDIYDA 1016
            +     DN   + +  LF GT    I  L+  N + ++ E FL   I + GD   DI   
Sbjct: 460  FGPQKTDNSNDNFITDLFKGTLTNRIKCLTCDN-ITSRDEPFLDFPIEVQGDEETDIQKM 518

Query: 1017 FDSYFKDEYLTM-------EEYG--DVIRTVAVTTFPTILQVQIQRVYYDRER 1060
              SY + E L         + YG  +  R V +   P IL + ++R  Y  E+
Sbjct: 519  LKSYHQREMLNGVNKFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSEEQ 571

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFN 775
           G  N GNTCY NS+LQ  ++I   R  VL Y + V   N
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERVAAVN 173

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 23/98 (23%)

Query: 695 QFLILRAALTKISIERNSTLI---TNFLLTGTIDPN-------------SLPPEN----- 733
           Q  +++  LT  +I   S++I   +  +L GT D +              L PE+     
Sbjct: 45  QKYMVKGGLTDNTISNLSSVIKPGSTVMLLGTPDADMISKPKESNKFIEDLAPEHQRQKF 104

Query: 734 --WPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQK 769
              P G+ N+GNTCY+NS LQ  + +  LR  VL+Y++
Sbjct: 105 NQMPIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKE 142

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVS 467

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N+L P     G+NN+GNTCY+NS LQ    I  LR Y L
Sbjct: 333 NALTPSRGNIGLNNLGNTCYMNSALQCLVHIPQLRDYFL 371

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N+L P    TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 293 NTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYFL 331

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 23/96 (23%)

Query: 695 QFLILRAALTKISIERNSTLI---TNFLLTGTIDPNSL--PPE----------------- 732
           Q  +++  L+  SI    T+I   +  +L GT D N L  P E                 
Sbjct: 45  QKFMVKGGLSDDSIANLQTIIKPGSTVMLLGTPDANLLSKPAEKHRFVEDLSPDQQVQQF 104

Query: 733 -NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
            + P G+ N+GNTCYLN+ LQ  F    L+  +L+Y
Sbjct: 105 NSTPLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y L  V  H+G  S  GHY  +I+D +    W K+ND+ +S
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVS 466

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQ-KTVENFN 775
           P G  N+GNTCYLN+ LQ  F +  LR  +L Y  K   N N
Sbjct: 107 PIGFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLN 148

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  V  H+G  S  GHY  +I+D N   +W K+ND+ +S
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVS 470

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 23/96 (23%)

Query: 695 QFLILRAALTKISIERNSTLI---TNFLLTGTIDPN-------------SLPPENW---- 734
           Q  +++  L+  S+   S++I   +N +L GT D +              L P+      
Sbjct: 43  QKYMVKGGLSDDSVSNLSSVIKAGSNVMLLGTPDADLISKPKGTNHFIEDLTPDQQMQKF 102

Query: 735 ---PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
              P G+ N+GNTCY+N+ LQ  F +  +R  +L Y
Sbjct: 103 DSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  +  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVS 464

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 9/112 (8%)

Query: 950  FQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDH 1009
            FQ+ SG        D+    +    F G  K SIV     N  +T ++ F+ L ++I D 
Sbjct: 251  FQVCSGKGVNDAISDDLCTCIAHSTFQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDIKD- 309

Query: 1010 PKDIYDAFDSYFKDEYLTMEEYG--------DVIRTVAVTTFPTILQVQIQR 1053
              ++Y+  DS+ K E L    Y         D I+ +++   P++L +Q++R
Sbjct: 310  KSNLYNCLDSFHKKERLHDFNYHCPNCNTSQDAIKRLSIYKLPSVLVLQLKR 361

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFN 775
           P G  N+GNTCYLN+ LQ  + +  LR  +L Y  + E  N
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASN 148

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQ 768
           P G  N+GNTCY+NS LQ  F +  L+  +L Y+
Sbjct: 108 PIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 2/69 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTA-TP 1250
            Y L  +  H+G  S  GHY  +I+D N    W K+ND+ +S            G  + + 
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKIEQLAGGGESDSA 495

Query: 1251 YFLVYVKQG 1259
              L+Y   G
Sbjct: 496  LILIYKGMG 504

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           P G  N+GNTCYLN+ LQ  + +  LR  +L Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLREMILNY 140

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 708 IERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           +E N   ++N  +      N L P +  TG+ N+GNTCY+NS LQ    +  LR Y L
Sbjct: 338 VEGNHHWVSNHFVY-----NKLEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFL 390

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 355 NKLEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 710 RNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           +N   ++N+ +      N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 272 KNYHWLSNYFMY-----NQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYFL 322

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 27/37 (72%), Gaps = 1/37 (2%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY-QKTVE 772
           G  N GNTCY NS+LQ  ++++PLR  +L++ +K +E
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQFPEKPIE 177

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 23/96 (23%)

Query: 695 QFLILRAALTKISIERNSTLI---TNFLLTGTIDPN-------------SLPPENW---- 734
           Q  +++  LT     + S+LI   T  +L GT D N              L PE      
Sbjct: 45  QKYMVKGGLTGEESIQISSLIKPGTTVMLLGTPDANLISKPAKKNNFIEDLAPEQQVQQF 104

Query: 735 ---PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
              P G  N+GNTCYLN+ LQ  + +  +R  +L Y
Sbjct: 105 AQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVT 471

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           P G  N+GNTCYLN+ LQ  + +  LR  +L Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 58/127 (45%), Gaps = 20/127 (15%)

Query: 1115 SRDD-SGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYND 1173
            S+DD  GLT   A LE +  +  D        ++  NDV  ++     + D        D
Sbjct: 628  SKDDKGGLTVDPAALEQMVSMGLDAKLCRKALLQYLNDVASSVEWVFSHPD--------D 679

Query: 1174 INSLEEKISHQ--FDDFKEYG------YSLFSVFIHRGEASY-GHYWIYIKDRNRNGIWR 1224
              SLE + + Q   +  +++G      Y L+ +  H+G ++  GHY  YI  R R+G W 
Sbjct: 680  DGSLETETAPQDTANAARKFGHPGGSIYKLYGIVCHKGNSTQSGHYVAYI--RQRDGQWT 737

Query: 1225 KYNDETI 1231
             YNDE I
Sbjct: 738  LYNDEKI 744

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRY 763
            G+NN+GNTCY+NS LQ    I P+R Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%)

Query: 699 LRAALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIA 758
           +R+ +  + IE          L+     N L P +   G++N+GN+CY+NS LQ    I 
Sbjct: 261 MRSPIVDLVIEFKGVEKDQHWLSNYYYYNKLSPPSGIVGLSNLGNSCYMNSALQCLVHIP 320

Query: 759 PLRRYVL 765
            LR Y L
Sbjct: 321 ELRDYFL 327

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL--EYQKTV 771
           N + P N   G+ N+GNTCY+NS LQ    I   + Y L   Y+K +
Sbjct: 340 NQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEI 386

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQ 768
           P G  N+GNTCY+N+ LQ  +    +R+ +L+Y+
Sbjct: 110 PIGFQNMGNTCYMNATLQALYRTDDIRQMILDYK 143

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 1193 YSLFSVFIHRGEAS-YGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y+L  +  H+G  S  GHY  +++D N    W K+ND+ ++
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVT 473

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  + K R   G+W + +DET+
Sbjct: 722  YSLRSVIVHYGTHNYGHYIAFRKYR---GVWWRISDETV 757

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDH 777
           TG+ N+GNTCY+NS+LQ  F+    R   L ++   E + DH
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHK--YEKYMDH 792

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G+ N GNTCY NS+LQ  F+++ LR  +L Y
Sbjct: 134 GLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAFRKHR---GFWWRISDETV 743

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N L P    TG++N+GN+CY+NS LQ    I  L+ Y L
Sbjct: 325 NKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDYFL 363

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++  LR ++LEY
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 710 RNSTLITNFLLTGTIDPNSLPPENWP-TGINNIGNTCYLNSLLQYYFSIAPLR 761
           RN TL   F +  TI+ NS P   +  TG+ N+GNTCY+N +LQ  F+   L+
Sbjct: 622 RNQTLTRKFSIP-TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELK 673

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 40.0 bits (92), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 20/90 (22%)

Query: 710 RNSTLITNFLLTGTI----------DPNSLPPENWPT----------GINNIGNTCYLNS 749
           RNS+  + FL+ G++          DP  +   N+            G  N G TCYLNS
Sbjct: 156 RNSSRNSGFLVNGSLNVSVFIRILKDPTGVLWHNFMNYDSKKLTGYIGFKNQGATCYLNS 215

Query: 750 LLQYYFSIAPLRRYVLEYQKTVENFNDHLS 779
           LLQ YF     R+ V +     E+ ND +S
Sbjct: 216 LLQSYFFTKLFRKMVYKIPSDNESPNDSVS 245

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 10/92 (10%)

Query: 974  LFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYL------T 1027
            LF G  K  I  ++   +   +VE F  + +N+ +  KD+ ++F++Y + E +       
Sbjct: 311  LFVGKMKSYIRCVNVDYE-SFRVEDFWDIQLNVKN-LKDVKESFENYVEVEMMDGENQYA 368

Query: 1028 MEEYG--DVIRTVAVTTFPTILQVQIQRVYYD 1057
             ++YG  D  + V   +FP +L +Q++R  YD
Sbjct: 369  AQDYGLQDAKKGVVFESFPPVLHLQLKRFEYD 400

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y+L  V +H G+ S GHY+  IK  N    W +++D+ +
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKP-NVTDQWFRFDDDKV 476

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 68/166 (40%), Gaps = 20/166 (12%)

Query: 938  QQDVTECIGNVLFQIESGSEPIRYDEDNEQYD----LVKQLFYGTTKQSIVPLSATNKVR 993
            QQD  E +   L Q+    +  R    NEQ +    +   +F G  K SIV     N  +
Sbjct: 241  QQDAHEFLQYFLNQLHQDYK--RDSSHNEQENNCPCVAHSIFQGELKSSIVCPECQNDSK 298

Query: 994  TKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYG--------DVIRTVAVTTFPT 1045
            T ++ F+ L ++I D   D+Y   DS+ K E L    Y         D I+   +   P 
Sbjct: 299  TIIDPFMDLSLDIKD-KTDLYQCLDSFHKKEKLHDFNYHCSRCNTSLDPIKQFTINKLPP 357

Query: 1046 ILQVQIQR----VYYDRERLMPFKSIEPLPFKEVIYMDRYADTENP 1087
            +L +Q++R    V     +L  F    PL      Y DR  + E P
Sbjct: 358  MLVLQLKRFEHFVNGTNVKLNEFVQY-PLYLNMRDYCDRNTNQETP 402

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 39.7 bits (91), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 73/170 (42%), Gaps = 22/170 (12%)

Query: 906  VSENEDTTGLTSPTRVAKISSDQLENAL-EMGRQQDVTECIGNVLFQ----IESGSEPIR 960
            ++EN   TG+ SPT   KI   + EN L     QQD  E +  +L      IE  +  ++
Sbjct: 393  ITENLSLTGIVSPTEFVKIL--KKENVLFNTMMQQDAHEFLNFLLNDFSEYIERRNSGMQ 450

Query: 961  Y----DEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINI-GDHPKDIYD 1015
            +    D  N   + +  LF GT    I  L+  N + ++ E FL   I + GD   DI  
Sbjct: 451  FGPKKDIVNANDNFIADLFKGTLTNRIKCLTCDN-ITSRDEPFLDFPIEVQGDDETDIQK 509

Query: 1016 AFDSYFKDEYLTM-------EEYG--DVIRTVAVTTFPTILQVQIQRVYY 1056
               SY + E L         + YG  +  R V +   P IL + ++R  Y
Sbjct: 510  ILRSYHQREMLNGVNKFYCNKCYGLQEAERIVGLKQLPYILSLHLKRFEY 559

 Score = 38.9 bits (89), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 22/35 (62%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTV 771
           G  N GNTCY NS+LQ  ++I+  R  VL Y + V
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRYPERV 161

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 36/92 (39%), Gaps = 6/92 (6%)

Query: 1168 MKLYNDI-NSLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNRNGIWRK 1225
            +KL+N I   L   +S  FD      Y L  V IH G    +GHY    K  N    W  
Sbjct: 567  IKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICK--NEKFGWLL 624

Query: 1226 YNDETISXXXXXX--XXXXXXGNTATPYFLVY 1255
            Y+DET+               G+  T Y L Y
Sbjct: 625  YDDETVESIREETVLKFTGHPGDQTTAYVLFY 656

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 39.7 bits (91), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLS 779
            G  N G TCYLNSLLQ Y+     RR V +     EN ND ++
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVYQIPTEGENPNDSVT 246

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 16/130 (12%)

Query: 971  VKQLFYGTTKQSIVPLSAT-NKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME 1029
            + +LF G  K  I  ++     VRT  E F  + +N+ +  +D+  +F++Y + E +  E
Sbjct: 309  INELFVGKMKSYIRCINVDYQSVRT--EDFWDIQLNVKNM-RDLQTSFENYIEVELMDGE 365

Query: 1030 -EYG-------DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVI----Y 1077
             +Y        D  + V   +FP +L +Q++R  YD       K  +   F + I    Y
Sbjct: 366  NQYAAQGHGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPY 425

Query: 1078 MDRYADTENP 1087
            MD  A  +NP
Sbjct: 426  MDSEALEQNP 435

 Score = 32.7 bits (73), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y L  V +H G+ S GHY+  IK   ++  W +++D+ +
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKDE-WYRFDDDRV 477

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780
           TG+ N+GNTCY+NS+LQ  F+    R   +   K  E FN + SN
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFRDLFVS-GKFEEFFNQNYSN 651

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y+L SV +H G  +YGHY  Y K R   G+W + +DE++
Sbjct: 689  YALRSVIVHYGTHNYGHYIAYRKFR---GVWWRISDESV 724

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQK 769
           G  N GNTCY NS+LQ  ++++ LR  +L++ K
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPK 173

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETIS 1232
            YSL SV +H G  +YGHY  + K R   G W + +DET+ 
Sbjct: 624  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVG 660

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y+L SV +H G  +YGHY  + K R   G+W + +DET+
Sbjct: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETV 713

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 644  YSLRSVIVHYGTHNYGHYIAFRKFR---GCWWRISDETV 679

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 39.3 bits (90), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDET 1230
            YSL SV +H G  +YGHY  + K R   G+W + +DET
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRKFR---GVWWRISDET 708

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 39.3 bits (90), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 22/41 (53%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFND 776
            G  N G TCYLNSLLQ YF     RR V +   + EN  D
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQENPKD 243

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 14/129 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYL---- 1026
            + ++F G  K S +     +    + E F  + +N+ +  K + D+F++Y + E +    
Sbjct: 309  LNEIFVGKMK-SFIKCINVDYESARTEDFWDIQMNVKNL-KGLKDSFENYIEVELMDGEN 366

Query: 1027 --TMEEYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVI----YM 1078
                ++YG  D  + V   +FP +L +Q++R  YD       K  +   F E I    YM
Sbjct: 367  QYAAQDYGLQDAKKGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYM 426

Query: 1079 DRYADTENP 1087
            D+     NP
Sbjct: 427  DKDVLEANP 435

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 682  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 717

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y+L SV +H G  +YGHY  + K R   G+W + +DET+
Sbjct: 679  YALRSVIVHYGTHNYGHYIAFRKFR---GLWWRISDETV 714

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 38.9 bits (89), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 681  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 716

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVE 772
           G+ N GNTCY NS+LQ  +++  LR  VL+Y    E
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKYPTRAE 135

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
            G  N G TCYLNSLLQ YF     RR V  YQ   EN
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV--YQIPTEN 228

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 51/97 (52%), Gaps = 10/97 (10%)

Query: 969  DLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTM 1028
            D + ++F G  K  I  ++   +  ++VE F  L +N+ +  KD+  +F++Y + E +  
Sbjct: 297  DKLNEIFVGRMKSYIKCINVDYE-SSRVEEFWDLQMNVKN-LKDLKSSFENYIEIELMNG 354

Query: 1029 E------EYG--DVIRTVAVTTFPTILQVQIQRVYYD 1057
            E      +YG  D  + V   +FP +L +Q++R  YD
Sbjct: 355  ENQYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 391

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 44/115 (38%), Gaps = 24/115 (20%)

Query: 1173 DINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETIS 1232
            D++S  +K+  +  +     Y L  V +H G+ S GHY+  IK    +  W +++DE + 
Sbjct: 411  DVSSYIDKMGTEDTEMPPCIYKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVW 469

Query: 1233 XXXXXXXXXXXXGNTATP-----------------------YFLVYVKQGQEGDI 1264
                        G    P                       Y LVY+++ QE D+
Sbjct: 470  KVTKTQVFDENFGLDRIPDDEVRLMSREQYQNYLLARHTSAYMLVYIREDQEADL 524

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 685  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 720

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRKYR---GYWWRISDETV 612

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 683  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 718

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDH 777
           G  N GNTCY NS+LQ  + +   R  VLEY +  E    H
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEYPEKPEEQERH 202

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
            G  N G TCYLNSLLQ YF     RR V  YQ   EN
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV--YQIPTEN 238

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 17/136 (12%)

Query: 970  LVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME 1029
            ++ ++F G  K S +     +   ++VE F  L +N+ +  K + ++FD+Y + E L  E
Sbjct: 308  MLNEIFVGKMK-SYIKCIDVDYESSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGE 365

Query: 1030 ------EYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRY 1081
                  +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +   
Sbjct: 366  NQYQAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDL--- 422

Query: 1082 ADTENPLLLAKKKETE 1097
                +P L   KKE E
Sbjct: 423  ----SPYLEDSKKEKE 434

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 1168 MKLYNDIN-SLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNRNGIWRK 1225
            +KL+N +N      IS  FDD     Y L S+ +H GE+   GHY    K ++    W  
Sbjct: 561  IKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCKHKSYG--WLI 618

Query: 1226 YNDETISXXXXXXXXXXXXG--NTATPYFLVY 1255
            Y+DET+                 +AT Y L Y
Sbjct: 619  YDDETVQAVSDELVSRILNNEQRSATAYLLFY 650

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++  LR  +LEY
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 67/172 (38%), Gaps = 21/172 (12%)

Query: 906  VSENEDTTGLTSPTRVAKISSDQ--LENALEMGRQQDVTECIGNVLFQIESG-----SEP 958
            ++EN+  TG+ SP    K+   +  L N++    QQD  E +  +L ++        S P
Sbjct: 391  ITENKSLTGVVSPVEFVKVLKKENILFNSM---MQQDAHEFLNFLLNELSEYLQNHISHP 447

Query: 959  IRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINI-GDHPKDIYDAF 1017
                 D    + V  LF G     I  L+  N + ++ E FL   I + GD   DI D  
Sbjct: 448  SNKPTDIPFKNYVIDLFQGVLTNRIKCLTCDN-ITSRDEPFLDFPIGVKGDENIDIQDVL 506

Query: 1018 DSYFKDEYLTMEE---------YGDVIRTVAVTTFPTILQVQIQRVYYDRER 1060
              Y   E L               +  R V +   P  L + ++R  Y  E+
Sbjct: 507  RCYHTREMLNGSNKFYCSQCCGLQEAERIVGLKQLPHTLALHLKRFKYSEEQ 558

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETIS 1232
            YSL SV +H G  +YGHY  + K R   G W + +DE+++
Sbjct: 687  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDESVT 723

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 720 LTGTIDPNSLP---PENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEY-QKTVE 772
           +  TI   S+P     N   G  N GNTCY NS+LQ  ++++ LR  +L++ +K +E
Sbjct: 122 ILATIASESMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPEKPIE 178

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K S +     +    +VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LSEIFVGKMK-SYIKCVNVDYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYA 1082
                 +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1083 DTE 1085
            D E
Sbjct: 429  DKE 431

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 37/97 (38%), Gaps = 24/97 (24%)

Query: 1191 YGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATP 1250
            Y Y+L  V +H G+ S GHY+  IK    +  W +++DE +             G    P
Sbjct: 447  YVYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLP 505

Query: 1251 -----------------------YFLVYVKQGQEGDI 1264
                                   Y LVY++Q QE D+
Sbjct: 506  DEKVRTMTREDYQNYIIQRHTSAYMLVYIRQEQEEDL 542

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           G++N+GNTCY+NS LQ    I  LR Y L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFL 352

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           TG+ N+GNTCY+NS+LQ  F  +  R   L
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL 617

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  F++   R  +L++
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQF 145

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  +   R   G W + +DET+
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAF---RRYRGYWWRISDETV 689

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 69/181 (38%), Gaps = 13/181 (7%)

Query: 1079 DRYADTENPLL--LAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLES 1136
            D    TE P L    + KE E +  +  +    QRELL+  D     +   L+  + L  
Sbjct: 449  DSITSTEEPFLDFAIEVKEDENLNIQRHLESFHQRELLNGSDKFYCDRCCGLQEAERLVG 508

Query: 1137 DTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDIN-SLEEKISHQFDDFKEYGYSL 1195
              +K+ P  +       K   + + NI     KL+N I+      +S  FD      Y L
Sbjct: 509  --LKRLPKTLSLHLKRFKYSEDKMANI-----KLFNKIDYPTFLTVSSTFDSKLSKRYEL 561

Query: 1196 FSVFIHRGEA-SYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPYFLV 1254
             S  IH G+   YGHY    K       W  ++DET+              N+ T Y L 
Sbjct: 562  ASAVIHLGDGPQYGHYISLCKTETFG--WLLFDDETVEAVDEQTVLSFTGENSDTAYVLF 619

Query: 1255 Y 1255
            Y
Sbjct: 620  Y 620

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ +F+ +  R  +L +
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSF 158

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  ++I  LR  V++Y
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766
            G  N G TCYLNSLLQ YF     RR V E
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYE 233

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 1173 DINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGI---WRKYNDE 1229
            D++   EK S Q  + +   Y+L  V +H G+ S GHY+  I    R G+   W +++D+
Sbjct: 421  DVSPYIEKGSEQLSNKEACIYNLHGVLVHAGDISTGHYYTMI----RPGVSDEWYRFDDD 476

Query: 1230 TI 1231
             +
Sbjct: 477  KV 478

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K  I  ++   +  ++VE F  L +N+ +  K + ++F +Y + E +  E 
Sbjct: 309  LNELFVGKMKSYIKCINVDYE-SSRVEDFWDLQLNVKNL-KGLEESFSNYIEIELMNGEN 366

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYD 1057
                 +YG  D  + V   +FP +L +Q++R  YD
Sbjct: 367  QYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 73/170 (42%), Gaps = 25/170 (14%)

Query: 938  QQDVTECIGNVLFQIESGSEPIR-YDEDNE--------QYDLVKQLFYGTTKQSIVPLSA 988
            QQD  E +  +L Q+    +  R  DED E         + +V   F GT + SIV    
Sbjct: 226  QQDAHEFLQFLLNQLHCDYKRERQVDEDKEVRSSSSQLCHCIVHSSFQGTLRSSIVCPEC 285

Query: 989  TNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYG--------DVIRTVAV 1040
             +  +T ++ FL L ++I    + +YD  DS+ + E L   +Y         D I+ + +
Sbjct: 286  QDDSKTMLDPFLDLSLDIKGQ-RTLYDCLDSFHRREQLHDFDYHCPRCQTSRDPIKQLTI 344

Query: 1041 TTFPTILQVQIQRVYYDRERLMPFKSI---EPLPFKEVIYMDRYADTENP 1087
                  L +Q++R     E L   +++   +P+ F   + M RY     P
Sbjct: 345  ERLAPTLVLQLKRF----EHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEP 390

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 23/44 (52%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLS 779
            G  N G TCYLNSLLQ YF     R  V +     EN ND ++
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLVYQIPTADENPNDSVA 302

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 12/109 (11%)

Query: 994  TKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME------EYG--DVIRTVAVTTFPT 1045
            ++VE F  + +N+    + + +AF++Y + E +  E      +YG  D  + V   +FP 
Sbjct: 387  SRVEDFWDIQLNVKG-LEGLANAFENYIEVELMDGENQYAAQDYGLQDAKKGVVFESFPE 445

Query: 1046 ILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKK 1094
            +L +Q++R  YD       K  +   F E I +  Y D E   +L K+K
Sbjct: 446  VLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKE---VLKKQK 491

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y+L  V +H G+ S GHY+  IK    +  W +++DE +
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTDDK-WYRFDDEKV 533

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N L P +   G+ N+G+TC++NS+LQ    I  LR Y L
Sbjct: 342 NRLSPSSGTMGLANLGSTCHINSVLQCLTHITELRDYFL 380

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 74/174 (42%), Gaps = 22/174 (12%)

Query: 906  VSENEDTTGLTSPTRVAKISSDQLENAL-EMGRQQDVTECIGNVL------FQIESGSEP 958
            ++EN   TG+ SPT   KI   + EN L     QQD  E +  +L       +  + S  
Sbjct: 404  ITENLALTGIVSPTEFVKIL--KKENVLFNTMMQQDAHEFLNFLLNDSSEYIECHTSSVN 461

Query: 959  IRYDED-NEQYD-LVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINI-GDHPKDIYD 1015
            I   E+ N   D  +  LF GT    I  L+  N + ++ E FL   I + GD   DI  
Sbjct: 462  IVPQENMNGTSDNFITDLFKGTLTNRIKCLTCDN-ITSRDEPFLDFPIEVQGDDETDIQK 520

Query: 1016 AFDSYFKDEYLTM-------EEYG--DVIRTVAVTTFPTILQVQIQRVYYDRER 1060
               SY + E L         + YG  +  R V +   P IL + ++R  Y  E+
Sbjct: 521  ILKSYHQREMLNGVNKFYCNKCYGLQEAERIVGLKQVPYILSLHLKRFKYSEEQ 574

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTV 771
           G  N GNTCY NS+LQ  ++I   R  VL Y + +
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERI 171

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 37/95 (38%), Gaps = 6/95 (6%)

Query: 1165 NELMKLYNDIN-SLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNRNGI 1222
            N  +KL+N I   L   +S  FD      Y L  V IH G    +GHY    K  N    
Sbjct: 575  NSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICK--NEKFG 632

Query: 1223 WRKYNDETISXXXXXX--XXXXXXGNTATPYFLVY 1255
            W  Y+DET+               G+  T Y L Y
Sbjct: 633  WLLYDDETVESVSEETVLKFTGHSGDQTTAYVLFY 667

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 736  TGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
            TG+ N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N L P    TG+ N+GNTCY+NS LQ    I   R Y L
Sbjct: 312 NDLVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFL 350

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL--EYQKTVENFND-HLSN 780
           +G+ N+GNTCY+NS+LQ  F+    R   L   Y++ +    D HLSN
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSN 493

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS+LQ  F+    R
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFR 581

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  ++I   R  +L+Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 71/177 (40%), Gaps = 28/177 (15%)

Query: 906  VSENEDTTGLTSPTRVAKISSDQLENAL-EMGRQQDVTECIGNVLFQIESGSEPIRYDED 964
            ++EN   TG+ SPT   KI   + EN L     QQD  E +    F +   SE I   + 
Sbjct: 399  ITENLSLTGIVSPTEFVKIL--KKENVLFNTMMQQDAHEFLN---FLLNDFSEYIECHDP 453

Query: 965  NEQYDLVKQ-----------LFYGTTKQSIVPLSATNKVRTKVERFLSLLINI-GDHPKD 1012
               +   K            LF GT    I  L+  N + ++ E FL   I + GD   D
Sbjct: 454  RVNFGPQKNINNISNNFITDLFKGTLTNRIKCLTCDN-ITSRDEPFLDFPIEVQGDDDTD 512

Query: 1013 IYDAFDSYFKDEYLTM-------EEYG--DVIRTVAVTTFPTILQVQIQRVYYDRER 1060
            I     SY + E L         + YG  +  R V +   P IL + ++R  Y  E+
Sbjct: 513  IQRILKSYHQREMLNGINKFYCNKCYGLQEAERIVGLKQLPYILSLHLKRFKYSEEQ 569

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 36/92 (39%), Gaps = 6/92 (6%)

Query: 1168 MKLYNDI-NSLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNRNGIWRK 1225
            +KL+N I   L   +S  FD      Y L  V IH G    +GHY    K  N    W  
Sbjct: 573  IKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICK--NEKFGWLL 630

Query: 1226 YNDETISXXXXXXXXXXXX--GNTATPYFLVY 1255
            Y+DET+               G+  T Y L Y
Sbjct: 631  YDDETVESIREETVLQFTGHPGDQTTAYVLFY 662

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 21/41 (51%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFND 776
            G  N G TCYLNSLLQ YF     R+ V       EN ND
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIPTNGENPND 244

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K S +     +   ++VE F  + +N+ +  K + ++F++Y + E +  E 
Sbjct: 310  LNEIFVGKMK-SYIRCKNVDYESSRVEDFWDIQLNVKNF-KSLQESFENYIEVELMNGEN 367

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYD 1057
                 ++G  D  + V   +FP +L +Q++R  YD
Sbjct: 368  QYAAPDFGLQDAYKGVVFESFPAVLHLQLKRFEYD 402

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
            G  N G TCYLNSLLQ YF     R+ V  YQ   EN
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV--YQIPTEN 242

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K  I  ++   +  ++VE F  L +N+ +  K + ++F +Y + E +  E 
Sbjct: 313  LNELFVGKMKSYIKCINVDYE-SSRVEDFWDLQLNVKNL-KGLEESFKNYIEIELMNGEN 370

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVI----YM 1078
                 ++G  D  + V   +FP IL +Q++R  YD       K  +   F E I    YM
Sbjct: 371  QYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYM 430

Query: 1079 DRYADTEN 1086
            D+ A  EN
Sbjct: 431  DKKALREN 438

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQDQ-WYRFDDEKV 481

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 16/75 (21%)

Query: 706 ISIERNSTLITNFLLTGTIDPN--SLPPENWPT-----------GINNIGNTCYLNSLLQ 752
           I+ ER++++I       TID N  +L P   P            G  N GNTCY NS+LQ
Sbjct: 476 INTERSASIIPTIT---TIDHNHSALQPRTNPLIPFGDGSNKVFGYENFGNTCYCNSVLQ 532

Query: 753 YYFSIAPLRRYVLEY 767
             +++  LR  +L++
Sbjct: 533 CLYNMTNLRTNILQF 547

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 20/129 (15%)

Query: 970  LVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME 1029
            L+  +F G  K SIV     +  +T  + ++ L ++I D    +Y   DS+ K E  T+ 
Sbjct: 251  LIHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDIKD-KATLYQCLDSFHKKE--TLH 307

Query: 1030 EYG----------DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEV---I 1076
            +Y           D I+ + +   P +L +Q++R     E L   ++++   F E    +
Sbjct: 308  DYNYHCPNCDTMQDPIKQLTIDKLPPVLVLQLKRF----EHLNNGQNVKLNAFIEFPTYL 363

Query: 1077 YMDRYADTE 1085
             M +Y  TE
Sbjct: 364  NMKKYCHTE 372

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            YSL SV +H G  +YGHY  +   R   G W + +DE++
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAF---RRYRGCWWRISDESV 709

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 709 ERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL--E 766
           +++S   +NFL+      N+L       G+ N+GNTCY+NS LQ    I   R Y L   
Sbjct: 308 QKSSHWPSNFLIY-----NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGT 362

Query: 767 YQKTVENFN 775
           +QK V   N
Sbjct: 363 FQKEVNEGN 371

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 5/63 (7%)

Query: 697 LILRAALTKISIERNSTLITNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQY 753
           L     LT++ +E+N  L  +F +T +     +   P  N+  G+ N+GN+CYLNS+LQ 
Sbjct: 279 LATEKTLTELQVEQN--LNWDFKMTDSAGHELIKLEPNGNFGCGLINLGNSCYLNSILQA 336

Query: 754 YFS 756
            F+
Sbjct: 337 LFA 339

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 21/41 (51%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFND 776
            G  N G TCYLNSLLQ YF     R+ V E     E  ND
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTDEEKPND 249

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 66/141 (46%), Gaps = 13/141 (9%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K S +     +   ++VE F  + +N+ D  K++  +F++Y + E +  E 
Sbjct: 315  LSELFVGKMK-SYIKCKNVDYESSRVEEFWDIQLNVKD-LKNLQQSFENYIEVELMDGEN 372

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYA 1082
                 ++G  D  + V   +FP +L +Q++R  YD       K  +   F + I +  Y 
Sbjct: 373  QYAAPDFGLQDAYKGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYL 432

Query: 1083 DTENPLLLAKKKETEEMKQKL 1103
            D +   +L  + ETE    KL
Sbjct: 433  DKD---VLKNENETESHIYKL 450

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y L SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 672  YELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETV 707

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 10/121 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYL---- 1026
            + +LF G  K  I  ++   +  ++VE F  + +N+ +  K + ++FD+Y + E +    
Sbjct: 308  LNELFVGKMKSYIRCINVDYE-SSRVEDFWDIQLNVKN-LKGVQESFDNYVEVEIMDGEN 365

Query: 1027 --TMEEYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYA 1082
                ++YG  D  + V   +FP++L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 366  QYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYL 425

Query: 1083 D 1083
            D
Sbjct: 426  D 426

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 23/40 (57%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFND 776
           G+ N G TCYLNSLLQ YF     R+ V +     E+ ND
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIVYKIPSENESPND 242

 Score = 32.7 bits (73), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y+L  V +H GE S GHY+  IK  +    W +++D+ +
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKP-DVGDQWFRFDDDKV 476

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 60/123 (48%), Gaps = 10/123 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K  I  ++   +  ++VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LNEIFVGRMKSYIKCINVDYE-SSRVEDFWDLQMNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYA 1082
                 +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFV 428

Query: 1083 DTE 1085
            D +
Sbjct: 429  DKD 431

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 39/102 (38%), Gaps = 24/102 (23%)

Query: 1186 DDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXG 1245
            D+   Y Y+L  V +H G+ S GHY+  IK    +  W +++DE +             G
Sbjct: 441  DNGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFG 499

Query: 1246 NTATP-----------------------YFLVYVKQGQEGDI 1264
                P                       Y LVY++Q QE D+
Sbjct: 500  CDRLPDEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL 541

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++   R  VL+Y
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y L SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 658  YVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 693

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 722 GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYV 764
           G +D ++L    +  G+ N GNTC++NS++Q   S A L +++
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY++S+LQ  F+   LR
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLR 650

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS+LQ  F+    R
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFR 633

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 9/124 (7%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K  I  ++   +  ++VE F  + +N+ D  K++ ++F+ Y + E +  E 
Sbjct: 303  INELFVGKMKSCIKCINVDYE-SSRVEDFWDIQLNVKDM-KNLQESFEQYIEVELMNGEN 360

Query: 1030 -----EYG-DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYAD 1083
                 ++G    + V   +FP +L +Q++R  YD       K  +   F E I +  Y D
Sbjct: 361  QYAAQDHGLQDAQKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLD 420

Query: 1084 TENP 1087
            +  P
Sbjct: 421  SAAP 424

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFN 775
            G  N G TCYLNSLLQ Y      R+ V  YQ   E+ N
Sbjct: 197 VGFKNQGATCYLNSLLQSYHFTKLFRKLV--YQIPTEDEN 234

 Score = 32.7 bits (73), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y L  V +H G+ S GHY+  I+  + +G W +++D+ +
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQP-DAHGSWYRFDDDRV 468

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 45/115 (39%), Gaps = 24/115 (20%)

Query: 1173 DINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETIS 1232
            D + L++ +  +  D   Y Y+L  V +H G+ S GHY+  IK    +  W +++DE + 
Sbjct: 429  DKDVLKKTLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVW 487

Query: 1233 XXXXXXXXXXXXGNTATP-----------------------YFLVYVKQGQEGDI 1264
                        G    P                       Y LVY++Q QE D+
Sbjct: 488  RVTKKQVFQENFGCDRLPDEKVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDL 542

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K  I  ++   +   +VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LNEIFVGKMKSYIKCINVDYE-SARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYA 1082
                 +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1083 DTE 1085
            D +
Sbjct: 429  DKD 431

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766
            G  N G TCYLNSLLQ YF     R+ V E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 37/97 (38%), Gaps = 24/97 (24%)

Query: 1191 YGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATP 1250
            Y Y+L  V +H G+ S GHY+  IK    +  W +++DE +             G    P
Sbjct: 447  YIYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLP 505

Query: 1251 -----------------------YFLVYVKQGQEGDI 1264
                                   Y LVY++Q QE D+
Sbjct: 506  DEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL 542

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + ++F G  K  I  ++   +   +VE F  L +N+ +  +++  +FD+Y + E +  E 
Sbjct: 311  LNEIFVGKMKSYIKCINVDYE-SARVEDFWDLQLNVKNF-ENLQGSFDNYIEMELMNGEN 368

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYA 1082
                 +YG  D  + V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1083 DTE 1085
            D +
Sbjct: 429  DKD 431

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  ++++ +R  +L++
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQF 172

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++  LR  +LE+
Sbjct: 144 GYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 733 NWPTGI---NNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           N P+GI   +N+GNTCY+NS LQ    I  L  Y L
Sbjct: 333 NAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFL 368

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           GI N+GNTCY+NS+LQ  F     R   L
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRDLFL 242

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVL--EYQKTV 771
           G++N+GNTCY+NS LQ    I   + Y L   Y+K V
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEV 383

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFR 634

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS+LQ  F+    R
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFR 703

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 36.6 bits (83), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++   R  +L+Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 36.2 bits (82), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL--EYQKTV 771
           N L P     G+ N+GNTCY+NS LQ    +     Y L   YQK +
Sbjct: 405 NYLVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEI 451

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++   R  +L+Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 72/171 (42%), Gaps = 19/171 (11%)

Query: 906  VSENEDTTGLTSPTRVAKISSDQLENAL-EMGRQQDVTECIGNVLFQIESGSEPIRYDED 964
            ++E+   TG+ SP +   +   + EN L +    QD  E +    F +   S+  R D D
Sbjct: 378  ITEHSSLTGIVSPVQFVNML--RRENVLFDSMMHQDAHEFLN---FMLNDFSD--RLDRD 430

Query: 965  NEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHP-KDIYDAFDSYFKD 1023
            N+  + + ++F GT    +  L+  N V ++ E FL L I + ++   DI      Y + 
Sbjct: 431  NQAKNFINEIFQGTLTNKVRCLTCDN-VTSREEAFLDLPIEVKENGDTDIQRVLKYYSQR 489

Query: 1024 EYLTMEE---------YGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFK 1065
            E L               +  R V +   P  L + ++R  Y  ++L   K
Sbjct: 490  EMLNGSNKFNCSQCCALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIK 540

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 703 LTKISIERNSTLITNFLLTGTIDPNSLPP-ENWPTGINNIGNTCYLNSLLQYYFSIA 758
           L ++ +E+N       + +   +   LP  + +  G+NN+GN+CY+NS+LQ  F+ A
Sbjct: 279 LVELQVEQNMNWDFQMVDSKGNELKHLPASKEYGCGLNNLGNSCYMNSVLQVLFNGA 335

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627

>Kpol_397.9 s397 complement(27399..28373,28377..28877) [1476 bp, 491
           aa] {ON} complement(27399..28373,28377..28877) [1476 nt,
           492 aa]
          Length = 491

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 153 FQAVIFNPSLAEQQISTFDDIVKIPIYHLKVSVKV-RQELERLKKHVGVTQFHSLDHLHE 211
           FQ VIFNP+ +  + ++F D VK    H+K  VKV  QE     + V   Q  SLD   E
Sbjct: 324 FQRVIFNPNNSMGK-NSFLDSVKNKFEHVKNRVKVMEQEEAENGEGVETIQLKSLDDSTE 382

Query: 212 YDRVDLSTFDSSDP 225
            + ++L  F SSDP
Sbjct: 383 LE-INLPDFSSSDP 395

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           TG+ N+ NTCY+NS+LQ  FS    R   L
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 35.8 bits (81), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y L  +  HRG  + GHY  Y K    +G+W ++ND  +
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTK--TADGVWYQFNDSVV 459

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++   R  +LEY
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEY 203

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 6/97 (6%)

Query: 1163 IDNELMKLYNDIN-SLEEKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNRN 1220
            + N  +KL+N +   L   ++  FD   E  Y L  V IH G +  +GHY    K  N  
Sbjct: 661  VKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCK--NDK 718

Query: 1221 GIWRKYNDETISXXXXXXXXXXXX--GNTATPYFLVY 1255
              W  ++DET+                N AT Y L Y
Sbjct: 719  FGWLLFDDETVESVSESTVLEFTGDPNNQATAYVLFY 755

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
            G++N+GNTCY+NS LQ    I  LR Y  
Sbjct: 289 VGLSNLGNTCYMNSGLQCLVHIPKLRDYFF 318

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           TG+ NIG TCY+NS+LQ  F+    R   L
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 35.8 bits (81), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766
            G  N G TCYLNSLLQ YF     R+ V +
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVYQ 236

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           G++N+GNTCY+NS LQ    I  +R Y +
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFV 350

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYV 764
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 971  VKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTME- 1029
            + +LF G  K  I  ++   +  ++VE F  L +N+ +  K + D+F++Y + E +  E 
Sbjct: 307  LSELFVGKMKSYIKCVNVEYE-SSRVEDFWDLQLNVKNL-KCLKDSFENYIEIELMNGEN 364

Query: 1030 -----EYG--DVIRTVAVTTFPTILQVQIQRVYYD 1057
                 ++G  D  + V   +FP IL +Q++R  YD
Sbjct: 365  QYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYD 399

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+G+TCY+NS+LQ  F+    R
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFR 638

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 8/66 (12%)

Query: 1193 YSLFSVFIHRGEA-SYGHYWIYIKDRNRNGIWRKYNDETISXXXXXXXXXXXXGNTATPY 1251
            Y L SV +H G + S GHY  +   R  +G W  Y+DE I+                  Y
Sbjct: 761  YQLLSVVVHEGRSLSSGHYIAHC--RQPDGTWATYDDELINKISELKLLTEPNA-----Y 813

Query: 1252 FLVYVK 1257
            +LVY +
Sbjct: 814  YLVYTR 819

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVE 772
           G+ N GNTCY NS+LQ  +++   R  +L    +++
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILGLTPSID 167

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 16/124 (12%)

Query: 973  QLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYG 1032
            ++F G  K SIV     +  +T +E F+ L ++I      +Y+  +S+ K E L   +Y 
Sbjct: 275  KVFQGFLKSSIVCPECNSDAKTTIEPFMDLSLDIKG-KNTLYECLNSFHKKEQLHDFDYH 333

Query: 1033 --------DVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSI---EPLPFKEVIYMDRY 1081
                    D  + +AV     +L  Q +R     E L+   SI   + + F   + M  Y
Sbjct: 334  CKNCNTSQDPTKQLAVAKLSPVLLFQFKRF----EHLLSGSSIKLNDVIEFPLYLNMKDY 389

Query: 1082 ADTE 1085
             D E
Sbjct: 390  CDVE 393

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  ++ + LR  ++ Y
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILY 158

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766
            G+ N G TCYLNSLLQ Y+     R+ V +
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLVYQ 220

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++   R  +L++
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFRIQMLQH 162

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYV 764
            G+ N G TCYLNSLLQ Y+     R+ V
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 227

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N GNTCY NS+LQ  +++   R  +L++
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLLQH 155

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y L SV +H G  +YGHY  +   R   G W + +DE++
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAF---RRFRGCWWRISDESV 716

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEY 767
           G  N G+TCY NS+LQ  +++   R+ +L++
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQF 152

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETIS 1232
            Y L S+  H+G  + GHY + +K    +G W K+ND  +S
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVKV--NDGQWFKFNDSMVS 470

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N  NTCY+NS++Q  F   P R
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFR 317

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+G TCY+NS+LQ  F+    R
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFR 624

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 681 FKQKWFDENVYEPDQFL--ILRAALTKISIERNSTLITNFLLT------GTIDPNSLPPE 732
           + + W +  +    Q L  I   AL  +S+   S  + N+LL+      G+  P  L  +
Sbjct: 15  YNRTWLELFLQRKGQLLRKITYTALLGLSLYVISPTVVNYLLSVLGLEKGSKGPKRL--D 72

Query: 733 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYV---LEYQKTVENFNDH 777
            + TG+ N GN C++NS +Q    +  L  Y+   LE +KT      H
Sbjct: 73  KFTTGLVNPGNDCFINSSIQALVPLDKLTTYLSATLEDEKTASTLPLH 120

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 14/67 (20%)

Query: 709 ERNSTLIT---NFLLT--GTIDPNSLP----PENWP-----TGINNIGNTCYLNSLLQYY 754
           +R+STL+T   +F+L     I  +++P     +N P      G+ N GNTCY+NS++Q  
Sbjct: 197 KRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCL 256

Query: 755 FSIAPLR 761
           F    LR
Sbjct: 257 FGTKVLR 263

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766
           G+ N+GN+CYLNS+LQ   +   L R+ LE
Sbjct: 310 GLQNLGNSCYLNSVLQVLLN-GDLSRWSLE 338

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%)

Query: 712 STLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765
           STLI       T+  N +   ++  G+ N+GN+CY+N ++Q  F+   L +  L
Sbjct: 501 STLIRKNSPEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFL 554

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%)

Query: 729 LPPENWPTGINNIGNTCYLNSLLQ 752
           LP +++  G+ N+GN+CYLNS+LQ
Sbjct: 316 LPNKDYGCGLINLGNSCYLNSVLQ 339

>TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3.115
            YOL087C
          Length = 1122

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 13/84 (15%)

Query: 1030 EYGDVIRTVAVTTFPTILQVQIQ---RVYYDRERLMPFKSIEPLPFKEVIYMDRYADTEN 1086
            EY +    V  T F TIL  Q++   ++Y + ER +PF         +++++D     ++
Sbjct: 878  EYIESAIPVNQTIFKTILPKQVKENYQLYRNLERFLPFW------LSKILFIDDTIKNKD 931

Query: 1087 PLLLAKKKETEEMKQKLKVMKNRQ 1110
            PLL+ KKK T    +K    KN+Q
Sbjct: 932  PLLVPKKKITNSSYKK----KNQQ 951

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 29/130 (22%)

Query: 624 ALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQ 683
           A+   ++S  + DL+ +  ++  +F     P+ ++   ALK+  +N            ++
Sbjct: 238 AIKLGSLSSSTCDLYCYACDDETRF-----PDNVNLGSALKIYGIN-----------IQE 281

Query: 684 KWFDENVYEPDQFLILRAALTKISIERNSTLITNFLLTGTIDPNSLPPEN-WPTGINNIG 742
           K  DE              L ++ IE+N       + +   +   LP  N +  G+ N+G
Sbjct: 282 KIADEKT------------LVQLQIEQNENWQFKMVDSSGKELKKLPASNEYGCGLINLG 329

Query: 743 NTCYLNSLLQ 752
           N+CYLNS++Q
Sbjct: 330 NSCYLNSVMQ 339

>KAFR0J02900 Chr10 (552553..553698) [1146 bp, 381 aa] {ON} Anc_3.570
           YGL246C
          Length = 381

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 52/130 (40%), Gaps = 19/130 (14%)

Query: 286 SQVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGN--LALNTHLNPEWLTS--------KYG 335
           S++DC +      K  L   +K   T TI+S +  L    ++   WL+          YG
Sbjct: 213 SEIDCIFDFKTDGKDNLKHYTKLACTSTINSSSETLKFENNIFRTWLSCFVVGIQRVIYG 272

Query: 336 FQASSEIDEETNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPN 395
           F+  + I +   E  T+ +P  +         ++       KCL  I W  L T  L   
Sbjct: 273 FKDKNSILKTVEEFATDEIPVIL---------KQNNSKVSAKCLDAIKWYGLFTEWLLKM 323

Query: 396 SPLKNTKSVK 405
            P  +TKSV+
Sbjct: 324 IPRDDTKSVR 333

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQK 769
           G  N GNTCY NS+LQ  F +   R  +L++ +
Sbjct: 123 GYENFGNTCYCNSILQCLFFLDDFRIDILKHPR 155

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 697 LILRAALTKISIERNSTLITNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQY 753
           L     L ++ +E+N  +  +F +T +   + L   P +    G+ N+GN+CYLNS+LQ 
Sbjct: 283 LASEKTLVELQVEQN--MNWDFQMTDSAGKDLLKLKPDQEHGCGLINLGNSCYLNSVLQC 340

Query: 754 YFS 756
            F+
Sbjct: 341 LFN 343

>KLTH0G11330g Chr7 complement(956495..958000) [1506 bp, 501 aa] {ON}
           similar to uniprot|P06101 Saccharomyces cerevisiae
           YDR168W CDC37 Essential Hsp90p co-chaperone necessary
           for passage through the START phase of the cell cycle
          Length = 501

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 153 FQAVIFNPSLAEQQISTFDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEY 212
           F  V +N S   Q   +F D V+    H+K  VKV Q+ E  ++ V   Q  SLD   E 
Sbjct: 320 FLKVFYNRS-NNQGKKSFLDSVQAKFEHVKKRVKVMQQ-EEPQEGVETIQLKSLDDSTEL 377

Query: 213 DRVDLSTFDSSDP 225
            +V+L  FDS DP
Sbjct: 378 -QVNLPNFDSKDP 389

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 1186 DDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETIS 1232
            DD  +  + L  +  HRG  + GHY  + K     G W K+ND  +S
Sbjct: 398  DDVPDIIFELIGIIAHRGTVNEGHYIAFTKV--TTGHWFKFNDSMVS 442

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 9/87 (10%)

Query: 975  FYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYG-- 1032
            F G+ K SIV        +T  + F+ L ++I D   ++Y+  DS+ K E L    Y   
Sbjct: 282  FQGSLKSSIVCPECKMDSKTTKDPFMDLSLDIKD-KSNLYECLDSFHKMEQLHDFNYHCD 340

Query: 1033 ------DVIRTVAVTTFPTILQVQIQR 1053
                  + I+ + +   P +L +Q++R
Sbjct: 341  RCNTTQNAIKRLIIHKLPAVLVLQLKR 367

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL--EYQKTVEN 773
           TG+ N  NTCY+NS++Q  FS    R   L  +Y+  +EN
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLEN 335

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETI 1231
            Y L +V IH G  +YGHY  Y K  N+   W + +DE++
Sbjct: 422  YDLKAVIIHYGTHNYGHYISYRKFMNQ---WWRISDESV 457

>Smik_6.129 Chr6 complement(208819..209709) [891 bp, 296 aa] {ON}
           YGR044C (REAL)
          Length = 296

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 50/119 (42%), Gaps = 13/119 (10%)

Query: 817 TRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKET---TDDAFTTK-- 871
           T E CVTPS+E    +   SN  +   +E    V    +  DSK+     TD  F  +  
Sbjct: 37  TEENCVTPSEEC--FSLHSSNNCLPGSLESTATVTSENLEHDSKRNPPFETDTTFELQLD 94

Query: 872 -IKDTS-----LIDLEMEDGLNGDVGTDANRKKNESNDAEVSENEDTTGLTSPTRVAKI 924
            IKD +     L+DL   D +N    T+ N      N  E  +++    L   + VA++
Sbjct: 95  EIKDDARCTMPLVDLGFRDIINCKTQTEVNHALIRGNGEEKVDSQYILTLPQSSHVAQL 153

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 725 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR 761
           D N L  E   TG+ N  NTCY+NS++Q  F     R
Sbjct: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFR 323

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 21/25 (84%)

Query: 732 ENWPTGINNIGNTCYLNSLLQYYFS 756
           +++  G+ N+GN+CYLNS+LQ +++
Sbjct: 322 DDFGVGLINLGNSCYLNSILQCFYN 346

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 32.3 bits (72), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 17/130 (13%)

Query: 970  LVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYL--- 1026
            +V   F G+ K SIV     N  +T  + F+ L + I D    + +  D++ K E L   
Sbjct: 269  VVHSSFQGSLKSSIVCPECNNDSKTTFDPFIDLSLGIKD-KHTLTECLDNFHKKEQLHDY 327

Query: 1027 -----TMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPF---KSIEPLPFKEVIYM 1078
                   +   + I+   +   P +L +Q++R     E LM     K  + + F +++ M
Sbjct: 328  DFFCKKCQAQQNPIKQFTINKLPPVLVLQLKRF----EHLMSGVNQKLNDYIEFPKILDM 383

Query: 1079 DRY-ADTENP 1087
              Y  D +NP
Sbjct: 384  KPYLKDNQNP 393

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 1168 MKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYN 1227
            MK Y  I   E+ I ++     +  Y L  +  H+G  + GHY  + K     G W K+N
Sbjct: 388  MKSYCSIRESEKHIGNK--KVPDIIYELIGIVSHKGTVNEGHYIAFCKI--SGGQWFKFN 443

Query: 1228 DETIS 1232
            D  +S
Sbjct: 444  DSMVS 448

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 32.3 bits (72), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 733 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL--EYQKTVENFNDHLSN 780
           N+  G+ N+GN+CY+N +LQ       L +  L   Y+K + N N  L +
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHI-NINSKLGS 628

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,816,361
Number of extensions: 6678427
Number of successful extensions: 29636
Number of sequences better than 10.0: 389
Number of HSP's gapped: 30762
Number of HSP's successfully gapped: 480
Length of query: 1272
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1151
Effective length of database: 39,606,813
Effective search space: 45587441763
Effective search space used: 45587441763
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)