Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR123C (LEO1)5.440ON46446415720.0
Smik_15.3005.440ON46337613860.0
Suva_8.1755.440ON45336813490.0
Skud_15.2855.440ON48737013400.0
CAGL0K10230g5.440ON4462729211e-120
TDEL0D026105.440ON4402899081e-118
NCAS0H020805.440ON4352748601e-111
ZYRO0F10164g5.440ON4232358561e-110
SAKL0G02662g5.440ON4793698561e-109
KNAG0B042105.440ON4632288501e-109
NDAI0C015905.440ON4702178281e-105
KAFR0D050505.440ON4192228221e-105
Kpol_1062.265.440ON4572338101e-103
KLLA0E02311g5.440ON4172377735e-98
TPHA0E017305.440ON4692277742e-97
KLTH0F15928g5.440ON4232297529e-95
Kwal_55.214085.440ON4362207512e-94
ACL167C5.440ON4392327338e-92
Ecym_45115.440ON4612257322e-91
TBLA0A064905.440ON4282437259e-91
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR123C
         (464 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   610   0.0  
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   538   0.0  
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   524   0.0  
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   520   0.0  
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   359   e-120
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   354   e-118
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   335   e-111
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   334   e-110
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   334   e-109
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   332   e-109
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   323   e-105
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   321   e-105
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   316   e-103
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   302   5e-98
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   302   2e-97
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   294   9e-95
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   293   2e-94
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   286   8e-92
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   286   2e-91
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   283   9e-91

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/464 (68%), Positives = 316/464 (68%)

Query: 1   MSSESPQDQPQKEQIXXXXXXXXXXXXXXXXXXXQDDNVKEVNGNXXXXXXXXXXXXXXX 60
           MSSESPQDQPQKEQI                   QDDNVKEVNGN               
Sbjct: 1   MSSESPQDQPQKEQISNNVGVTTNSTSNEETSRSQDDNVKEVNGNDDTKEEEQEEDAELD 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNINHRSRHRESLGLDDDEAEEQAMYT 120
                                             NINHRSRHRESLGLDDDEAEEQAMYT
Sbjct: 61  DLFGDDNDDDDDDDVKKSETEKSDSDSDEDDEGENINHRSRHRESLGLDDDEAEEQAMYT 120

Query: 121 RKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPNFLTID 180
           RKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPNFLTID
Sbjct: 121 RKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPNFLTID 180

Query: 181 PIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQW 240
           PIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQW
Sbjct: 181 PIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQW 240

Query: 241 SDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIH 300
           SDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIH
Sbjct: 241 SDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIH 300

Query: 301 QKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELEXXXXXXXXXXXXXXXXXXXXXXXPD 360
           QKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE                       PD
Sbjct: 301 QKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRRRQLKEKEKQESPD 360

Query: 361 AAFETGFRKQNSPTTYGASRRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           AAFETGFRKQNSPTTYGASRRN                                      
Sbjct: 361 AAFETGFRKQNSPTTYGASRRNEYEEDDFLVDDDEEEEAAFDDEEDDNEEEEEEEDADEE 420

Query: 421 XXSRLRNLKREGAAMYXXXXXXXXXXXXXXXXXVAVIEDDEDED 464
             SRLRNLKREGAAMY                 VAVIEDDEDED
Sbjct: 421 NASRLRNLKREGAAMYREEEEEEKDRSETKRRRVAVIEDDEDED 464

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/376 (72%), Positives = 282/376 (75%), Gaps = 9/376 (2%)

Query: 96  INHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPS 155
           +NHRSRHRESLGLDDDEAEEQAMYTRKFYGED N+FSDQDE THTFKEENVELVRHIIPS
Sbjct: 90  VNHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPS 149

Query: 156 KANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDEN 215
           K  VNETASHNEIFYARIPNFLTIDP+PFDPPSFEAKVNER SNSAS+EDQLDDRLIDEN
Sbjct: 150 KGIVNETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDEN 209

Query: 216 TVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQEL 275
           TVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQEL
Sbjct: 210 TVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQEL 269

Query: 276 IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
           IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQ+KGPGTYIVSMDPEVEK+ELE
Sbjct: 270 IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELE 329

Query: 336 XXXXXXXXXXXXXXXXXXXXXXXPDAAFETGFRKQNSPTTYGASRRNX-------XXXXX 388
                                  PDAAFETGFRKQ+SPT YG SRRN             
Sbjct: 330 KKQSQILRDRRRRQLKEKEKQESPDAAFETGFRKQSSPTAYGTSRRNEYEEDDFLVDDDE 389

Query: 389 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRLRNLKREGAAMYXXXXXXXXXXXX 448
                                             +RLR+LK+EGAAMY            
Sbjct: 390 EEEAEFDDDDDNEEEEEEEEEEEEEEEDADEANAARLRSLKKEGAAMY--RQEENEDNNE 447

Query: 449 XXXXXVAVIEDDEDED 464
                VAVIEDDE+ED
Sbjct: 448 TKRRRVAVIEDDEEED 463

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/368 (71%), Positives = 278/368 (75%), Gaps = 3/368 (0%)

Query: 97  NHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSK 156
           NHR  HRESLGLDDDEAEEQAMYTRKFYGEDAN+FSDQDE THTFKEENVELVRHIIPSK
Sbjct: 89  NHRDHHRESLGLDDDEAEEQAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSK 148

Query: 157 ANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENT 216
           ANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERA+NS S+EDQLDDRLIDENT
Sbjct: 149 ANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENT 208

Query: 217 VRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELI 276
           VRWRYSRD DQHVFKESNTQIVQWSDG+YSLKVGEE TDILVNDTSNTFLTVSHDQQEL+
Sbjct: 209 VRWRYSRDNDQHVFKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELM 268

Query: 277 QCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELEX 336
           QCYEGGEIKKTLMFIPTST+SKIHQKLSKAV+R+NQRQ++GPGTYI++MDPEVEK+ELE 
Sbjct: 269 QCYEGGEIKKTLMFIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEK 328

Query: 337 XXXXXXXXXXXXXXXXXXXXXXPDAAFETGFRKQNSPTTYGASRRNXXXXXXXXXXXXXX 396
                                 PD  FET FRKQ+SPT YGA+RRN              
Sbjct: 329 KQSQILRDRRKRQLKEKEKQESPDVGFETAFRKQSSPTAYGATRRN--EYEEDDFLVDDD 386

Query: 397 XXXXXXXXXXXXXXXXXXXXXXXXXXSRLRNLKREGAAMYXXXXXXXXXXXXXXXXXVAV 456
                                     +RLRNLKREGAAMY                 VAV
Sbjct: 387 EEEEAEFDDDDDNEEEEEEEADEDNAARLRNLKREGAAMY-KEEGGDDDSNESKRRRVAV 445

Query: 457 IEDDEDED 464
           IEDDEDED
Sbjct: 446 IEDDEDED 453

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/370 (72%), Positives = 282/370 (76%), Gaps = 3/370 (0%)

Query: 96  INHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPS 155
           ++HRSRHRESLGLDDDEAEEQAMYTRKFYGEDAN++SDQDE  HTFKEEN+E+VRHIIP+
Sbjct: 118 VDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPN 177

Query: 156 KANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDEN 215
           KANVNETASHNEIFYARIPNFLTID +PFDPPSFEAKVNERA NS S+EDQLDDRLIDEN
Sbjct: 178 KANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDEN 237

Query: 216 TVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQEL 275
           TVRWRYSRDKDQHVFKESNTQIVQWSDG+YSLKVGEECTDILVNDTSNTFLTVSHDQQEL
Sbjct: 238 TVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQEL 297

Query: 276 IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
           IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQ+KGPGTYIV+MDPEVEKKELE
Sbjct: 298 IQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELE 357

Query: 336 XXXXXXXXXXXXXXXXXXXXXXXPDAAFETGFRKQNSPTTYGASRRNXXXXXX--XXXXX 393
                                  PDAAFETGFRKQ+SPT+YG SRRN             
Sbjct: 358 KKQSQVLRDRRRRQLKEREKQESPDAAFETGFRKQSSPTSYGISRRNEYEEDDFLVDDDE 417

Query: 394 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRLRNLKREGAAMYXXXXXXXXXXXXXXXXX 453
                                        +RLRNLKREGAAMY                 
Sbjct: 418 EEEAGFDDGDDEEEEEEEEEEEEADQENAARLRNLKREGAAMY-KEEEKDDDSNETKRRR 476

Query: 454 VAVIEDDEDE 463
           VAVIEDDEDE
Sbjct: 477 VAVIEDDEDE 486

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  359 bits (921), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 177/272 (65%), Positives = 209/272 (76%), Gaps = 6/272 (2%)

Query: 113 AEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYAR 172
           A+EQ MYTRKFYGEDA N+SD DE  HTFKE NV+L+RHIIP K        H+EIFYA+
Sbjct: 106 AKEQEMYTRKFYGEDAVNYSDDDEP-HTFKESNVDLIRHIIPYKTRTTNN-EHDEIFYAK 163

Query: 173 IPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKE 232
           +P FLTIDP+PFDP +FEA V+ER S SAS+EDQL DRLIDENT+RWRYSRD +QHVFKE
Sbjct: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223

Query: 233 SNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIP 292
           SN QIVQWSDG++SLK+G+E TDI+VNDT NTFLTVSHDQQEL+QCY+GGEI KT+MFIP
Sbjct: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283

Query: 293 TSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELEXXXXXXXXXXXXXXXXX 352
           TSTNSKIHQKLSKAV RRN RQ+ GPG+YI+  DPE+EKKELE                 
Sbjct: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKE 343

Query: 353 XXXXXXPDAAF-ETG-FRKQNSPTTYGASRRN 382
                  +  F ETG F++ N+P+   +SR+N
Sbjct: 344 IETRENAENGFAETGEFKRGNTPSR--SSRQN 373

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  354 bits (908), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 174/289 (60%), Positives = 211/289 (73%), Gaps = 12/289 (4%)

Query: 103 RESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNET 162
           R  + +DD+EA+E AMYTRKFYGEDA+N SDQ+E+ + F EENVELVRHI+P K      
Sbjct: 73  RGEMQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGA 132

Query: 163 ASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYS 222
              + I+YA++P FLTIDP+PFDPPSFE+KV ER  NS+SREDQL DRLIDENT+RWRYS
Sbjct: 133 DEKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYS 191

Query: 223 RDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGG 282
           RD++Q V+KESN QIVQWSDG  SLK+G E TDILVNDT NTF  VSHD+QEL+QC +GG
Sbjct: 192 RDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGG 251

Query: 283 EIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELEXXXXXXX 342
           E+ K+LMFIPTSTNSK+HQKL+KAVIRR+QRQ+KGPG Y V+ DPE+EK ELE       
Sbjct: 252 EVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVV 311

Query: 343 XXXXXXXXXXXXXXXXPDAAFE-TGFRKQNSPTT--------YGASRRN 382
                           PD +    G+RK  +P T        YG+S+RN
Sbjct: 312 RERRKRQLKEIESRNSPDISTGLNGYRK--TPVTASDEQDSYYGSSKRN 358

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  335 bits (860), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 166/274 (60%), Positives = 201/274 (73%), Gaps = 7/274 (2%)

Query: 114 EEQAMYTRKFYGEDANN--FSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYA 171
           EE+AMYTRKFYG+D  N   SDQD   H FKEENVEL+RH++P K + +E      ++YA
Sbjct: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTS-SEKTDETTVYYA 139

Query: 172 RIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFK 231
           ++P FLTI+P+PFDP +FE+ V +R SN +S+EDQL DRLIDENTVRWRYSRD +Q VFK
Sbjct: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199

Query: 232 ESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFI 291
           ESN QIVQWSDG++SLK+G+E TDILVN+T+NTFL VSHDQQEL+QCY GGEI KTLMFI
Sbjct: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259

Query: 292 PTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELEXXXXXXXXXXXXXXXX 351
           PTSTNSKIHQ+LSKAV RRNQR+  GPGT I++ DPEVEK+ELE                
Sbjct: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRRRQLK 319

Query: 352 XXXXXXXPDAAFET--GF--RKQNSPTTYGASRR 381
                  PD   +   G+  RK+N+P     SRR
Sbjct: 320 EKELLESPDTTMDVSGGYETRKRNTPNPSLGSRR 353

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  334 bits (856), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 192/235 (81%), Gaps = 5/235 (2%)

Query: 101 RHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVN 160
           RHR+ +  DD+EAEE AMYTRKFYGED +  SD++E     +EE+VELVRHI+P +A   
Sbjct: 76  RHRQEM--DDEEAEEHAMYTRKFYGEDVDRVSDEEEAQEF-REEDVELVRHIVPYRAT-- 130

Query: 161 ETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWR 220
           +      ++YA+IP FLTIDP+PFDPPSFEA V ER  N AS+EDQL DRLIDENTVRWR
Sbjct: 131 QGTDKPVLYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWR 190

Query: 221 YSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYE 280
           YSRD +Q VFKESN QIVQWSDGT+SLK+G+E TDIL NDT NTF  VSHDQQEL+QCYE
Sbjct: 191 YSRDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYE 250

Query: 281 GGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
           GGE+ KTLMFIPTST+S++HQKL+KAV+RR+ +Q+ GPGTYIV  DPE+E+ ELE
Sbjct: 251 GGEVTKTLMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELE 305

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  334 bits (856), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 173/369 (46%), Positives = 223/369 (60%), Gaps = 4/369 (1%)

Query: 97  NHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSK 156
           NH S+   + G   +E EEQAMY RKFYG+D +N SD +++   FKE +VE+ +HI+P K
Sbjct: 113 NHLSKSEANHGSYLEEDEEQAMYNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYK 172

Query: 157 ANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENT 216
              N  +   E++YA++P FLTIDP+PFDPPSF+  V  R +  +S+EDQLDDRLIDENT
Sbjct: 173 TTSN--SQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENT 230

Query: 217 VRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELI 276
           +RWRYSRD  Q VFKESN QI+QWSDGT+SL++G+E +D+L+NDT NTFLTVSH+QQEL+
Sbjct: 231 IRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELM 290

Query: 277 QCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELEX 336
           QC EGGEI KT+MFIPTST+SKIHQ+LSKAV+RR QR+  GP TYIV  DPE+E++ELE 
Sbjct: 291 QCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEK 350

Query: 337 XXXXXXXXXXXXXXXXXXXXXXPDAAFETGFRKQNSPTTYGASRRNXXXXXXXXXXXXXX 396
                                  D+    G RK ++ +++G  RRN              
Sbjct: 351 KQDQIVRERRKRQLKEQLEKENRDSVEPLGVRK-SATSSFGVGRRNEYEEDDFLVDDEEE 409

Query: 397 XXXXXXXXXXXXXXXXXXXXXXXXXXS-RLRNLKREGAAMYXXXXXXXXXXXXXXXXXVA 455
                                     + RLR LKREGAA Y                   
Sbjct: 410 EEEGGISGEEEEEAEEEDDDDEDDLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKI 469

Query: 456 VIEDDEDED 464
            + DDE+ED
Sbjct: 470 AVLDDEEED 478

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  332 bits (850), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 183/228 (80%), Gaps = 3/228 (1%)

Query: 108 LDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNE 167
           LD DE EE  MY RKFYGED +  SD ++  H FKE NVELV+HI+P K   ++    N+
Sbjct: 94  LDMDEEEE--MYNRKFYGEDVD-MSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTND 150

Query: 168 IFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQ 227
           I+ A++P FL IDP PFDP SFE KV +R   S S+ED+L DRLIDENTVRWRYSRD +Q
Sbjct: 151 IYVAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQ 210

Query: 228 HVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKT 287
            VFKESNTQIVQWSDG+YSLK+G E TDIL+NDT NTFLTVSHDQQEL+QC EGG + KT
Sbjct: 211 SVFKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKT 270

Query: 288 LMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
           LMFIPTST+SKIHQKLSKAV RRN  QS GPGTYIVS+DPE+EKKELE
Sbjct: 271 LMFIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELE 318

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  323 bits (828), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/217 (68%), Positives = 181/217 (83%), Gaps = 3/217 (1%)

Query: 111 DEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFY 170
           D  +E+AMYTRKFYG D + +SD +E  H FKE NVE++RH++P K + ++  +   I+Y
Sbjct: 114 DMDDEEAMYTRKFYG-DTDKYSDNEEDAHDFKEANVEIIRHMVPYKTSSDQ--ADTTIYY 170

Query: 171 ARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVF 230
           A++P FLTIDPIPFDP SFE KV +R ++ +SREDQL DRLIDENT+RWRYSRD++Q VF
Sbjct: 171 AKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVF 230

Query: 231 KESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMF 290
           KESN QIVQWSDG++SLK+G+E TDILVNDT NTFLTVSHDQQEL+QCY GGEI KT+MF
Sbjct: 231 KESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMF 290

Query: 291 IPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDP 327
           IPTSTNSKIHQ+LSKAV RRNQRQ+ GPGT I+  DP
Sbjct: 291 IPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDP 327

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  321 bits (822), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 180/222 (81%), Gaps = 2/222 (0%)

Query: 114 EEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYARI 173
           EE+AMY RKFYGE+ ++ SD +E    FKE +VELVRH++P K    E      I+Y ++
Sbjct: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYKT-FPENEDDKTIYYTKV 124

Query: 174 PNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKES 233
           P FL+IDP+PFDPPSFE KV ER SN +S EDQL DRLIDENT+RWRYSRD +Q VFKES
Sbjct: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184

Query: 234 NTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPT 293
           N QIVQWSDG+YSLK+G E TDILVN T NTFLTVSHDQQEL+QC +GG+I KTL+FIPT
Sbjct: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244

Query: 294 STNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
           STNSKIHQ+LSKA+ RR+QR   GPGT IV++DPEVEK+ELE
Sbjct: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELE 286

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  316 bits (810), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 184/233 (78%), Gaps = 4/233 (1%)

Query: 95  NINHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIP 154
           NI  R R+     +D+DE EEQAMYTRKFYGED  + SDQ+E  H F+EE+V L RH++P
Sbjct: 76  NIGRRRRNY----VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVP 131

Query: 155 SKANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDE 214
           +K    E  +   I+YA++P FLTIDPIPFDPP+FE  V ER +N  S+E+QL+DRLID+
Sbjct: 132 TKITSEENDADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQ 191

Query: 215 NTVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQE 274
           NT+RWRYSRD +Q VFKESN  IVQWSDG+YSLK+G+E TDIL+NDT NTFLTVSHDQQE
Sbjct: 192 NTIRWRYSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQE 251

Query: 275 LIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDP 327
           L+QC  GGEI K+L+F+P ST SK+HQ+LSKA++RRN  ++ GP + IV++DP
Sbjct: 252 LMQCVHGGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDP 304

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  302 bits (773), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 149/237 (62%), Positives = 186/237 (78%), Gaps = 8/237 (3%)

Query: 100 SRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSK-AN 158
           S HR    +DD+E EEQAMY RKF GED    S+++      KE +VE+V+H++P K AN
Sbjct: 57  SHHR---VIDDEEDEEQAMYNRKFLGEDYEGQSEEEYEKKY-KEVDVEIVKHVVPYKTAN 112

Query: 159 VNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVR 218
               A    I+YA++P FLTIDP+PFDPPSF+ KV +R S  +S+EDQL DRLI+ENT+R
Sbjct: 113 ---GADDKTIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIR 169

Query: 219 WRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQC 278
           WRYSRDKD+ VFKESN QIV+WSDGT+SLKVG+E TDILVN+T NT+LTVSH++QELIQC
Sbjct: 170 WRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQC 229

Query: 279 YEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
            EGGEI K++MF+PTSTNSK+H+ LSKAV RR++R   GP TYI   DPE+EK+ELE
Sbjct: 230 VEGGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELE 286

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  302 bits (774), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 179/227 (78%), Gaps = 7/227 (3%)

Query: 108 LDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKA-------NVN 160
           +D+DE EE AMYTRKFYG++  N  D+DE  H FKE +VELVRHI+P K        + +
Sbjct: 104 MDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKD 163

Query: 161 ETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWR 220
           +  S N  +YARIP FLTIDP+PFDPP FE++V ER  N+ + +D++ DRLIDENT+RWR
Sbjct: 164 DATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWR 223

Query: 221 YSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYE 280
           YSRD +Q VFKESN QI+QWSDG+YSLK+G++ TD+LVND SNTFLTVSHDQQEL+QC +
Sbjct: 224 YSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVD 283

Query: 281 GGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDP 327
           GGEI K+ MF+P STNS++HQ+LSKA+ RR+Q  ++ P + I+++DP
Sbjct: 284 GGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDP 330

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  294 bits (752), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 135/229 (58%), Positives = 180/229 (78%), Gaps = 10/229 (4%)

Query: 110 DDEAEEQAMYTRKFYG---EDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHN 166
           ++E +EQAMY RKFYG   ED+N     DE +  F+E ++++++HI+P   +   +    
Sbjct: 62  EEEDDEQAMYNRKFYGDKGEDSN-----DEGSQEFREADIDIMKHIVP--YSTEPSQGDK 114

Query: 167 EIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKD 226
            I+Y ++P FLTIDPIPFDPP+F++K+ ERA+   S EDQ+DDRLI+ENTVRWRYSRDK+
Sbjct: 115 TIYYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKN 174

Query: 227 QHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKK 286
           Q VFKESN  IVQWSDGTYSL++G+E TD+L+NDT +T+L VSHDQQELIQ  +GGE+ K
Sbjct: 175 QRVFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTK 234

Query: 287 TLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
            ++FIPTSTNSK HQ+LSKAV R+ Q++  GP TYI+ +DPE+E+KELE
Sbjct: 235 NMIFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELE 283

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  293 bits (751), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 176/220 (80%), Gaps = 3/220 (1%)

Query: 116 QAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPN 175
           QAMY RKFYG++A + +D+  +   F+E +V++V+H++P     +E      IFYA++P 
Sbjct: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137

Query: 176 FLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKESNT 235
           FLTIDPIPFDPP+F+ K+ +R +  +S EDQ+DDRLI+ENTVRWRYSRD  Q VFKESN 
Sbjct: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197

Query: 236 QIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTST 295
           QIVQWSDGT+SL++G+E TD+L+NDT +T+LTVSHDQQELIQ  +GGE+ K ++FIPTST
Sbjct: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257

Query: 296 NSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
           NSK HQ+LSKAV R+ QR+  GP TYI+ +DPE+E+KELE
Sbjct: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELE 297

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  286 bits (733), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 175/232 (75%), Gaps = 5/232 (2%)

Query: 107 GLDDDEAEEQAMYTRKFYGED---ANNFSDQDETTHTFKEENVELVRHIIPSKANVNETA 163
           GL  ++ EEQ MY RKFYG+D   A++ SD+DE     KE ++ELV+H++P   N     
Sbjct: 73  GLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPLLYN-KPLE 130

Query: 164 SHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSR 223
               ++Y ++P FLTIDP+PFDPPSF+ ++ +R +  +S+EDQL D LIDENT+RWRYSR
Sbjct: 131 GKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSR 190

Query: 224 DKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGE 283
             DQ VFKESN Q+++WSDGT SLK+G+E TDIL N+  NT+LTVSH+QQE++QC EGG 
Sbjct: 191 GSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGT 250

Query: 284 IKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELE 335
           I  +++FIPTSTNSKIH++L+KA+ RR  R+  GP TYIV  DPE+EK+EL+
Sbjct: 251 ISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQ 302

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  286 bits (732), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 171/225 (76%), Gaps = 4/225 (1%)

Query: 105 SLGLDDDEAEEQAMYTRKFYGEDANNFSDQD--ETTHTFKEENVELVRHIIPSKANVNET 162
            LGL D+E +EQ MY RKFYG+D    S +   E     KE NV++++H++P     N +
Sbjct: 77  GLGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPY-YTTNAS 134

Query: 163 ASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYS 222
              + ++YA++P FLTIDPIPFDPP F++++ +R    +S+EDQL DRLIDENT+RWRYS
Sbjct: 135 EKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYS 194

Query: 223 RDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGG 282
           R  +Q VFKESN QI+QWSDGT+SLK+G+E +DIL+ND  NT++TVSH+Q+EL+QC EGG
Sbjct: 195 RGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGG 254

Query: 283 EIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDP 327
           EIKK+++FIPTSTNSK HQ+LS A+ RR  R+  GP TYIV MDP
Sbjct: 255 EIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDP 299

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  283 bits (725), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 180/243 (74%), Gaps = 8/243 (3%)

Query: 97  NHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSK 156
           N RS + E+     D+ +++AMY +KFYGED  N SD D+  + +KE ++ELVRHI+P K
Sbjct: 41  NRRSEYDEN----SDDEQDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYK 96

Query: 157 ANVN--ETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDE 214
              +  E   H E++YA++P FL +DP+PFD  +FE+ V ER  NS + + Q+ DRL DE
Sbjct: 97  TRPSNKELDKHRELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDE 156

Query: 215 NTVRWRYSRDKDQH--VFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQ 272
           NT+RWRYSRD + +  VFK+SN QI+QWSDG+YSLK+G + TDIL N+T N FLTVSHDQ
Sbjct: 157 NTIRWRYSRDSNDNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQ 216

Query: 273 QELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKK 332
           QEL+QCY GGEI KTLMFIP+ST SKIHQ+L+ AV  R+++ + GPG  +++ DPE+EKK
Sbjct: 217 QELMQCYNGGEITKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKK 276

Query: 333 ELE 335
            LE
Sbjct: 277 LLE 279

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,354,939
Number of extensions: 1467898
Number of successful extensions: 4221
Number of sequences better than 10.0: 35
Number of HSP's gapped: 4339
Number of HSP's successfully gapped: 40
Length of query: 464
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 351
Effective length of database: 40,524,141
Effective search space: 14223973491
Effective search space used: 14223973491
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)