Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR120W (GCY1)5.434ON31231216600.0
Skud_15.2835.434ON31231215110.0
Smik_15.2985.434ON31231214980.0
Suva_8.1735.434ON31231214800.0
NDAI0C016005.434ON31331211811e-163
KNAG0C049105.434ON31331211811e-163
CAGL0I01100g5.434ON31030911651e-161
NCAS0H020605.434ON32230611261e-155
SAKL0G02530g5.434ON31231211251e-155
Suva_2.5405.434ON31231211241e-155
Smik_4.6345.434ON31231211201e-154
Skud_4.6375.434ON31231211181e-154
YDR368W (YPR1)5.434ON31231211151e-153
NDAI0B056705.434ON31831210901e-149
Kpol_1062.295.434ON31130910801e-148
CAGL0A02816g5.434ON31030910731e-147
TBLA0A065105.434ON31231210541e-144
KAFR0E038405.434ON31031210531e-144
TBLA0A02825singletonON31131210501e-144
NCAS0F033805.434ON31331310481e-143
ZYRO0F10032g5.434ON31030910441e-143
KAFR0E03850singletonON31131310421e-142
KLLA0B14707gsingletonON31030110341e-141
TPHA0E017605.434ON31030910271e-140
TDEL0E019105.434ON31131210231e-139
KLTH0E00220gsingletonON30630110161e-138
KLTH0A00528gsingletonON30630110161e-138
Kwal_47.18084na 1ON30930810051e-137
KLTH0E15532gsingletonON3093039961e-135
KLTH0A03476gna 1ON3083029611e-130
KLLA0D10109gsingletonON3093019521e-129
KLTH0F16060g5.434ON3093099511e-129
TPHA0G00210singletonON3113129471e-128
TBLA0A02835singletonON3113129421e-127
TDEL0D00230singletonON3123059421e-127
Kwal_55.214265.434ON3083099081e-122
AER401W5.434ON3133108431e-112
NDAI0A070003.108ON3202965698e-71
NCAS0I024203.108ON3202905662e-70
SAKL0C10626gsingletonON3222925568e-69
Kwal_56.226113.108ON3213015306e-65
Suva_4.3983.108ON3443105291e-64
Smik_2.289singletonON3443105274e-64
KNAG0K020703.108ON3233045202e-63
Smik_2.2883.108ON3443005212e-63
YBR149W (ARA1)3.108ON3443105203e-63
KLTH0C10010g3.108ON3213135193e-63
Skud_2.2763.108ON3443095195e-63
KAFR0G013503.108ON3243065132e-62
SAKL0C09922g3.108ON3222984984e-60
KLLA0F02728g3.108ON3303094942e-59
TDEL0D051603.108ON3252884811e-57
ZYRO0B06138g3.108ON3283104793e-57
Ecym_55085.409ON3263084663e-55
ACL107C5.409ON3543094448e-52
NCAS0A066605.409ON3263074402e-51
Ecym_7160na 2ON2712934353e-51
CAGL0I01122g5.409ON3263084367e-51
ZYRO0A06336g5.409ON3273284332e-50
TBLA0F01720singletonON3263084306e-50
KLLA0F03256g7.468ON2852804215e-49
KAFR0C05320singletonON3273074235e-49
KNAG0B03780singletonON3263094228e-49
SAKL0F14278g7.468ON2862804172e-48
Kwal_47.182197.468ON2932864163e-48
KNAG0D013707.468ON2822914145e-48
TBLA0A00630singletonON3283134175e-48
TPHA0E018605.409ON3263084141e-47
SAKL0G01914g5.409ON3293094142e-47
TDEL0E021505.409ON3293104123e-47
KLTH0G02420gna 3ON2893104093e-47
Kwal_33.13276na 4ON3022754103e-47
KLLA0E21627g5.409ON3293054113e-47
TDEL0C033207.468ON2832784075e-47
NCAS0H005607.468ON2842924051e-46
CAGL0C04543g7.468ON2872814051e-46
KLTH0F16610g5.409ON3293094081e-46
KLTH0F01892gna 4ON3022834051e-46
Kpol_1013.827.468ON2852814032e-46
NDAI0D016005.409ON3273094052e-46
ZYRO0G17600g7.468ON2832924023e-46
YJR096W7.468ON2822844014e-46
YHR104W (GRE3)5.409ON3273084044e-46
Skud_10.3187.468ON2822893962e-45
KAFR0G009207.468ON2862863972e-45
Suva_12.1847.468ON2822843962e-45
KLTH0G05786g7.468ON2862863953e-45
Smik_10.3847.468ON2822843927e-45
SAKL0F02574gna 3ON2893213929e-45
Smik_8.1825.409ON3273083922e-44
Kwal_47.18893na 3ON2892913884e-44
Suva_15.3005.409ON3273083888e-44
ABL209Cna 2ON3102883852e-43
KLLA0F05775g7.285ON3093023817e-43
Skud_8.1655.409ON3273103828e-43
Kwal_55.215365.409ON3293123704e-41
CAGL0J09394g7.285ON3113103555e-39
NCAS0A137407.285ON3093023469e-38
Smik_4.1137.285ON3123073424e-37
Kpol_1020.137.285ON3133293372e-36
KAFR0B012007.285ON3153063275e-35
Skud_4.1317.285ON3123113275e-35
Kwal_47.19278na 5ON3143233251e-34
YDL124W7.285ON3123133241e-34
NDAI0A023007.285ON3133343232e-34
KLTH0G00638gna 5ON3133093153e-33
SAKL0F09746g7.285ON3123123111e-32
ZYRO0E09614gna 5ON3083123074e-32
SAKL0F00704gna 5ON3153223041e-31
Kpol_381.8singletonON3093243022e-31
KNAG0C041107.285ON3113052934e-30
TBLA0F019807.285ON3023192916e-30
TDEL0D02790singletonON3292982911e-29
ZYRO0C09196g7.285ON3122912857e-29
Ecym_32647.285ON3113212717e-27
Kwal_33.13274singletonON108831921e-17
Suva_4.1227.285ON2061801082e-05
Kpol_400.9singletonON3413291103e-05
TBLA0G01120singletonON3432761094e-05
Kpol_449.4singletonON3412731023e-04
Suva_12.272singletonON265205950.002
Ecym_22962.604ON340182940.003
TBLA0B10110singletonON345257930.004
TDEL0A08000singletonON319221900.008
TBLA0G00960singletonON321236900.009
TPHA0H00110singletonON345319890.010
TBLA0E05040singletonON342306870.023
NCAS0C02450singletonON343292860.027
YDL243C (AAD4)singletonON32999860.029
NCAS0A129502.604ON323179810.11
Skud_10.383na 6ON376143800.14
KAFR0C04240singletonON34383790.19
Suva_14.10na 7ON37699790.21
KNAG0M023402.604ON309163780.22
NCAS0C019908.565ON343230790.22
KAFR0F03890singletonON319265780.24
YFL056C (AAD6)singletonON212144770.26
YNL331C (AAD14)na 7ON376143780.30
Smik_14.1na 7ON376143780.31
KLLA0B09658g3.462ON342227760.46
Skud_3.183singletonON21796740.55
TPHA0C025602.604ON340111750.63
KLTH0E01474gsingletonON313215740.77
ZYRO0F04840gsingletonON379258740.79
YCR107W (AAD3)singletonON363102731.0
NDAI0G027608.295ON4961164731.3
KLTH0E16852gsingletonON375145721.6
Kwal_33.13275singletonOFF6726651.6
KLTH0E02530g5.402ON372182712.7
ZYRO0F00858g2.604ON346107702.8
SAKL0H09438g8.565ON34255702.8
Skud_14.2382.196ON220151683.9
KLLA0A05951g1.202ON28671684.5
KLLA0F19360gsingletonON34473684.8
KLTH0A08052gsingletonON338213675.2
NDAI0G012103.441ON164872685.4
KLTH0D13750g3.462ON33875675.7
TDEL0C06010singletonON34486668.5
NDAI0B009305.76ON94073669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR120W
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   644   0.0  
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   586   0.0  
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   581   0.0  
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   574   0.0  
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   459   e-163
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   459   e-163
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   453   e-161
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     438   e-155
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   437   e-155
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   437   e-155
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   436   e-154
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   435   e-154
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   434   e-153
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   424   e-149
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   420   e-148
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   417   e-147
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   410   e-144
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   410   e-144
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     409   e-144
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     408   e-143
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   406   e-143
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     405   e-142
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   402   e-141
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   400   e-140
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   398   e-139
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   395   e-138
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   395   e-138
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   391   e-137
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   388   e-135
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   374   e-130
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   371   e-129
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   370   e-129
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 369   e-128
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     367   e-127
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   367   e-127
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   354   e-122
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   329   e-112
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   223   8e-71
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   222   2e-70
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   218   8e-69
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   208   6e-65
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   208   1e-64
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   207   4e-64
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   204   2e-63
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   205   2e-63
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   204   3e-63
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   204   3e-63
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   204   5e-63
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   202   2e-62
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   196   4e-60
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   194   2e-59
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   189   1e-57
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   189   3e-57
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   184   3e-55
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   175   8e-52
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             174   2e-51
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   172   3e-51
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   172   7e-51
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   171   2e-50
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     170   6e-50
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   166   5e-49
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   167   5e-49
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               167   8e-49
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   165   2e-48
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   164   3e-48
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   164   5e-48
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     165   5e-48
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   164   1e-47
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   164   2e-47
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   163   3e-47
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   162   3e-47
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   162   3e-47
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   162   3e-47
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   161   5e-47
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   160   1e-46
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   160   1e-46
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   161   1e-46
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   160   1e-46
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   159   2e-46
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               160   2e-46
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   159   3e-46
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   159   4e-46
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   160   4e-46
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   157   2e-45
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   157   2e-45
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   157   2e-45
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   156   3e-45
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   155   7e-45
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   155   9e-45
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   155   2e-44
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   154   4e-44
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   154   8e-44
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   152   2e-43
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   151   7e-43
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   151   8e-43
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   147   4e-41
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   141   5e-39
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   137   9e-38
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   136   4e-37
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   134   2e-36
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   130   5e-35
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   130   5e-35
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   129   1e-34
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   129   1e-34
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     129   2e-34
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   125   3e-33
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   124   1e-32
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   122   4e-32
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   121   1e-31
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   120   2e-31
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   117   4e-30
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   116   6e-30
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     116   1e-29
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   114   7e-29
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   108   7e-27
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    79   1e-17
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    46   2e-05
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    47   3e-05
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    47   4e-05
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    44   3e-04
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    41   0.002
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    41   0.003
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    40   0.004
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              39   0.008
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      39   0.009
TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON}                 39   0.010
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             38   0.023
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    38   0.027
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    38   0.029
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    36   0.11 
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    35   0.14 
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               35   0.19 
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    35   0.21 
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    35   0.22 
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     35   0.22 
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      35   0.24 
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    34   0.26 
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    35   0.30 
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    35   0.31 
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    34   0.46 
Skud_3.183 Chr3 (296810..296845,296849..297115,297116..297466) [...    33   0.55 
TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.6...    33   0.63 
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    33   0.77 
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    33   0.79 
YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putati...    33   1.0  
NDAI0G02760 Chr7 (629341..644226) [14886 bp, 4961 aa] {ON} Anc_8...    33   1.3  
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    32   1.6  
Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig...    30   1.6  
KLTH0E02530g Chr5 complement(221189..232354) [11166 bp, 3721 aa]...    32   2.7  
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    32   2.8  
SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly...    32   2.8  
Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W...    31   3.9  
KLLA0A05951g Chr1 (552438..553298) [861 bp, 286 aa] {ON} highly ...    31   4.5  
KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} high...    31   4.8  
KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {...    30   5.2  
NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3....    31   5.4  
KLTH0D13750g Chr4 complement(1120534..1121550) [1017 bp, 338 aa]...    30   5.7  
TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa] ...    30   8.5  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    30   9.6  

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 301 VHPNWSPFEVFK 312
           VHPNWSPFEVFK
Sbjct: 301 VHPNWSPFEVFK 312

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/312 (88%), Positives = 294/312 (94%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           MPATL DST+ LSLNTGAQIPQ+GLGTWQSK+NDAYK+VL ALKDGYRHIDTAAIYRNED
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           QVGQAI+DSGVPRE+IFVTTKLWCTQHHEP  ALDQSL+RLGLDYVDLYLMHWP RLDP 
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           YIK+ +ILSVPTK+DGSRAVDITNWNFIKTWELMQELPKTGK KAVGVSNFSINNLKDLL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           AS+GNKLTPAANQVEIHPLLPQ+ELI+FC+ KGI++E YSPLGSTDAPLLKEPVILEIAK
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           KNNVQP HVVISWH QRGYVVLPKSVNPDR+K NRKIFTLS EDFEAIN ISK KGEKRV
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 301 VHPNWSPFEVFK 312
           VHPNWSPFE FK
Sbjct: 301 VHPNWSPFEAFK 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/312 (89%), Positives = 294/312 (94%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M  TLHDSTK LSLNTGAQIPQ+GLGTWQSK+NDAYK+VL ALK GY+HIDTAAIYRNED
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           QVGQAIKDSGVPREEIFVTTKLW TQHHEP  ALD+SL+RLGLDYVDLYL+HWPARLD  
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           YIK+ DILSVPTK DGSRAVD+TNWNFIKTWELMQELPKTGKTKA+GVSNFSINNLKDLL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           AS GNKLTPAANQVEIHPLLPQ+ELINFCKSK I++EAYSPLGSTDAPLLKEP IL+IAK
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           KNNVQPGHVVISWH QRGYVVLPKSVNPDRI+TNRKIFTLS EDFEAINNISKEKGEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 301 VHPNWSPFEVFK 312
           V+PNWSPFE FK
Sbjct: 301 VNPNWSPFEAFK 312

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/312 (88%), Positives = 293/312 (93%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M ATL  STK L LNTGA+IPQ+GLGTWQSK+NDAYK+V+ ALKDGYRHIDTAAIY NED
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           QVGQAIKDSGVPREEIFVTTKLWCTQHHEP  ALDQSLKRLGLDYVDLYLMHWP RLDP 
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           YIK+  ILS+PTK+DGSR VDITNWNFIKTWELMQELPKT KT+AVGVSNFSINNLKDLL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           AS GN+LTPAANQVE+HPLLPQ+ELI+FCKSKGI+VEAYSPLGSTDAPLLKEPV+LEIAK
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           KNNVQPGHVVISWH QRGYVVLPKSVNPDRIKTNRK+FTLS EDFEAINNISKEKGEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 301 VHPNWSPFEVFK 312
           V+P+WSPFE FK
Sbjct: 301 VNPDWSPFEAFK 312

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  459 bits (1181), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 217/312 (69%), Positives = 259/312 (83%), Gaps = 1/312 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYRHIDTAAIYRNE 59
           M +TL +ST    LNTGA IP +GLGTWQS  EN+ Y+AV+ ALK GYRHIDTAAIY+NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDP 119
           DQVG+AI DSG+PREEIFVTTKLW TQH +PE AL+QSL+RLGLDYVDLYLMHWP    P
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 AYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179
             IK+ +  ++P   +G R +D+T WNF+KTWELMQELPKTGKT+AVGVSNFSINNLK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239
           L+S GNKL PAANQVE HPLLPQDEL  FCK KGI++EAYSPLGST+AP+L EP I+EIA
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299
           KK+NVQP  VVISWHVQ+G+VVLPKSV+ +RIK N + F LS ++ +++NN+SKEKGE+R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 300 VVHPNWSPFEVF 311
           +V PNW+PF  F
Sbjct: 301 IVQPNWAPFVPF 312

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  459 bits (1181), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/312 (69%), Positives = 257/312 (82%), Gaps = 1/312 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKE-NDAYKAVLTALKDGYRHIDTAAIYRNE 59
           M ATL  +T +L LNTGA I  IGLGTW+S    DAY +V+ AL+ GYRHIDTAAIY NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDP 119
            +VG+AI++SGVPR EIFVTTKLWCTQH EPE+ALDQSLKRLGLDYVDLYLMHWP R+  
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 AYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179
             +   D +  PT  +G R +DIT+WNF+KTWELMQ+LP+TGKT+A+GVSNFSINNLKDL
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239
           LAS GNK+ PAANQVE+HPLLPQ EL++FC  KGIV+EAYSPLGS DAP+LKEPVI+EIA
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299
           KKN V    VVISW+VQRGY+VLPKSVN +RI+ N   FTL++EDFEA+NNISK +G KR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 300 VVHPNWSPFEVF 311
           ++ P+W PF+ F
Sbjct: 301 IIDPDWEPFKPF 312

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  453 bits (1165), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 214/309 (69%), Positives = 251/309 (81%), Gaps = 1/309 (0%)

Query: 3   ATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQV 62
           A LH +T  L LNTGA IP IGLGTWQS EN+ Y A L ALK GYRHIDTAAIY+NE+++
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61

Query: 63  GQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
           G+AI+DS +PR E+FVTTKLW TQH  P  ALDQSLKRLGLDYVDLYLMHWP  L    I
Sbjct: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121

Query: 123 KNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLAS 182
           K+ ++L +P ++DGSR VD+ +WNF+KTWELMQELPK  K +A+GVSNFSINNLK+LL S
Sbjct: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180

Query: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN 242
           +GNK+ PAANQ+EIHPLLPQDELINFCK KGIV+EAYSPLGSTDAP+LKE  I EIAKKN
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVH 302
            V  G +VISWH QRGYVVLPKSV P+RI  N++ F LS EDF  ++N +K+ GE+RVV 
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 303 PNWSPFEVF 311
           PNW PF+ F
Sbjct: 301 PNWGPFKPF 309

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  438 bits (1126), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/306 (67%), Positives = 247/306 (80%), Gaps = 1/306 (0%)

Query: 7   DSTKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQA 65
           +ST    LNTGA I  +GLGTWQS  EN+ Y+AV+ ALK GYRHIDTAAIY NE QVG+A
Sbjct: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75

Query: 66  IKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNE 125
           I DSGVPREEIFVTTKLW TQHH+P   L+ SLKRLGLDYVDLYLMHWP  L+P  IK+ 
Sbjct: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135

Query: 126 DILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGN 185
           + LS+P   DG R V+I  W+++KTWELMQELPKTGKT+AVGVSNFSINNLK +L+S GN
Sbjct: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195

Query: 186 KLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQ 245
           K+ PA NQVEIHPLLPQ+EL+ +C SKGI++EAYSPLGST+AP+L EPV++ +AKK+ VQ
Sbjct: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255

Query: 246 PGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNW 305
              +VISWHVQRGY+VLPKSV+ +RI+ N K   LS E+   INNISKEKGE+R+V P+W
Sbjct: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315

Query: 306 SPFEVF 311
            PF  F
Sbjct: 316 EPFVPF 321

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  437 bits (1125), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 252/312 (80%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M   L +S+  + LNTGA IPQ+GLGTW+S + +AY +VL+A+K GYRHID+AAIY NE+
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
            VG+AI+DSGVPR E+FVTTKLW TQ   PE ALD SLKRLGLDYVDLYL+HWP      
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            IK++D L+VPT KDG   VD+ +WNF+KTWEL+QELP TGK KAVGVSNFS+NNLK+LL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           AS GNKL PA NQVE+HPLLPQDELI F KSKGIV+EAYSPLGS  +PLLKEPVI+E+AK
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K  V+P  V+I+W +QRGYV+LPKSVNP R+++N K+F LS ED + I+ ISKE+G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 301 VHPNWSPFEVFK 312
           VHP+W  F +F+
Sbjct: 301 VHPDWPSFPIFE 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  437 bits (1124), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 250/312 (80%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           MPATL +S+  L LNTGA IP +G GTW+S +N  Y +V+ ALK GYRHID AAIY NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           +VG+AIKDSGVPREEIF+TTKLW T+  +PE ALD+SLKRLGLDYVDLYLMHWP  L   
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            I + D L +PT +DG+  VD   WNF+KTW+LMQ+LPKTGKTKAVGVSNFSINN+K+LL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
            S  NKL PA NQ+EIHPLLPQDELI FCK KGIVVEAYSP GS +APLLKE  I+++AK
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K+ V+P  ++ISW +QRGYVVL KSVNP+R+ +N KIFTL  +DF+ I+N+SK  GEKRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 301 VHPNWSPFEVFK 312
           V+  W+ F +F+
Sbjct: 301 VNMQWNSFPIFE 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  436 bits (1120), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/312 (66%), Positives = 249/312 (79%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           MPATL +S+  L LNTGA IP +G GTW+S EN+ Y +V+ ALK GYRHID AAIY NE+
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           +VG+AIKDSGVPRE+IF+TTKLW T+  +PE AL++SLKRLGLDYVDLYLMHWP  L   
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            I + ++L +PT  DG+  VD   WNFIKTW+LMQELPKTGKTKAVGVSNFSINN+K LL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
            S  NKL PAANQ+EIHPLLPQ+ELI FCK KGIVVEAYSP GS +APLL+E  I+++AK
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K+ V P  ++ISW +QRGYVVL KSVNP+RI +N KIFTL  +DF+ I+N+SK  GEKRV
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 301 VHPNWSPFEVFK 312
           V   WS F +FK
Sbjct: 301 VDMKWSSFPIFK 312

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  435 bits (1118), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 251/312 (80%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           MPATL +S+  L LNTGA IP +G GTW+S +N+ Y +V+ ALK GYRHID AAIY NE+
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           +VG+AIKDSG+ REEIF+TTKLW T+  +PE AL++SLKRLGLDYVDLYLMHWP  L   
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            + + ++L +PT +DG+  VD   WNFIKTW+LMQELPKTGKT+AVGVSNFSINN+K+LL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
            S  NKL PA NQVEIHPLLPQDELI FCK KGIVVEAYSP GS +APLLKE  I+++AK
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K+ V+P  ++ISW +QRGYVVL KSVNP+R+ +N KIFTL  +DF+AI ++SK  GEKRV
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 301 VHPNWSPFEVFK 312
           V+  W+ F +F+
Sbjct: 301 VNMKWASFPIFE 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 249/312 (79%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           MPATL +S+  L LNTGA IP +G GTW+S +N+ Y +V+ ALK GYRHID AAIY NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           +VG+AIKDSGVPREEIF+TTKLW T+  +PE AL++SLKRLGLDYVDLYLMHWP  L   
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            + + ++L +PT +DG+  +D   WNFIKTWELMQELPKTGKTKAVGVSNFSINN+K+LL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
            S  NK+ PA NQ+EIHPLLPQDELI FCK KGIVVEAYSP GS +APLLKE  I+++AK
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K+ V+P  ++ISW +QRGYVVL KSVNP+RI +N KIFTL  +DF+ I+N+SK  G KRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 301 VHPNWSPFEVFK 312
           V   W  F +F+
Sbjct: 301 VDMKWGSFPIFQ 312

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  424 bits (1090), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 251/312 (80%), Gaps = 7/312 (2%)

Query: 8   STKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI 66
           S  IL L+TGA IPQIGLGTW+S   NDAY +V+ ALK+GYRHIDTAAIY NE QVG+AI
Sbjct: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66

Query: 67  KDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNED 126
           +DSGVPR EIFVT+KLWC Q H+P++AL+Q+LKRLGLDY+DLYLMHWP   +P  IK+ED
Sbjct: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126

Query: 127 -----ILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLA 181
                 +++PT  +G+  V++  WNFIKTWELMQ LP++GKTKAVGVSNFSINNL DLLA
Sbjct: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186

Query: 182 SQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKK 241
           +   K+ PAANQ+E+HPLL Q+EL+ +CK K I+VEAYSP GS +AP+LK+  I  IAKK
Sbjct: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246

Query: 242 NNVQPGHVVISWHVQR-GYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
            ++Q G VV+SWH+QR GYVVLPKSV+ +RI  NRK+ TL  EDF+AINN+ KEKGE RV
Sbjct: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306

Query: 301 VHPNWSPFEVFK 312
           V P+WSPF +FK
Sbjct: 307 VDPDWSPFPLFK 318

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  420 bits (1080), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 202/309 (65%), Positives = 243/309 (78%), Gaps = 1/309 (0%)

Query: 4   TLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVG 63
           +L +    + LNTGA++P +GLGTWQS ENDAYKAVLTALK GYRHID AAIY NE +VG
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVG 61

Query: 64  QAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIK 123
           +AI+DSGVPR EIFVTTKLW TQ   P++AL+QSL+RLGLDYVDLYL+HWP  L+PA  +
Sbjct: 62  KAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCE 121

Query: 124 NE-DILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLAS 182
              + L+ P   +G R VD+  WNF+KTWELMQELP TGK KAVGVSNFSINN+K+LL+S
Sbjct: 122 ESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSS 181

Query: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN 242
            GNKL PA NQ+E+HPLLPQ EL+NFCK KGIVVEAYSPLG T A +LKEP++ E+AKK 
Sbjct: 182 PGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKY 241

Query: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVH 302
           N+   ++V+SW VQRG VVLPKSV   RI +N +  TL+ ED E I N+SKEKGEKR   
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCA 301

Query: 303 PNWSPFEVF 311
           P++SPF  F
Sbjct: 302 PDFSPFNTF 310

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  417 bits (1073), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/309 (64%), Positives = 239/309 (77%)

Query: 4   TLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVG 63
           +L +ST  L LNTGA+IP +GLGTW+S  ND Y +VL ALK GYRHID AAIY NEDQVG
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVG 61

Query: 64  QAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIK 123
           +AIKDSGVPR+EIF+TTKLW T+H  P  ALD SLKRLGLDYVDLYLMHWP  L     +
Sbjct: 62  RAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSE 121

Query: 124 NEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQ 183
            +D+L++P K DG   +DI +W+FIKTWELMQELPKTGKTKA+GVSNFSINNLK L  S 
Sbjct: 122 EKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSP 181

Query: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNN 243
                PAANQVEIHPL PQ ELI +CKS+ I++EAYSP GS DAP+LKEP + ++A+K N
Sbjct: 182 KFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYN 241

Query: 244 VQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHP 303
           +    ++ISW VQRGYVVLPKSV+ +RI+ N K+ TL  ED E I N+SK KGEKR+V  
Sbjct: 242 ISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQL 301

Query: 304 NWSPFEVFK 312
           +WSPF  F+
Sbjct: 302 DWSPFPTFE 310

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  410 bits (1054), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 243/312 (77%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           MPA L +S   ++LN G +IP +GLGTW+S+END Y +V+ ALK GYRHIDTAAIYRNE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           +VG+AIKDSGVPR++IF+TTKLWCT+   P+ AL+ SLKRLGLDYVDLYLMHWP  L+P 
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           YIK++D L VP   DG+R VD+  W++IKTWEL+QELP TG T++VGVSNFSINNL+ +L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           +S GNKLTPA NQVE+HPLLPQ EL  +C SK I +EAYSP GS +AP LK+  I++IA 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           KN V P  V+ SW VQR  VVLPKSV+ +R+ +N K+F LS ED   I+ ++K  GEKR+
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 301 VHPNWSPFEVFK 312
             P+W PF VF+
Sbjct: 301 NKPDWDPFPVFE 312

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  410 bits (1053), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 245/312 (78%), Gaps = 4/312 (1%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQ-SKENDAYKAVLTALKDGYRHIDTAAIYRNE 59
           M A L +STK L LN G+QIP +GLGTWQ + E DAY AV  AL  GYRHIDTAAIY+NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDP 119
            QVG+AI+DSGVPREEIFVTTKLW  QHHEPEVALD+SL+RLGLDYVDLYLMHWP  LD 
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 AYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179
           +Y+K E  L +  + DG+R V+ T+W FI TWELMQ+LPK  K +++GVSNFS+NNLKDL
Sbjct: 121 SYMK-ESPLELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239
           L +    + P  NQVE+HPLLPQ EL+++C+   I VEAYSPLGST APLL EP+++++A
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299
           KKN VQP HVV+SW VQR  +VLPKSV+ +R+  N K FTL  EDF+AI  IS+++GE+R
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 300 VVHPNWSPFEVF 311
           + +PN+ PF+ F
Sbjct: 298 INNPNFEPFKTF 309

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  409 bits (1050), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 234/312 (75%), Gaps = 1/312 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M A L + T  + LNTGA IP IGLGTW+S+ ND Y +V+ A K GYRHIDTAAIY NED
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           QVG+AI + GV R E+FVTTKLW TQ  +PE AL+QSLKRLGLDYVDLYL+HWP      
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            IK+ ++L++P KKDG   +D   WNFIKTWELMQ L KTGKTKA+G+SNFSINN+K+LL
Sbjct: 121 TIKDGNLLTIP-KKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           A+    +TPA NQVE+HPLLPQDELI FCK KGIV+EAYSPLG  +AP+LK+  I+EIAK
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           +NNV  G VV SWHVQRGYVVLPKSV   RI +N K FTLS +D   INN+ K KGE R 
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 301 VHPNWSPFEVFK 312
                  F +F+
Sbjct: 300 CDLGIKGFPMFQ 311

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  408 bits (1048), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 246/313 (78%), Gaps = 1/313 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYRHIDTAAIYRNE 59
           M  TL  ST  L LNTGA IP+I LGTW+S    D Y +V+ ALK GYRHIDTAAIY NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDP 119
           DQVG+AI+DSG+PREEIFVT+KLW TQ H P  AL  +L RLGLDY+DLYLMHWP   + 
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 AYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179
             +K  D + +P  ++G   +++  WNF+KTWELMQELP TG TKAVGVSNFSINNLK+L
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239
           L S GNKLTPAANQ+EIHPLLP+ +LI FC+ KGI++EAYSPLGS +AP+LKEP I+EI+
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299
           KK +V P  ++ISWHVQRGYVVL KS + +RI  NRK+FTLS EDFEAI N++KEKG  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 300 VVHPNWSPFEVFK 312
           VV P+WSPF +FK
Sbjct: 301 VVDPDWSPFPLFK 313

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 238/309 (77%), Gaps = 1/309 (0%)

Query: 4   TLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVG 63
           TL +ST  L LNTG  IPQ+GLGTW+SKEN+ YKAV+ ALK GYRHID AA+Y NE +VG
Sbjct: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62

Query: 64  QAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIK 123
           +AI+DSGVPR EIF+TTKLWCTQ   P+ ALDQSL+RLGLDYVDLYL+HWP  L    IK
Sbjct: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122

Query: 124 NEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQ 183
           + ++     K DGS+ VD+  WNFIKTWELMQ+L ++GKTKA+GVSNFS+NNLKDLLA+ 
Sbjct: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181

Query: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNN 243
             K+TPA NQVE+HPLLPQ++LI F K  GIV+EAYSPLG  +AP+L +P + EIAK N 
Sbjct: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241

Query: 244 VQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHP 303
           V+ GHVVISW VQ+G V LPKSV P RI  N K+ TLS  D   ++ + K KGE+R  + 
Sbjct: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301

Query: 304 NWSPFEVFK 312
           ++SPF +F+
Sbjct: 302 DFSPFPIFQ 310

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  405 bits (1042), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/313 (62%), Positives = 253/313 (80%), Gaps = 3/313 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKEN-DAYKAVLTALKDGYRHIDTAAIYRNE 59
           M +TL ++T  L LNTGA +P +GLGTW++ ++ + Y AV +AL+ GYRHIDTAAIY+NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDP 119
           + VG+AI++SG+PR+EIFVTTKLW TQH +P  ALDQSL+RLGLDYVDLYLMHWP  ++ 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 AYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179
            Y K+  +L  P + DGS AV+ ++W+FIKTWELMQELPKT KT+A+GVSNFSINN+ DL
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVE-SDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239
           L S GNK+ PAANQVE+HPLLPQ EL+ FC+ KGIVVEAYSP GS  APLL E  I+E+A
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299
           KK++V    V++SWH++RG  VLPKSV+ +R+ +N K F+L  +DF  INN+SKEKGEKR
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 300 VVHPNWSPFEVFK 312
           VV+ +WSPF++F+
Sbjct: 299 VVNFDWSPFKIFE 311

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 189/301 (62%), Positives = 235/301 (78%)

Query: 12  LSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGV 71
           L LNTGA IP +GLGTW+S E DAY AV++AL++GYRHIDTAAIY NE+ VG+ I+DSGV
Sbjct: 10  LKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGIRDSGV 69

Query: 72  PREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVP 131
           PREEIFVTTKLW TQ  +PE ALD SL+RLGLDYVDLYL+HWP  L+ + I + + L+ P
Sbjct: 70  PREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGNYLTFP 129

Query: 132 TKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAA 191
              DG   +DI  WNFIKTWE MQ LPK+GKTKA+GVSNFSI N++ LLA+  + + PAA
Sbjct: 130 RTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPDFIVPAA 189

Query: 192 NQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQPGHVVI 251
           NQ+EIHP LPQ ELI++CKSKGI++EAYSPLGS+ + +L +P I  IA K N +P +++I
Sbjct: 190 NQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAEPANILI 249

Query: 252 SWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNWSPFEVF 311
           SW   RGYVVLPKSVNP RIKTN K+  LSTED E IN +++  G KR V P++SPF +F
Sbjct: 250 SWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDFSPFAIF 309

Query: 312 K 312
           +
Sbjct: 310 E 310

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 239/309 (77%), Gaps = 2/309 (0%)

Query: 4   TLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVG 63
           TL +ST  ++LN G Q+P +GLGTWQSKENDAYKAV+ ALK GYRHIDTAAIY NE++VG
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 64  QAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIK 123
           +AIKDSGV R EIFVTTKLW TQH  P+ AL+QSL+RLGLDYVDLYLMHWP  ++ A  K
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 124 NED-ILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLAS 182
            ++  L +P  +DG+R +D+ +W+FIKTWELMQ LPK+ K K++GVSNFSINN+KDLLAS
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180

Query: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN 242
            GNK  P  NQVE+HPLLPQ EL+ FCKSK IVVEAYSPLGST AP+L+   I E++KK 
Sbjct: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240

Query: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVH 302
            + P +VV SW +QR  VVLPKSV   RI +N +   L  E+F  +NNIS E GEKR V 
Sbjct: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300

Query: 303 PNWSPFEVF 311
           PNW+PF  F
Sbjct: 301 PNWTPFIPF 309

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 238/312 (76%), Gaps = 1/312 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M ATL ++T  + LNTG  IPQ+GLGTW+SKE D YKAV  ALK GYRHID AAIY NE+
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           +VG+AI+DSG+PREE+F+TTKLW TQ   P+ AL+QSL+RLGL+YVDLYLMHWP  L   
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            I + ++LS P K+DG   VD T W+F+KTWELMQELPKT K ++VGVSNFSINNLK+LL
Sbjct: 121 RITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           AS GNKL PA  QVEIHPLLPQ  L +FCK   I VEAYSPLG   AP+L +P+I +IA 
Sbjct: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           ++N   G+VV+SW VQRG V LPKS  P+R+ +N + F LS E+  +INN+SK +G+KR 
Sbjct: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299

Query: 301 VHPNWSPFEVFK 312
             P+ SPF +F+
Sbjct: 300 NAPDMSPFPLFE 311

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  395 bits (1016), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 177/301 (58%), Positives = 240/301 (79%)

Query: 12  LSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGV 71
           L +NTG  IP +GLGTW++ + D Y+AVL AL+ GYRHIDTAAIYRNE  VG+AI+DSGV
Sbjct: 6   LQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSGV 65

Query: 72  PREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVP 131
           PRE+IFVTTKLWCTQ  +P+ AL+ SL+RLGLDYVDLYLMH+P  L    IK+ ++LS+P
Sbjct: 66  PREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSIP 125

Query: 132 TKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAA 191
            + DG+R VDI  W+F+KTW+LMQ+LPK+GKTKA+GVSNFSI N++++L  +     PAA
Sbjct: 126 VRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPAA 185

Query: 192 NQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQPGHVVI 251
           NQ+EIHP LPQDELI +CKSKGI+VEAYSPLGS+++ +L +P ++++A+K+ V+P  ++I
Sbjct: 186 NQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQILI 245

Query: 252 SWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNWSPFEVF 311
           SW V RGY +LPKSVN  R+++N KI  LS+ D + I+ I ++ G KR V P+W+PF ++
Sbjct: 246 SWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPFPMY 305

Query: 312 K 312
           +
Sbjct: 306 E 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  395 bits (1016), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 177/301 (58%), Positives = 240/301 (79%)

Query: 12  LSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGV 71
           L +NTG  IP +GLGTW++ + D Y+AVL AL+ GYRHIDTAAIYRNE  VG+AI+DSGV
Sbjct: 6   LQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSGV 65

Query: 72  PREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVP 131
           PRE+IFVTTKLWCTQ  +P+ AL+ SL+RLGLDYVDLYLMH+P  L    IK+ ++LS+P
Sbjct: 66  PREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSIP 125

Query: 132 TKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAA 191
            + DG+R VDI  W+F+KTW+LMQ+LPK+GKTKA+GVSNFSI N++++L  +     PAA
Sbjct: 126 VRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPAA 185

Query: 192 NQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQPGHVVI 251
           NQ+EIHP LPQDELI +CKSKGI+VEAYSPLGS+++ +L +P ++++A+K+ V+P  ++I
Sbjct: 186 NQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQILI 245

Query: 252 SWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNWSPFEVF 311
           SW V RGY +LPKSVN  R+++N KI  LS+ D + I+ I ++ G KR V P+W+PF ++
Sbjct: 246 SWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPFPMY 305

Query: 312 K 312
           +
Sbjct: 306 E 306

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  391 bits (1005), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 190/308 (61%), Positives = 234/308 (75%), Gaps = 2/308 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           MPA L ++T I  LNTGA IP +G GTW+S E + Y AVL+A+KDGYRHID+AA+Y NE 
Sbjct: 1   MPA-LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEA 59

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
            VG+AI+DSGVPREE+FVTTKLW TQ  EP  ALDQSL+RLGLDYVDLYL+HWP  +   
Sbjct: 60  AVGRAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTD 119

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            I + ++ S+PTK+DG   VD T W++IKTW+LMQELP TGKT+AVGVSN S++ L+ LL
Sbjct: 120 RITDGNLFSIPTKEDGKPDVD-TEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLL 178

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           A +GNK+ PA  QVE HPLLPQ++L++FC    I++EAYSPLGS  +PL+ EPVI EIAK
Sbjct: 179 ADKGNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAK 238

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K N  P  ++ISW ++RGYVVLPKSV P RIK+N +   L  EDFE IN +  EKGEKRV
Sbjct: 239 KYNADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRV 298

Query: 301 VHPNWSPF 308
             P W  F
Sbjct: 299 NDPEWFTF 306

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 232/303 (76%), Gaps = 1/303 (0%)

Query: 7   DSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI 66
           +S+ +  L TGA IP +G GTW+S E D Y AVLTALK GYRHIDTAA+Y NE  VG+AI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 67  KDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNED 126
           +DSGVPR+++FVTTKLW TQH +P +ALDQSL+RLGLDYVDLYL+HWP  L    I + +
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 127 ILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNK 186
           + +VPTK+DG   VD   W+++KTWE+MQ+LP T KT+AVGVSNFS+  L++LLA+ G K
Sbjct: 126 LFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 187 LTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQP 246
           + PA NQVE HPLLPQD+L  FC    I++EAYSPLGS  +PL++EP + EIA K+N  P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 247 GHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNWS 306
             V+ISW ++RGYV+LPKSV P RI++N KI  L+ +DF  INNI KEKGEKR+  P+W 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 307 PFE 309
            F+
Sbjct: 305 HFD 307

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 183/302 (60%), Positives = 226/302 (74%), Gaps = 2/302 (0%)

Query: 8   STKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK 67
           ST +  LNTGA IP +GLGT+ S++   YKAVL A+K GYRHID AA+Y+NED VG+AI+
Sbjct: 7   STSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRAIR 66

Query: 68  DSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDI 127
           DSGVPREE+FVTTK+W TQH EP  AL++SL RLGLDYVDL+LMHWP  L    I + ++
Sbjct: 67  DSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDGNM 126

Query: 128 LSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKL 187
           ++VP ++D    VD T WN+IKTW LMQ+LP +GKTKAVGVSNFS+  L+ LLA  G+K+
Sbjct: 127 ITVPKREDEKPDVD-TEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGSKV 185

Query: 188 TPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQPG 247
            PA NQVE+HPLLPQ  L +FCK K I++ AYSPLGS  APLL +PVILEIA K+   P 
Sbjct: 186 VPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKADPA 245

Query: 248 HVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNWSP 307
            ++I W V+RGYV LPKSV P RI++N +I  L+  + E IN I K KGEKRVV P W  
Sbjct: 246 QIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEWFD 304

Query: 308 FE 309
           FE
Sbjct: 305 FE 306

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  371 bits (952), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 222/301 (73%), Gaps = 2/301 (0%)

Query: 12  LSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGV 71
           L LNTGA IPQ+G GTW S   DAY AV+TALK GYRHID AA+Y NE  VG+ I+DSG+
Sbjct: 11  LKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSGI 70

Query: 72  PREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVP 131
           PREEIFVTTKLW TQ  +P  ALD+SL+RLGLDYVDL+L+HWP  L P     E++L  P
Sbjct: 71  PREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVG-GPENLLKYP 129

Query: 132 TKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAA 191
           T     + +D  +W+FIKTWELMQ LPKTGKT+AVGVSNFSI NL+DLL S  + L PA 
Sbjct: 130 TPGIKPQ-IDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPAV 188

Query: 192 NQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQPGHVVI 251
           NQ EIHP LPQ ELIN+CKSKGIVVEAY PLGS+ + +L +P I EIA K +V+P +V+I
Sbjct: 189 NQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVLI 248

Query: 252 SWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNWSPFEVF 311
           +W + RGY VLPKS  P RI +N+    LS ED E I  +S+  G KR VHP++ P+ +F
Sbjct: 249 NWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPLF 308

Query: 312 K 312
           +
Sbjct: 309 E 309

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  370 bits (951), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 224/309 (72%), Gaps = 1/309 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M   L   T    LNTGAQIP +GLGTW+S + + Y A L A+K GYRHID AA+  NE 
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
            VG+AI+DSGVPREE+FVTTKLWCTQH +P+ AL QSLKRLGLDYVDLY+MHWP      
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            +K+ + + +P +KDG   VD   W+++KTWELMQELP TGKT A+GV+NFS++ LK L+
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
            S GNK+ PAA+Q+E HP LPQ+++++FCK   I++EAYSPLGS  APLL EPV+ EI+K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K +V+P  +++SW +QRG+ VL KS  P RI+ N   F +   D   IN +++E+G KR+
Sbjct: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299

Query: 301 VHPNWSPFE 309
            +P W  FE
Sbjct: 300 HNPTWFSFE 308

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  369 bits (947), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 225/312 (72%), Gaps = 1/312 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M  T  +     ++    +IP + LGTW++  N+ Y AVL ALK GYRHID AAIY NE+
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           +VG+AI+DSG+PR++IFVTTKLW T+   P  ALD SLKRLGLDYVDLYLMHWP  L   
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            I + D+L++P    G   +DI NWNFIKTWELMQELP T K KA+GVSNFSINNL +LL
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           A+   K  PAANQ EIHPLLPQ+ELI +C+ K I+VEAY PLG ++ PL+  PVI EIA 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K  V  G ++ISW +QRGYVVLPKSV  +RI TN +  T+  E+FE +NN++KE G +R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 301 VHPNWSPFEVFK 312
           V+ ++SPF  ++
Sbjct: 300 VNIDFSPFPTYQ 311

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 235/312 (75%), Gaps = 1/312 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M  TL + T+ ++LN G +IP IGLGT+ SK+N+ Y+AV+TA K GYRH+DTAA Y+NE+
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           QVG+A+KD GVPR E++VTTK+W T+  +PE ALD+SLKRLGL+Y+DLYLMHWP  L   
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            IK+ +++ +P   DG+  VD  +W F++ WE MQ+L K+GK K++GVSNFSINN+K+LL
Sbjct: 121 TIKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           A+    + P  NQVE+ PLLP DELI FC+SK I+ +AY P G ++APL+K+  ++EIAK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
            N V  G V+ SWHVQRGYVVLPKSV   RI +N K FTLS  D   +NNISK +GEKR+
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 301 VHPNWSPFEVFK 312
            + N+SPF +F+
Sbjct: 300 NNVNFSPFPIFE 311

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/305 (57%), Positives = 222/305 (72%), Gaps = 1/305 (0%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD 68
           T    LNTGA +P IGLGTW+S E DAY AVL+ALK GY+HIDTAAIYRNE  VG+AI+D
Sbjct: 8   TPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKAIRD 67

Query: 69  SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDIL 128
           SG+PR+E+F+TTKLW TQH +P+ ALD SL+RLGLDYVDLYL+H+P       I++ +  
Sbjct: 68  SGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIEDGNPF 127

Query: 129 SVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLT 188
             P   +G R VDI +W+F+KTW L+Q LP++GK KAVGVSNFSINNLK LL S      
Sbjct: 128 CFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDEKFAV 187

Query: 189 PAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKK-NNVQPG 247
           PA NQVEIHP LPQ ELI+FCKSK IVVEAYSPLGST + +L +  + +IA+K  + QP 
Sbjct: 188 PAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXDAQPA 247

Query: 248 HVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHPNWSP 307
            ++I+W + RGY VLPKSV P RI+ N +I  +  ED   + N+    G KR + P+WSP
Sbjct: 248 QILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEPDWSP 307

Query: 308 FEVFK 312
           F +F+
Sbjct: 308 FPIFE 312

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  354 bits (908), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 224/309 (72%), Gaps = 2/309 (0%)

Query: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60
           M   L   T   +LNTGA+IP +GLGTW+  +   YKA+L ALK GYRHID+AA+  NE 
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
            +G+AI+DSGV R+E+FVTTKLW TQH +P  ALDQSLKRLGL+YVDLY+MHWP      
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
            IK ++ + +P   +G   VD T+W+++KTWELMQ+LP T KT+A+GV+NFS+  L  LL
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
            S  NK+ PAA+Q+E HP LP DE++ FC+ KGI++EAYSPLG    PL+ EPVI EI+K
Sbjct: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300
           K +V+P  ++ISW ++RG  VLPKS    RI++N ++F LS ED+E I+ I++E+G KR 
Sbjct: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298

Query: 301 VHPNWSPFE 309
            +P W  FE
Sbjct: 299 HNPPWFSFE 307

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  329 bits (843), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 166/310 (53%), Positives = 221/310 (71%), Gaps = 1/310 (0%)

Query: 3   ATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQV 62
           ATL  ST  ++LNTGA+IP  GLGTWQS ++DA  AV  ALK GY+HIDTA+ Y+NE+ V
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELV 64

Query: 63  GQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
           G+A+K+SG+PREE+F+TTK+W  Q  +P  ALD SLK+LG +YVDL LMHWP        
Sbjct: 65  GKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPEN 124

Query: 123 KNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLAS 182
              D   VP   DG    D   W+F+KTW LMQ+L  TGK KA+GVSNFSINNL++LL +
Sbjct: 125 STLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNA 183

Query: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN 242
           +G  + PA NQVE+H  LPQ EL+ +C+ KGIVVEAYSPLGS+ APLLK+  + ++A+K 
Sbjct: 184 EGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKY 243

Query: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVH 302
            V P HV++++   RG VVLPKSV   RI +N + F +  ED + +N+I K++G +R V 
Sbjct: 244 GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVD 303

Query: 303 PNWSPFEVFK 312
           P++SPF +F+
Sbjct: 304 PDFSPFPLFQ 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  223 bits (569), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 183/296 (61%), Gaps = 15/296 (5%)

Query: 8   STKI-LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ 64
           ST+I  +LN G +IP IGLGT   K+   +  +AV  A++ GYRHIDTA  Y+ E  +GQ
Sbjct: 6   STEIYFNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQ 65

Query: 65  AIKD----SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           A+K+    + + REE+F+TTK+W T  + P  ++DQSLK LG+DYVDL L HWP      
Sbjct: 66  ALKELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKV 125

Query: 121 YIKNEDILSVPTKKDGSRAVDI-TNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNL 176
                +I+ +P  KDG+   +   +W F  T++ ++++   PK  + +A+GVSN+ I  L
Sbjct: 126 ENSQGNIIGLPRDKDGNALFEKDADWLF--TYKALEKIYLDPKDNRVRAIGVSNYPIEYL 183

Query: 177 KDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVIL 236
           + L   +  K+TPA NQVE+HP LPQ EL  FC    I++ AYSPLGS  AP LK   + 
Sbjct: 184 ERLF--KECKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQ 241

Query: 237 EIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNIS 292
           ++AKK  V+P  ++ S+H+ +G VVLP+S+NP RI  N     L+ +D   ++ + 
Sbjct: 242 DLAKKYKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVG 297

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  222 bits (566), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 117/290 (40%), Positives = 182/290 (62%), Gaps = 12/290 (4%)

Query: 12  LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK-- 67
            +LN G +IP IGLGT   K    +  KAV  A++ GYR IDTA  Y+ E  +G+A+K  
Sbjct: 11  FNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKEL 70

Query: 68  --DSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNE 125
             D  + RE++F+TTK+W     +P  ++++SLK LG+DYVD+ L HWP      Y +N 
Sbjct: 71  FRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKTYDENG 130

Query: 126 DILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNLKDLLAS 182
            I+  P  KDG + +     ++I T++LM+++   PK  + +A+GVSN+ I  L+ ++  
Sbjct: 131 TIIGKPLDKDG-KVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVIKE 189

Query: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN 242
              K+TP  NQVE+HP LPQ EL +FC   GI++ AYSPLGS  AP  K P++ E AKK+
Sbjct: 190 --CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAKKH 247

Query: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNIS 292
            V P  ++ S+HV++G VV+P+S+NP+R+ +N     L+  + +++++  
Sbjct: 248 EVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  218 bits (556), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 185/292 (63%), Gaps = 10/292 (3%)

Query: 12  LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
            +LNTGA+IP +GLGT    E       AV  A+K+GYR IDTA +Y +E  +G+A+++ 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 69  ---SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNE 125
                V RE++F+TTK+W   ++  E +L +SLK+L LDYVDL L HWP      Y ++ 
Sbjct: 71  FEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHG 130

Query: 126 DILSVPTKKDGSRAVDITNWNFIKTWELMQELPK--TGKTKAVGVSNFSINNLKDLLASQ 183
            + S P        V     +++ TW+ ++++ K  +G+ + +GVSN+ +  L+ LL   
Sbjct: 131 KLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE- 189

Query: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNN 243
             ++ P  NQVE+HPLLPQ+EL  +C S GI++E++SPLGS+  P L+ P++ E++KK +
Sbjct: 190 -TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYD 248

Query: 244 VQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEK 295
            +PG V++++HV++G VV+P+S+N  RI  N     LS ED + ++ + +EK
Sbjct: 249 CEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREK 300

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  208 bits (530), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 187/301 (62%), Gaps = 17/301 (5%)

Query: 12  LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
            +LN G ++P +GLGT    E      +AV  A+K GYRHIDTA  YR ED++G+A+K+ 
Sbjct: 11  FTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKEL 70

Query: 69  ---SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPA---RL-DPAY 121
                + RE+IF+TTK+W T     + ++ +SL+ LG+DYVDL L HWP    RL DP  
Sbjct: 71  FEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNRLQDPEG 130

Query: 122 IKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQE--LPKTGKTKAVGVSNFSINNLKDL 179
           I  + I   PT +DGS   +    ++++T++ +++  L K  + +++GVSN+ +  L+ L
Sbjct: 131 I--DGICRNPTHEDGSPHYN-EKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLERL 187

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239
           L     K+ PA NQVE+HP LPQ EL +FC    I +EA+SP G+T +P++K  ++ ++A
Sbjct: 188 LKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQKVA 245

Query: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299
           +K +  P  V+I++H+++G V +P+SVNP  I +N +   LS ED + +N    E  ++ 
Sbjct: 246 QKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFGVENPKRL 305

Query: 300 V 300
           V
Sbjct: 306 V 306

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  208 bits (529), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 187/310 (60%), Gaps = 22/310 (7%)

Query: 12  LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
            +LN G ++P +GLGT    E   +  +AV  A+K GYRHIDTA  Y  E  VG+AIK+ 
Sbjct: 25  FTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 69  ---SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARL----DPAY 121
                + RE++F+TTK+W     E E +L +SLK +GLDYVDL+L HWP       DP  
Sbjct: 85  LEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEKVKDPKG 144

Query: 122 IKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNLKD 178
           I    ++  P  K G  A+  +N ++++T++ ++++   P   + +A+GVSNFSI  L+ 
Sbjct: 145 ISG--LVKTPVHKSG-EAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLER 201

Query: 179 LLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEI 238
           L+  +  ++ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP LK P++ ++
Sbjct: 202 LV--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKL 259

Query: 239 AKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEK 298
            +K NV    V+IS+H+++G +V+P+S+NP RI ++ +   L+ ++ + +N+     GEK
Sbjct: 260 VEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDF----GEK 315

Query: 299 RVVHPNWSPF 308
             V     PF
Sbjct: 316 YPVRFIDEPF 325

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  207 bits (527), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 187/310 (60%), Gaps = 22/310 (7%)

Query: 12  LSLNTGAQIPQIGLGTW--QSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
            SLN G +IP +GLGT   Q K  +  +AV  A+K GYRHIDTA  YR E  VG+AIK+ 
Sbjct: 25  FSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVGEAIKEL 84

Query: 69  ---SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARL----DPAY 121
                + RE++F+TTK+W     E + +L++SLK LGLDYVDL L HWP       DP  
Sbjct: 85  LEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEKVKDPKG 144

Query: 122 IKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNLKD 178
           I    ++  P   D  + V  +N ++++T++ ++++       + +A+GVSNFSI  L+ 
Sbjct: 145 ISG--LVKTPVD-DSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLER 201

Query: 179 LLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEI 238
           L+  +  K+ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP LK P++ ++
Sbjct: 202 LI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKL 259

Query: 239 AKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEK 298
            +K NV    ++IS+H+++G +V+P+S+NP RI +N +   L+ ++ + +N    E GEK
Sbjct: 260 CEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN----EFGEK 315

Query: 299 RVVHPNWSPF 308
             V     PF
Sbjct: 316 YPVRFIDEPF 325

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  204 bits (520), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 185/304 (60%), Gaps = 24/304 (7%)

Query: 8   STKI-LSLNTGAQIPQIGLGTWQSKENDA--YKAVLTALKDGYRHIDTAAIYRNEDQVGQ 64
           ST+I   LN G  +P +GLGT   +E+ A   +AV  A+K GYRHIDTA  Y  E  +G 
Sbjct: 6   STEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGD 65

Query: 65  AIKD----SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
           A+K+      V R ++F+T+K+W     + +++L++SLK LGLDYVDLYL HWP      
Sbjct: 66  ALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPL----C 121

Query: 121 YIKNED-------ILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSN 170
           + K ED       +   P  KDG+ A+ +   +++ T++ M+++   PK  + +A+GVSN
Sbjct: 122 FQKIEDSKDGVNGLKGKPIDKDGN-ALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSN 180

Query: 171 FSINNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLL 230
           + +  L  LL     K  PA NQVE+HP LPQ EL  FC+   I + AYSPLGS+ APLL
Sbjct: 181 YPVEYLDRLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLL 238

Query: 231 KEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINN 290
           K P++ E+++K  V    V+IS+H+++G  V+P+S+NP R+       TL+  + + +++
Sbjct: 239 KLPLVKELSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDD 298

Query: 291 ISKE 294
           I ++
Sbjct: 299 IGRK 302

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  205 bits (521), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 182/300 (60%), Gaps = 22/300 (7%)

Query: 12  LSLNTGAQIPQIGLGTW--QSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
            SLN G +IP +GLGT   Q K  +  +AV  A+K GYRHIDTA  Y  E  VG+AIK+ 
Sbjct: 25  FSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 69  ---SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARL----DPAY 121
                + RE++F+TTK+W     E + +L++SLK LGLDYVDL L HWP       DP  
Sbjct: 85  LEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGKVKDPEG 144

Query: 122 IKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNLKD 178
           I     L V    D  + V  +N ++++T++ ++++       + +A+GVSNFSI  L+ 
Sbjct: 145 ISGYMKLPV---DDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLER 201

Query: 179 LLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEI 238
           L+  +  K+ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP LK P++ ++
Sbjct: 202 LI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKL 259

Query: 239 AKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEK 298
            +K NV    ++IS+H+++G +V+P+S+NP RI +N +   L+ ++ + +N    E GEK
Sbjct: 260 CEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN----EFGEK 315

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  204 bits (520), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 187/310 (60%), Gaps = 22/310 (7%)

Query: 12  LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK-- 67
            SLN G +IP +GLGT    E   +  +AV  A+K GYRHIDTA  Y  E  VG+AIK  
Sbjct: 25  FSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 68  --DSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARL----DPAY 121
             D  + RE++F+TTK+W     E + +L++SLK LGL+YVDL L HWP       DP  
Sbjct: 85  LEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKG 144

Query: 122 IKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNLKD 178
           I    ++  P   D  + +   + ++++T++ ++++   P   + +A+GVSNFSI  L+ 
Sbjct: 145 ISG--LVKTPVD-DSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLER 201

Query: 179 LLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEI 238
           L+  +  ++ P  NQVE HP LPQ EL  FC    I++ AYSPLGS  AP LK P++ ++
Sbjct: 202 LI--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKKL 259

Query: 239 AKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEK 298
           A+K NV    ++IS+H+++G +V+P+S+NP RI ++ +  +L+ ++ + +N+     GEK
Sbjct: 260 AEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDF----GEK 315

Query: 299 RVVHPNWSPF 308
             V     PF
Sbjct: 316 YPVRFIDEPF 325

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  204 bits (519), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 124/313 (39%), Positives = 189/313 (60%), Gaps = 17/313 (5%)

Query: 12  LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
            +LN G ++P IGLGT    E      +AV  A+K GYRHIDTA  Y+ ED+VG+A+K+ 
Sbjct: 11  FTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGEALKEL 70

Query: 69  ---SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPA---RL-DPAY 121
                V RE+IFVTTK+W T     + ++ +SL+ LGLD+VDL L HWP    RL DP  
Sbjct: 71  FEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNRLEDPDG 130

Query: 122 IKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQEL--PKTGKTKAVGVSNFSINNLKDL 179
           I  + +   P  +DGS   +    ++++T++ +++L   K  + +A+GVSN+ +  L+ L
Sbjct: 131 I--DGVRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYLERL 187

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239
           L  +  ++ PA NQVE HP LPQ EL +FC    I +EAYSPLG+T+APL+   ++ +IA
Sbjct: 188 L--KECQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVKKIA 245

Query: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299
            K      +V+I++H+++G V +P+SVNP  I +N +   LS ED + +N    E  ++ 
Sbjct: 246 GKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVENTKRI 305

Query: 300 VVHPNWSPFEVFK 312
           V  P  +    F+
Sbjct: 306 VDEPFAAAIPGFR 318

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  204 bits (519), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 120/309 (38%), Positives = 187/309 (60%), Gaps = 20/309 (6%)

Query: 12  LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK-- 67
            SLN G +IP +GLGT    E   +  +AV  A+K GYRHIDTA  Y  E  VG+AIK  
Sbjct: 25  FSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 68  --DSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNE 125
             D  + RE++F+TTK+W     E + +L++SLK LGLDYVDL+L HWP   +   +K+ 
Sbjct: 85  LEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEK--VKDP 142

Query: 126 DILSVPTKK---DGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNLKDL 179
             LS   K    D  + +  +N ++++T++ ++++   P   + +A+GVSNFSI  L+ L
Sbjct: 143 KGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLERL 202

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239
           +  +  ++ P  NQVE HP LPQ  +  FC    I++ AYSPLGS  AP LK P++ ++ 
Sbjct: 203 I--KECRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLT 260

Query: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299
           +K N+    V+IS+H+++G +V+P+S+NP RI ++ +   L+ ++ + +N+     GEK 
Sbjct: 261 EKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDF----GEKY 316

Query: 300 VVHPNWSPF 308
            V     PF
Sbjct: 317 PVRFIDEPF 325

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  202 bits (513), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 186/306 (60%), Gaps = 16/306 (5%)

Query: 8   STKI-LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ 64
           ST+I   LN G  IP +G GT+  +E   +  +AV  A+K GYRHIDTA +Y +E  VG+
Sbjct: 6   STEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGE 65

Query: 65  AIKD----SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWP---ARL 117
           AIK+      V R ++FVTTK+W       E +L++SL+ LGLDYVDL L HWP    R+
Sbjct: 66  AIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPRV 125

Query: 118 DPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSIN 174
           +        +++ P   +G   ++    +F++T+  ++++   P   + +A+GVSN++I 
Sbjct: 126 EDEKNGVNGLVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIE 184

Query: 175 NLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPV 234
            L+ L      K+ P  NQVEIHP LPQ EL  FC + GI++ AYSPLGS  AP LK P+
Sbjct: 185 YLEALFKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPL 242

Query: 235 ILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKE 294
           + ++A+K ++    ++IS+H+++G  V+P+S+NP RI +  +    + E+ + ++N+  E
Sbjct: 243 VHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGIE 302

Query: 295 KGEKRV 300
           +  + V
Sbjct: 303 EPARFV 308

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  196 bits (498), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 178/298 (59%), Gaps = 22/298 (7%)

Query: 12  LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
            +LN G +IP +GLGT   K+      +AV  A+K G+R IDTA  Y  E+ +G+A+++ 
Sbjct: 11  FNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQEL 70

Query: 69  ---SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNE 125
                V RE++F+TTK+W     + E +L++SLKRL LDYVDL L HWP      ++K +
Sbjct: 71  FAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPF----CFVKKQ 126

Query: 126 D------ILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNL 176
           D      +++ P  +DGS   D T  ++++T++ ++ +       + +A+GVSN+ I  L
Sbjct: 127 DPEGSGQLVNHPQHEDGSPFYD-TAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYL 185

Query: 177 KDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVIL 236
           + L      K  PA NQVE+HP LPQ EL ++C   GI++ +YSPLGS  AP L+ P++ 
Sbjct: 186 ERLFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQ 243

Query: 237 EIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKE 294
           E+A K N     V++S+H+++G +V+P+S+N +RI        L+ E+ + +N    E
Sbjct: 244 ELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVE 301

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  194 bits (494), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/309 (37%), Positives = 182/309 (58%), Gaps = 20/309 (6%)

Query: 8   STKI-LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ 64
           ST+I  + N G ++P  GLGT    E   +  +AV  A+K GYRHIDTA  Y  E+ VG+
Sbjct: 6   STEIYFTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGE 65

Query: 65  AIKD----SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARL--- 117
           A+++      V RE++ +T+K+W T  ++ + +L++SL RL +DYVDL+L HWP      
Sbjct: 66  ALQELFEERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKV 125

Query: 118 -DPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSI 173
            DP  +  + I   P    G+   D    ++I+T++ ++++       + +A+GVSNF I
Sbjct: 126 PDPHGV--DKIAKEPVDDQGNPLYD-EKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPI 182

Query: 174 NNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEP 233
             LK +L     +  PA NQVE+HP LPQ EL  FC    I+V AYSPLG   APLL+ P
Sbjct: 183 EYLKRVLKE--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELP 240

Query: 234 VILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISK 293
           ++  + +K N  P  ++ S+H+++G +V+P+S+N  RI +N +   LS ED   +N    
Sbjct: 241 ILKGLCEKYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFG- 299

Query: 294 EKGEKRVVH 302
           +K +KR ++
Sbjct: 300 QKNKKRYIN 308

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  189 bits (481), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 172/288 (59%), Gaps = 19/288 (6%)

Query: 8   STKI-LSLNTGAQIPQIGLGTWQSKEN--DAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ 64
           ST+I   LN G ++P IGLGT    E   +  +AV  A+K GYR+IDTA  Y +E  VG+
Sbjct: 6   STEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVGE 65

Query: 65  AIKD----SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWP----AR 116
           AIK+      + RE++F+T+K+W     + E +L +SLK LG+DY+DL+L HWP     R
Sbjct: 66  AIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNRR 125

Query: 117 LDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSI 173
            DP  I    +   P K DGS   +    +++ T++ M+ +   PK  + +A+GVSNF +
Sbjct: 126 EDPHGING--LARNPEKADGSPDFN-EKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPV 182

Query: 174 NNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEP 233
             LK +L  +   + P  NQVE+HP LPQ EL  FC    I + AYSPLGS  AP++K P
Sbjct: 183 EYLKRVL--KECPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHP 240

Query: 234 VILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLS 281
           +I E+++K       ++ S+H+++G  V+P+S+N  RI +N +   LS
Sbjct: 241 LIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLS 288

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  189 bits (479), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/310 (35%), Positives = 185/310 (59%), Gaps = 23/310 (7%)

Query: 12  LSLNTGAQIPQIGLGTW--QSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
            +LN G ++P +GLGT     +     +AV  A+K GYRHIDTA  Y +E  VG+AIK+ 
Sbjct: 14  FTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKEL 73

Query: 69  ---SGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNE 125
                + RE+IF+T+K+W     + E +L++SL+ LG+DY+DL+L HWP      Y+K E
Sbjct: 74  MEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPL----CYVKQE 129

Query: 126 DILSV------PTKKDGSRAVDITNWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNL 176
           D   +      P   +G    ++   ++++T+  M+++   P   + +++GVSNF +  L
Sbjct: 130 DTHGINGLARNPETPNGEPYYEVDG-DWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYL 188

Query: 177 KDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVIL 236
           +  L     K  PA NQVE+HP LPQ EL  FC++  I++EAYSPLGS +AP +   ++ 
Sbjct: 189 ERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQ 246

Query: 237 EIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKG 296
           ++A+K ++ P  ++ S+H+++G  V+ +SVN  RI +N +   L+ E+ + ++ +   K 
Sbjct: 247 DLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITK- 305

Query: 297 EKRVVHPNWS 306
            KR V+  W+
Sbjct: 306 PKRFVNEKWN 315

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  184 bits (466), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 110/308 (35%), Positives = 169/308 (54%), Gaps = 25/308 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVG----Q 64
           T+  +LN G ++P +GLG W+   + A   V  A+K GYR  D A  Y NE ++G    Q
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 65  AIKDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
           AI +  V RE++F+ +KLWC  HH   V  AL ++L  LGLDYVDLY +H+P  +    +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 123 KNEDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           + +    + T ++  R   ++      + T+  M++L   G  K++G+SNF    ++DLL
Sbjct: 124 EEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLL 183

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTD------------AP 228
             +G ++ P A QVE+HP L Q+ L+ + +SK I V AYS  G                P
Sbjct: 184 --RGARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTP 241

Query: 229 LLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTN---RKIFTLSTEDF 285
           LL+  ++L IAKK++V P  V++ W  QRG  V+PKS   +R+  N    K  TLS  + 
Sbjct: 242 LLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSEM 301

Query: 286 EAINNISK 293
             I +++K
Sbjct: 302 SDIFSLNK 309

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  175 bits (444), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 170/309 (55%), Gaps = 27/309 (8%)

Query: 8   STKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK 67
           + + + LN GA +P +GLG W+     A + V  A+K GYR +D A  Y NE +VGQ I+
Sbjct: 29  NVRTIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIR 88

Query: 68  ---DSG-VPREEIFVTTKLWCTQHHEPE---VALDQSLKRLGLDYVDLYLMHWPARLDPA 120
              D G V REE+FV +KLW   +H PE    AL ++L  LGLDY+DL+ +H+P      
Sbjct: 89  RAIDEGLVRREELFVVSKLW-NNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFV 147

Query: 121 YIKNEDILSVPTKKDGSRAVDITN--WNFIKTWELMQELPKTGKTKAVGVSNFSINNLKD 178
            ++      + T     +A  +       I+T+  +++L   G+ +A+G+SNF    ++D
Sbjct: 148 PLEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQD 207

Query: 179 LLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STD 226
           LL  +G ++ PAA Q+E HP L Q+ L+ + KS+G+ V  YS LG               
Sbjct: 208 LL--RGCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNA 265

Query: 227 APLLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTE 283
           APLL+  V+  IA+++   P  V++ W  QR   V+PKS   +R+ TN ++    TL+ +
Sbjct: 266 APLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADD 325

Query: 284 DFEAINNIS 292
           +   +++++
Sbjct: 326 ELRELSSLN 334

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  174 bits (440), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 166/307 (54%), Gaps = 25/307 (8%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK-- 67
           K+L+LN G ++PQ+GLG W+   +     V  A+K GYR  D A  Y NE +VG+ +K  
Sbjct: 3   KLLTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRA 62

Query: 68  --DSGVPREEIFVTTKLWCTQHHEPEVALD--QSLKRLGLDYVDLYLMHWPARLDPAYIK 123
             D  V R+++FV +KLW   HH   V L+  ++LK LGLDY+DLY +H+P       ++
Sbjct: 63  MDDGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPME 122

Query: 124 NEDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLA 181
                 + T K       +T  N   + T+  ++E  + G  K++G+SNF+   + D+L 
Sbjct: 123 ERYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADIL- 181

Query: 182 SQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STDAPL 229
            +G  + P A Q+E HP L Q++L+ +CK   + V  YS  G                PL
Sbjct: 182 -RGCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPL 240

Query: 230 LKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTEDFE 286
              PVI +IA+K+NV    V++ W  QRG  ++PKS +  R+ +N  I    TL+ ED +
Sbjct: 241 FDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLK 300

Query: 287 AINNISK 293
           +I+ +++
Sbjct: 301 SISGLNQ 307

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  172 bits (435), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 156/293 (53%), Gaps = 38/293 (12%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K  +L  G  +P +GLG +   +N   + V  ALK GYRH DTA  Y NE +VG+ I   
Sbjct: 4   KTYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAW 63

Query: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRLG-LDYVDLYLMHWPARLDPA 120
                S   R+++F  TKLW +Q  + E + A+ Q L+++  L Y+DL L+H PA     
Sbjct: 64  LAEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPA----- 118

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                                  +   + T+E MQE    G  K++GVSN+  ++L++L 
Sbjct: 119 ---------------------CGSAKRLATYEAMQESVDAGIVKSIGVSNYERHHLQELY 157

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           A    K  P  NQ+E+ P LP+++L+++CKS G+ ++AYSPLG  D   + +P I  +A 
Sbjct: 158 AMPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLAT 215

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISK 293
           + N  P  ++I+W + +GY  LPK+ N  R+++N   + +S    E + NI K
Sbjct: 216 QKNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVSLTA-EELTNIEK 267

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  172 bits (436), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 107/308 (34%), Positives = 167/308 (54%), Gaps = 25/308 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK- 67
           + +++LN G ++P +GLG W+   +   + V  A+K GYR  D A  Y NE +VGQ I+ 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
             D G V RE++FV +KLW + HH   V  AL ++L  +GLDY+DL+ +H+P        
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 KNEDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           + +      T K+  +   IT  +   I T+  +++  + G  K++G+SNFS + ++DLL
Sbjct: 122 EEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL 181

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYS------------PLGSTDAP 228
             +  K+ P A QVE HP L Q+ L+ +CK  GI V AYS            PL      
Sbjct: 182 --RQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPN 239

Query: 229 LLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTEDF 285
           L     I +IA  +NV    V++ W  QRG  ++PKS   +R++ N  I    TL+ ++ 
Sbjct: 240 LFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKEL 299

Query: 286 EAINNISK 293
           EAI+ ++K
Sbjct: 300 EAISKLNK 307

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  171 bits (433), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/328 (33%), Positives = 178/328 (54%), Gaps = 32/328 (9%)

Query: 11  ILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ----AI 66
           +++LN G ++P +GLG W+       + +  A+  GYR  D A  Y NE +VG+    AI
Sbjct: 4   VVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRRAI 63

Query: 67  KDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYIKN 124
           KD  V REE+FV +KLW + HH   V  AL ++L  +GLDY+DL+ +H+P  L P   + 
Sbjct: 64  KDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSFEE 123

Query: 125 EDILSVPTKKDGSRAVDITN--WNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLAS 182
           +    + T +  ++A  ++      + T+  ++E  + G  K++GVSNFS + + DLL  
Sbjct: 124 KYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDLL-- 181

Query: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STDAPLL 230
           +G ++ PAA Q+E+HP L Q+  + + +SKGI V AYS  G                PL 
Sbjct: 182 RGARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATPPLF 241

Query: 231 KEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTEDFEA 287
           +  V+ +IA K+NV    V++ W  Q+   V+PKS   +R++ N  +    TL+ ++ + 
Sbjct: 242 EHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGDEIKE 301

Query: 288 INNISKEKGEKRVVHP-NWS---PFEVF 311
           I+ ++K     R   P  WS   PF +F
Sbjct: 302 ISGLNK---NLRFNDPFTWSEKTPFPIF 326

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  170 bits (430), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 109/308 (35%), Positives = 162/308 (52%), Gaps = 25/308 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ---- 64
           + + +LN G ++P +GLG W+       + V  A+K GYR  D A  Y NE +VGQ    
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 65  AIKDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
           AI +  V R ++F+ +KLW T HH   V  A+ ++L  LGLDY+DLY +H+P       I
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 123 KNEDILSVPT-KKDGSRA-VDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           + +      T K+D ++  + +    ++ T+  M+ L + G  K++GVSN     L+D+L
Sbjct: 122 EEKYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVL 181

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGST-----------DAP- 228
              G K+ P   Q+E HP L Q  L+++CK + I+V AYS  G             D P 
Sbjct: 182 --MGCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPN 239

Query: 229 LLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTEDF 285
           L   PVI  IA K NV    V++ W  Q G  V+PKS   +R+  N  I    TLS E+ 
Sbjct: 240 LFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEEL 299

Query: 286 EAINNISK 293
             I+NI++
Sbjct: 300 VEISNINR 307

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  166 bits (421), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 99/280 (35%), Positives = 153/280 (54%), Gaps = 37/280 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K   L++G  IP +GLGT++   N     V  AL+ GYRH DTA +Y NE +VGQ IK  
Sbjct: 7   KSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKW 66

Query: 69  -----SGVPREEIFVTTKLWCTQH--HEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
                +   R ++F TTKLW +QH   + + A+D  L+ +  L Y+DL L+H P      
Sbjct: 67  LNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL----- 121

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                          G + + +      +T+E MQE    GK +++GVSN+   ++++LL
Sbjct: 122 ---------------GGKKLRL------ETYEAMQEAVDAGKVRSIGVSNYGFQHIEELL 160

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
             +  K  P  NQ+EI P   + EL +FCK KGI+VEAY+PL  T    LK+P ++++A 
Sbjct: 161 NWEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVAN 218

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTL 280
           +     G  +I W +Q+GY+ LPK+ +  R+ +N  +F+ 
Sbjct: 219 EVGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  167 bits (423), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 106/307 (34%), Positives = 167/307 (54%), Gaps = 26/307 (8%)

Query: 11  ILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK--- 67
           +++LN G ++P +GLG W+   +   + V  A+K GYR  D A  Y NE +VGQ IK   
Sbjct: 4   LVTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAI 63

Query: 68  DSG-VPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYIKN 124
           D G V R ++FV +KLW + HH   V  AL ++L+ LGLDY+DLY +H+P        + 
Sbjct: 64  DEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEE 123

Query: 125 EDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLAS 182
           +      T  D +R   ++      + T+  ++E    G  K++G+SNF+   ++DLL  
Sbjct: 124 KYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLL-- 181

Query: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STDAPLL 230
            G ++ P A Q+E HP L Q++L+ +CK KGI V AYS  G             +   LL
Sbjct: 182 NGCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLL 241

Query: 231 KEPVILEIAKKN-NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTEDFE 286
           + P+I +IA  + +  P  V++ W  QRG  V+PKS   +R+  N  +    TL+ E+  
Sbjct: 242 EHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEELN 301

Query: 287 AINNISK 293
            I++++K
Sbjct: 302 EISSLNK 308

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  167 bits (422), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 168/309 (54%), Gaps = 27/309 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK- 67
           ++ ++LN G  +P +GLG W+   +   + V  A+K GYR  D A  Y NE QVG  I+ 
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 68  --DSG-VPREEIFVTTKLWCTQHHEP---EVALDQSLKRLGLDYVDLYLMHWPARLDPAY 121
             D G V RE++FV +KLW T +H+P   ++AL ++L  + L+Y+DLY +H+P       
Sbjct: 62  AIDEGIVKREDLFVVSKLWNT-YHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVP 120

Query: 122 IKNEDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179
            +        T  + ++   +T      I T+  M+EL   G TK++G+SN++   ++D 
Sbjct: 121 FEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDT 180

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTD------------A 227
           L  +G ++ P   Q+E HP L Q++L+ +CK  GI V AYS  G                
Sbjct: 181 L--RGCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTP 238

Query: 228 PLLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTED 284
           PL   PVI +IA+++ V    V++ W  QRG  V+PKS +  R+  N +I    TL+ +D
Sbjct: 239 PLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 285 FEAINNISK 293
            E I++++K
Sbjct: 299 LEEISSLNK 307

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  165 bits (417), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 153/280 (54%), Gaps = 37/280 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI--- 66
           K   L++G  +P IGLGT+    N   + V  ALK GYRH+DTA +Y NE +VG+ I   
Sbjct: 8   KAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67

Query: 67  ---KDSGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
                S   RE++F  TKLW +Q  ++  + A+ +  +++ GL Y+DL L+H P      
Sbjct: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL----- 122

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                          GSR         ++T++ MQE    G  +++GVSN+ ++++ +LL
Sbjct: 123 --------------SGSR-------KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELL 161

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
                K  P  NQ+EI P L + EL ++CKS+G++VEAY+PL  T    +  P +L +AK
Sbjct: 162 NWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAK 219

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTL 280
           +     G V+I W +Q GYV LPK+ +  R+ +N  ++ +
Sbjct: 220 EAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  164 bits (416), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 157/286 (54%), Gaps = 42/286 (14%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K   L++G  +P IGLGT+     +  + V  ALK GYRH+DTA +Y NE +VGQ I+  
Sbjct: 15  KAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKW 74

Query: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRLG-LDYVDLYLMHWPARLDPA 120
                    R+++F TTKLW +Q  +   + A+ + ++++  L Y+DL L+H P      
Sbjct: 75  LEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL----- 129

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                          G+R         ++T++ MQE    G  +++GVSN+  +++ +LL
Sbjct: 130 --------------SGTR-------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELL 168

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
             +  K  P  NQ+EI P + + +L ++CKSKG+VVEA+SPL  T    LK P +L +AK
Sbjct: 169 TWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAK 226

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFE 286
           +     G V+I W +Q GYV LPKS + +R+K N K +     DFE
Sbjct: 227 ETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY-----DFE 267

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  164 bits (414), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 157/291 (53%), Gaps = 38/291 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI--- 66
           K   L +G  IP IGLGT+    ++    V  AL+ GYRH+DTA +Y NE +V Q     
Sbjct: 5   KSYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNF 64

Query: 67  --KDSGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPAY 121
             +   V RE+IF TTKLW +Q  + + + A+ + ++ + GL Y+DL LMH P       
Sbjct: 65  LGRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPI------ 118

Query: 122 IKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLA 181
                         G + V         TW+ MQE    G  +++GVS++   +L+DL  
Sbjct: 119 --------------GGKQVR------RGTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFE 158

Query: 182 SQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKK 241
               K  PA NQ+EI P + + +L ++CKSKGIVVEAYSPL  T    L +P +L++A++
Sbjct: 159 WSELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEE 216

Query: 242 NNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIF--TLSTEDFEAINN 290
               PG V++ W +Q GYV LPK+    R++ N  +F   LS E  + +++
Sbjct: 217 TGKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFDWELSPEHMKLLDH 267

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  165 bits (417), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 168/313 (53%), Gaps = 33/313 (10%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ---- 64
           T +++LN G ++P +GLG W+   +     V  A+K GYR  D AA Y NE +VGQ    
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIKDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
           A+ +  V R ++F+ +KLW T HH   V  AL ++L  LGLDY+DLY +H+P  L   Y+
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFP--LAFKYV 119

Query: 123 KNEDILSVPTKKDGSR-----AVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLK 177
             E+    P    G+       + + N  ++ T+  M++L   G TK++GVSN   + L+
Sbjct: 120 PFEEKYP-PCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQ 178

Query: 178 DLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG-----------STD 226
           D+L   G ++ PAA Q+E HP L Q+ L+ FCK++ I V +YS  G           + D
Sbjct: 179 DVL--MGCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAED 236

Query: 227 AP-LLKEPVILEIAKKN--NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTL 280
            P L   PVI +IA  +  +V    V++ W  QR   ++PKS   +R+  N  +    TL
Sbjct: 237 TPALFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTL 296

Query: 281 STEDFEAINNISK 293
           +  +   I+ ++K
Sbjct: 297 TEAELLEISALNK 309

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  164 bits (414), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/308 (34%), Positives = 165/308 (53%), Gaps = 27/308 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVG----Q 64
           +K+++LN G ++P +GLG W+   +     V  A+K GYR  D A  Y NE +VG    Q
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 65  AIKDSGVPREEIFVTTKLWCTQHHEP---EVALDQSLKRLGLDYVDLYLMHWPARLDPAY 121
           AI +  V REE+FV +KLW   +H+P   ++AL ++L  + LDY+DLY +H+P       
Sbjct: 62  AISEGIVKREELFVISKLW-NSYHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVP 120

Query: 122 IKNEDILSVPTKKDGSRAVDITN--WNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179
            + +      T K+ +    I+      I T+  M++L   G  K++G+SNF+   ++DL
Sbjct: 121 FEEKYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDL 180

Query: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG-----------STDAP 228
           L S   K+ P   Q+E HP L Q  LI +CK   I V AYS  G           + DA 
Sbjct: 181 LRS--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAK 238

Query: 229 LLKE-PVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTED 284
           +L E  VI  IA  ++V+P  V++ W  QRG  ++PKS   +R+  N  I    TLS ++
Sbjct: 239 VLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQE 298

Query: 285 FEAINNIS 292
              I++++
Sbjct: 299 LSTISDLN 306

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  164 bits (414), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 164/309 (53%), Gaps = 25/309 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK- 67
           +K ++LN G ++P IGLG W+   +     V  A+K GYR  D A  Y NE +VGQ IK 
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 68  ---DSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPA--RLDPA 120
              +  V RE++FV +KLW + HH   V  AL ++L  +GLDY+DL+ +H+P   +  P 
Sbjct: 65  AIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVPF 124

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
             K         + + +  +   +   I T+  +++    G  K++G+SNF+ + ++DLL
Sbjct: 125 EEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQDLL 184

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STDAP 228
             +G ++ P A Q+E HP L Q+ L+ +CK+ GI V AYS  G             T   
Sbjct: 185 --RGARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTTPT 242

Query: 229 LLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTEDF 285
           L +   +  IA  + V    V++ W  QRG  V+PKS   +R+  N  I    TLS ++ 
Sbjct: 243 LFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSDKEL 302

Query: 286 EAINNISKE 294
           +AI+ ++K+
Sbjct: 303 KAISALNKD 311

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  163 bits (412), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 166/310 (53%), Gaps = 27/310 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK- 67
           +++++LN G ++P +GLG W+         V  A+K GYR  D A  Y NE +VGQ I+ 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLD--PA 120
             D G V REE+FV +KLW + H    V  AL ++L  + LDY+DL+ +H+P  L   P 
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
             K    L   ++ +    +   N   I T+  +++L   G  K++G+SNFS + + DLL
Sbjct: 122 KEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDLL 181

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STDAP 228
             +G ++ P A Q+E HP L Q+ L+++ K +G+ V AYS  G             T  P
Sbjct: 182 --RGCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTPP 239

Query: 229 LLKEPVILEIAKKNN--VQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTE 283
           L + P I+EIAK +   + P  V++ W  Q    V+PKS   +R+  N  I    TL+ +
Sbjct: 240 LFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTDQ 299

Query: 284 DFEAINNISK 293
           + + I+ ++K
Sbjct: 300 ELKEISALNK 309

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  162 bits (409), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 171/310 (55%), Gaps = 44/310 (14%)

Query: 13  SLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI----KD 68
           +L  G +IP +G GT+++ +  A   V  A K GYRH+DTA +Y NE +   A+    K+
Sbjct: 10  TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69

Query: 69  S-GVPREEIFVTTKLWCTQH--HEPEVALDQSLKRLG-LDYVDLYLMHWPARLDPAYIKN 124
           S  V R+++F TTK+    H   + + ++ +SL+    L+YVDL+L+H P          
Sbjct: 70  SPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC--------- 120

Query: 125 EDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQG 184
                  T+K             + T++ +QE  K GK KA+GVS++SI +L++L + +G
Sbjct: 121 -----AETEKR------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEG 163

Query: 185 NKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN-- 242
            ++ P  NQ E++P L + +L+ +CK + +V+EA+SP+  T +    +PV+ ++ K++  
Sbjct: 164 LEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLKESYP 221

Query: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINNISKEKGEKRV 300
              P  ++I W +Q G+V LPKSV+ DR ++N     F +S ED + + +     GE  +
Sbjct: 222 GRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH----DGEHFL 277

Query: 301 VHPNWSPFEV 310
             P + P E 
Sbjct: 278 AQPGFDPIET 287

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  162 bits (410), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 151/275 (54%), Gaps = 37/275 (13%)

Query: 14  LNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK----DS 69
           LN G QIP IG G ++  + D    V +ALKDGYRHIDTA +Y+N+ +  Q ++    ++
Sbjct: 15  LNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLDET 74

Query: 70  GVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLD------YVDLYLMHWPARLDPAYIK 123
           G  RE I+ TTKLW +Q    E   +++L+ +  D      YVDL L+H P       ++
Sbjct: 75  GEARENIWFTTKLWDSQFGREET--EKALQEVAADVKEYIGYVDLLLLHSPRGGAKRRLE 132

Query: 124 NEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQ 183
              IL    ++ GS+A++I                     K++GVSNF +++L++LL  +
Sbjct: 133 TWAILEQAVQEPGSKALEI---------------------KSIGVSNFGVDHLEELL--K 169

Query: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNN 243
             K+ P  +Q+E+HP LP+ EL  + K K I  EAYSPL  T    L++P +L +  K  
Sbjct: 170 VAKVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPELLALEAKTG 227

Query: 244 VQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIF 278
           +    +++ W   +G+VVL KS NP+RI+ N  + 
Sbjct: 228 INKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVL 262

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  162 bits (411), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 103/305 (33%), Positives = 162/305 (53%), Gaps = 25/305 (8%)

Query: 12  LSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ----AIK 67
           ++LN G ++P +GLG W+   +     +  A+K GYR  D A  Y NE +VGQ    AIK
Sbjct: 8   VTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAIK 67

Query: 68  DSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNE 125
           +  V RE++ V +KLW + HH   V  AL+++L  L LDYVD++ +H+P    P     +
Sbjct: 68  EGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFDEK 127

Query: 126 DILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQ 183
                 T K+      I       + TW  +++L   GK K++G+SNFS   ++DLL  +
Sbjct: 128 YPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLL--R 185

Query: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG-----------STDAP-LLK 231
           G ++ P A Q+E HP L Q+ LI + K+ GI V AYS  G           + + P L +
Sbjct: 186 GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTLFE 245

Query: 232 EPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTEDFEAI 288
              I  IA K+ V P  V++ W  Q G  ++PKS   +R+  N +I    TL+ ++ + I
Sbjct: 246 HDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDELKQI 305

Query: 289 NNISK 293
           + +++
Sbjct: 306 SGLNQ 310

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  161 bits (407), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 99/278 (35%), Positives = 156/278 (56%), Gaps = 37/278 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K  +L+ G +IP + LGT+   ++     V  ALK GYRH DTA +Y NE +VG+ I   
Sbjct: 5   KFYTLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQW 64

Query: 69  -----SGVPREEIFVTTKLWCTQH-HEP-EVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
                    RE++F TTKLW +Q+ ++P + A+ + L+++  L Y+DL L+H P      
Sbjct: 65  LQEDPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPL----- 119

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                          GSR         ++T++ MQE    G  K++GVSN+  ++L++LL
Sbjct: 120 --------------SGSR-------KRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELL 158

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           + +G K  P  NQ+EI P   + EL  +C+S+GIVVE Y+PL  T    LK+P ++++A+
Sbjct: 159 SWEGLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAE 216

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIF 278
           +     G V+I W +Q GY+ LPK+ N DR+  N  ++
Sbjct: 217 EVGKNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVY 254

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  160 bits (405), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 157/292 (53%), Gaps = 39/292 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K  + N G QIP I LGT+   ++   K V  ALK GYRH DTA +Y NE QVG+ I   
Sbjct: 6   KYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQW 65

Query: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
                    R ++F TTKLW +Q  +H+ + A+ + L ++ GL Y+D+ L+H P      
Sbjct: 66  IQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSP------ 119

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                  L   TK+             ++TW  MQE  ++G  K +GVSN+   ++++LL
Sbjct: 120 -------LEGRTKR-------------LETWRAMQEAVESGLVKNIGVSNYGRQHVEELL 159

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
             +   + P  NQ+EI P + + EL ++CKS G+VVEA++PL  T    L +  ++ ++K
Sbjct: 160 QWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSK 217

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINN 290
           +       V+I W +Q GY+ LPK+    R++ N +   F L+TE  + I++
Sbjct: 218 EVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  160 bits (405), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 152/281 (54%), Gaps = 37/281 (13%)

Query: 7   DSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI 66
           D  K   L  G +IP + LGT+    +   K V  ALK GYRH DTA +Y NE +VGQ I
Sbjct: 6   DVPKYYELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGI 65

Query: 67  KD------SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARL 117
            +      +   RE++F TTKLW +Q  ++E + A+ + ++++ GL Y+D+ L+H P   
Sbjct: 66  VNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPL-- 123

Query: 118 DPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLK 177
                             G R         ++TW+ MQE    G  K++GVSN+  ++++
Sbjct: 124 -----------------SGQR-------RRLETWKAMQEAVDEGIVKSIGVSNYGKHHIE 159

Query: 178 DLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILE 237
           +LL     K  P  NQ+EI P + + EL ++CKS  +VVEAY+P+       + +P + E
Sbjct: 160 ELLGWDELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAH--GYKMNDPGLRE 217

Query: 238 IAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIF 278
           I+K+  + PG ++I W +Q GY+ LPK+    R+ +N  ++
Sbjct: 218 ISKETGMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  161 bits (408), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 162/309 (52%), Gaps = 25/309 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK- 67
           ++ + LN G ++P +GLG W+         V  A+K GYR  D A  Y NE +VGQ I+ 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSG-VPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPA--RLDPA 120
             D G V RE++FV +KLW + H    V  AL ++L+ LGL+Y+DL+ +H+P   +  P 
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
             +         + +    + +     + T+  +++    G  KA+GVSNF    L DLL
Sbjct: 125 EERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDLL 184

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STDAP 228
           A  G K+ PA  Q+E HP L Q++L+ +CK +GI V AYS  G             +   
Sbjct: 185 A--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTPT 242

Query: 229 LLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTEDF 285
           L +  V+ ++A  + V    V++ W  QR   ++PKS   +R+  N +I    TLS E+ 
Sbjct: 243 LFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEEL 302

Query: 286 EAINNISKE 294
           + I++++K+
Sbjct: 303 QEISSLNKD 311

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  160 bits (405), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 150/283 (53%), Gaps = 37/283 (13%)

Query: 14  LNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI----KDS 69
           LN G ++P IG G +     +  + V TAL++GYRHIDTA +Y N+ Q  Q +    +++
Sbjct: 15  LNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLEET 74

Query: 70  GVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLD------YVDLYLMHWPARLDPAYIK 123
           G PREE++ TTKLW TQ      A  ++L+ +  D      YVDL L+H P       ++
Sbjct: 75  GTPREEVWFTTKLWNTQQGRD--ATPRALEEIAADVKEFIGYVDLLLLHSPLTDAQRRLE 132

Query: 124 NEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQ 183
              +L    ++  S A++I                     +A+GVSNF + +L++LL   
Sbjct: 133 TWAVLERAVQEPASSALEI---------------------RAIGVSNFGVRHLQELLEVA 171

Query: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNN 243
             K  P  +Q+E+HP LP+ EL  F +  GI+ EAYSPL  T    L++P +L +  K+ 
Sbjct: 172 TVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPELLALEAKSG 227

Query: 244 VQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFE 286
           +  G +++ W   +G+ VL KS NP RI+ N  +    T+ ++
Sbjct: 228 LSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVLPAKTDSWK 270

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  159 bits (403), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 145/281 (51%), Gaps = 37/281 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K   L+ G  IP +GLGT+    N     V  ALK GYRH DTA +Y NE++VGQ I   
Sbjct: 7   KFYKLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRW 66

Query: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
                    RE +F TTKLW +Q  + +   A+   L ++  L+Y+DL L+H P      
Sbjct: 67  LLEDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL----- 121

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                          G++         ++TW+ MQE    G  K++GVSN+ ++++ +LL
Sbjct: 122 --------------GGTKLR-------LETWKAMQEAVDHGMVKSIGVSNYGMHHIDELL 160

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
             Q  K  P  NQ+EI P L + EL ++CKS  I VE YSPL  T    L +  + ++A 
Sbjct: 161 TWQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVAN 218

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLS 281
           +     G V+I W +Q GY+ LPK+   +R+KTN  ++  +
Sbjct: 219 ETGKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFN 259

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  160 bits (405), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 160/309 (51%), Gaps = 26/309 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK- 67
           + +++LN G ++P +GLG W+   +   + +  A+K GYR  D A  Y NE +VGQ IK 
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 68  --DSG-VPREEIFVTTKLWCTQHHEPEVALD--QSLKRLGLDYVDLYLMHWPARLDPAYI 122
             D G V RE++F+ +KLW   HH   V L+  ++LK LGLDYVDLY +H+P        
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSP 121

Query: 123 KNEDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                  + T K+      +T  N   I T+  M++L   G  K++G+SN++   + D L
Sbjct: 122 DERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVADTL 181

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STDAP 228
             +G ++ P A Q+E HP L Q++L+ +CK   + V AYS  G                P
Sbjct: 182 --RGCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNTPP 239

Query: 229 LLKEPVILEIAKK-NNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTED 284
           L   P I +IA K   V    V++ W  QRG  ++PKS   +R+  N  I    TL+ ED
Sbjct: 240 LFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAEED 299

Query: 285 FEAINNISK 293
              I+ +++
Sbjct: 300 LREISALNQ 308

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  159 bits (402), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 159/292 (54%), Gaps = 39/292 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K  ++  G +IP + LG +    +     V  ALK GYRH DTA +Y NE +VG+ I   
Sbjct: 5   KYYTMVNGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKW 64

Query: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRLG-LDYVDLYLMHWPARLDPA 120
                +   RE++F TTKLW +Q  +   +  + + + ++  L Y+DL L+H P      
Sbjct: 65  LKEDPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSP------ 118

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                  LS P ++             ++T++ MQE    G  K++GVSN+   ++++L 
Sbjct: 119 -------LSGPRRR-------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELY 158

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
                K  P ANQ+EI P   +++L ++C+SKG++VEA+SPL  T    LKEP ++ +AK
Sbjct: 159 KWDKLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAK 216

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINN 290
           K     G V+I W +QRG + LPK+ NP R+ +N ++  F L+ ED + +++
Sbjct: 217 KLGRDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELDH 268

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  159 bits (401), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 147/284 (51%), Gaps = 37/284 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI--- 66
           K   L+ G +IP I LGT+    +   + V   +K GYRH DTA +Y NE +VG  I   
Sbjct: 4   KFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKW 63

Query: 67  --KDSG-VPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
             +D G   REEIF TTKLW +Q  +   + A+ Q L  + GL Y+DL L+H P      
Sbjct: 64  LNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL----- 118

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                         +GS+         ++TW  MQE    G  K++GVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELL 157

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
                K  P  NQ+EI P + + EL ++CKSKG+VVEA++PL       +  P +L++ K
Sbjct: 158 NWPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCK 215

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTED 284
           + +  PG V+I W +Q GY+ LPK+    R++ N   +     D
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSD 259

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  160 bits (404), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 162/308 (52%), Gaps = 26/308 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ---- 64
           + +++LN G ++P +GLG W+  +      +  A+K GYR  D A  Y NE +VG+    
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
           AI +  V R++IFV +KLW   HH   V  AL ++L  +GLDY+DLY +H+P        
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KNEDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           + +      T  D  +   IT  +   I T+  ++E    G  K++GVSNF  + ++DLL
Sbjct: 122 EEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL 181

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG-----STDAPLLK-EPV 234
             +G ++ P A Q+E HP L Q+ L+ FCK   I V AYS  G       D  L K  P 
Sbjct: 182 --RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 235 ILE---IAKKNNVQPG----HVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTED 284
           + E   I K +   PG     V++ W  QRG  V+PKS   +R+  N +I   FTL+ ++
Sbjct: 240 LFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 285 FEAINNIS 292
            + I+ ++
Sbjct: 300 LKDISALN 307

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 150/289 (51%), Gaps = 42/289 (14%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI--- 66
           K  +L+ G +IP I LGT+    +   + V   +K GYRH DTA +Y NE +VG  I   
Sbjct: 4   KFYNLSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKW 63

Query: 67  ---KDSGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
                    RE+IF TTKLW +Q  +   + A+ Q L  + GL Y+DL L+H P      
Sbjct: 64  LNENPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL----- 118

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                         +GS+         ++TW+ MQE    G  K++GVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWQAMQEAVDEGVVKSIGVSNYGKKHIDELL 157

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
                   P  NQ+EI P + + EL ++CKSKG++VEA++PL       +  P +L++ K
Sbjct: 158 TWPDLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCK 215

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAIN 289
           + +  PG V+I W +Q GY+ LPK+    R++ N     L+  DFE ++
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGN-----LAAYDFELLD 259

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  157 bits (397), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 150/286 (52%), Gaps = 39/286 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI--- 66
           K   L++   IP + LGT+    ++  + V  AL  GYRH DTA +Y NE++V Q I   
Sbjct: 7   KTYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNW 66

Query: 67  --KDSGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPAY 121
             +     R+EIF TTKLW +Q  +   + A+ + + ++  L Y+DL LMH P       
Sbjct: 67  LIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSP------- 119

Query: 122 IKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLA 181
                 +  P  ++             +TW  MQE    G  K++GVSNF I +LK+L  
Sbjct: 120 ------IGGPQIRE-------------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQ 160

Query: 182 SQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKK 241
             G K  P  NQ+EI P L + EL +FCK +G+VVEAY+PL  T    +  P +++I+ +
Sbjct: 161 WDGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL--THGYKINHPDLIKISNE 218

Query: 242 --NNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLS-TED 284
             N    G ++I W +Q GYV LPK+    R+++N  ++    TED
Sbjct: 219 LNNTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVYDFELTED 264

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 146/284 (51%), Gaps = 37/284 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K    + G ++P I LGT+    +   + V   +K GYRH DTA +Y NE +VG  I   
Sbjct: 4   KFYKFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKW 63

Query: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
                    RE++F TTKLW +Q  +   +VA+ Q L  + GL Y+DL L+H P      
Sbjct: 64  LHEDPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL----- 118

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                         +GS+         ++TW+ MQE    G  K++GVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWQAMQEAVDEGMVKSIGVSNYGKKHVDELL 157

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
                K  P  NQ+EI P + + EL ++CKSK +VVEA++PL       + +P +L++ K
Sbjct: 158 NWSQLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCK 215

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTED 284
           + +  PG V+I W +Q GY+ LPK+    R+++N   +     D
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSD 259

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  156 bits (395), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 157/286 (54%), Gaps = 42/286 (14%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           +   L++G  +P +GLGT+     +  + V  ALK GYRH+DTA +Y NE +VG+ ++  
Sbjct: 8   RAYKLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKW 67

Query: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRLG-LDYVDLYLMHWPARLDPA 120
                    R ++F TTKLW +Q  +   + A+ + L ++  L Y+D+ L+H P      
Sbjct: 68  LKEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPL----- 122

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                          G+R         ++T++ MQE    G  +++GVSN+  +++ +LL
Sbjct: 123 --------------SGTR-------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELL 161

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
           A +  K  P  NQ+EI P + + +L ++CKSKG+VVEA+SPL  T    +K P ++ +A+
Sbjct: 162 AWEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAE 219

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFE 286
           +     G V+I W +Q GYV LPKS + +R+K N +++     DFE
Sbjct: 220 EVGRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVY-----DFE 260

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  155 bits (392), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 146/284 (51%), Gaps = 37/284 (13%)

Query: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68
           K   L+ G +IP I LGT++   +   + V   +K GYRH DTA +Y NE +VG  I   
Sbjct: 4   KFYKLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRW 63

Query: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120
                    R +IF TTKLW +Q  + + + A+ Q L  + GL+Y+DL L+H P      
Sbjct: 64  LNEDPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL----- 118

Query: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
                         +GS+         ++TW  MQE    G  K++GVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWRAMQEAVDAGVVKSIGVSNYGRKHIDELL 157

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240
                +  P  NQ+EI P + + EL ++CKSKG++VEA++PL       +  P +L + K
Sbjct: 158 NWSELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCK 215

Query: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTED 284
           + +  PG V+I W +Q GY+ LPK+    R++ N   ++    D
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSD 259

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  155 bits (392), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 171/321 (53%), Gaps = 52/321 (16%)

Query: 2   PATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQ 61
           P T H      +L  G ++P +GLG +Q+ + +    V  ALK GYR +D+A +Y NE +
Sbjct: 5   PGTTH------ALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNERE 58

Query: 62  VGQAI-----KDSGVPREEIFVTTKLWCTQHHEPEVA---LDQSLKRLG-LDYVDLYLMH 112
               I     +   V R +IF TTK+  TQ    E A   +++SL R+  LDY+DL+L+H
Sbjct: 59  ACLGITKFLEESPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIH 117

Query: 113 WPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFS 172
            P             L+   K+ G             TW+  QE  +TGK KA+GVSN+ 
Sbjct: 118 AP-------------LTNKEKRLG-------------TWKAFQEYYETGKIKAIGVSNYG 151

Query: 173 INNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKE 232
           I +L+++    G K+ P  NQ E++P L + EL N+C  KG+V++AYSPL  T A  L++
Sbjct: 152 IQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQD 209

Query: 233 PVILEIAKKNNVQ--PGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAI 288
           P ++++ + +  +     ++++W +Q G+V L K+V+ DR+K N K   F LS+ D + +
Sbjct: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269

Query: 289 NNISKEKGEKRVVHPNWSPFE 309
            +      +  +  P W P +
Sbjct: 270 TH----DDQYYLSQPKWDPIK 286

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  155 bits (392), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 162/308 (52%), Gaps = 26/308 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ---- 64
           + +++LN G ++P +GLG W+  +      +  A+K GYR  D A  Y NE +VG+    
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 65  AIKDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
           AI +  V R+++FV +KLW   HH   V  AL ++L  +GLDY+DLY +H+P        
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KNEDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           + +      T  D  +   IT  +   + T+  ++E    G  K++G+SNF  + ++DLL
Sbjct: 122 EEKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDLL 181

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG-----STDAPLLK-EPV 234
             +G ++ P A Q+E HP L Q+ L+ FC+   I V AYS  G       D  L K  P 
Sbjct: 182 --RGCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 235 ILE---IAKKNNVQPG----HVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTED 284
           + E   I K +   PG     V++ W  QRG  V+PKS   +R+  N +I   FTL+ ++
Sbjct: 240 LFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 285 FEAINNIS 292
            + I+ ++
Sbjct: 300 LKEISALN 307

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  154 bits (388), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 155/291 (53%), Gaps = 42/291 (14%)

Query: 13  SLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI-----K 67
           +L  G +IP + LG +++ + +    V TALK GYRH+D A +Y NE +VG  I     +
Sbjct: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69

Query: 68  DSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRL----GLDYVDLYLMHWPARLDPAYIK 123
              V R EIF TTK+    +H  E A    +K L     ++Y+DL L+H P         
Sbjct: 70  TPNVSRSEIFYTTKV-SGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNP--------- 119

Query: 124 NEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQ 183
               ++   ++ G             TW+ +QE    GK +A+GVSN+SI +L++L   +
Sbjct: 120 ----IAATEERLG-------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWE 162

Query: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN- 242
           G K+ P  NQ E++P L + EL  +C+ KG+V+EA+SPL  T      +P + E+ K + 
Sbjct: 163 GLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKTSY 220

Query: 243 -NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINN 290
            N  P  ++I W +Q G++ LPKS N  R  +N +   F +S +D +A+ +
Sbjct: 221 PNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  154 bits (388), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 162/308 (52%), Gaps = 26/308 (8%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ---- 64
           + +++LN G ++P +GLG W+         +  A+K GYR  D A  Y NE +VG+    
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
           AI +  V R++IFVT+KLW   HH   V  AL ++L  +GLDY+DLY +H+P        
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KNEDILSVPTKKDGSRAVDITNWN--FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180
           + +      T  +  +   IT  +   I T+  ++     G  K++G+SNF  + ++DLL
Sbjct: 122 EEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLL 181

Query: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG-----STDAPLLKE-PV 234
             +G ++ P A Q+E HP L Q+ L+++CK   I V AYS  G       D  L K  P 
Sbjct: 182 --RGCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPT 239

Query: 235 ILE---IAKKNNVQPG----HVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLSTED 284
           + E   + K +   PG     V++ W  QRG  V+PKS   +R+  N +I    TL+ ++
Sbjct: 240 LFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQE 299

Query: 285 FEAINNIS 292
            + I++++
Sbjct: 300 LKEISSLN 307

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  152 bits (385), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 151/288 (52%), Gaps = 40/288 (13%)

Query: 14  LNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD----- 68
           L+ G QIP +GLG +Q  E      V  AL+ GYR  D+A  Y NED V + I       
Sbjct: 15  LSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKHA 74

Query: 69  SGVPREEIFVTTKLWCTQHHEPEV---ALDQSLKRLG-LDYVDLYLMHWPARLDPAYIKN 124
            G  RE+++ TTK+  TQ+H  E    +L++SL   G L Y+DL L+H P          
Sbjct: 75  PGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAP---------- 123

Query: 125 EDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQG 184
              +S  T++ G             TW+ ++E    G+ +++GVSN+   +L +LL  +G
Sbjct: 124 ---MSDRTRRLG-------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEG 167

Query: 185 NKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNV 244
            K+ P  NQVEI+P L + EL+ +C+   I V+A+SPL       L +P++ ++A + + 
Sbjct: 168 LKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYDK 225

Query: 245 QPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINN 290
               +++ W +Q G++VLPK+   +R+  N  I  F LS E    + +
Sbjct: 226 GVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSELTH 273

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  151 bits (381), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 105/302 (34%), Positives = 156/302 (51%), Gaps = 59/302 (19%)

Query: 8   STKILSLNTGAQIPQI---GLGT--WQSKENDA---------YKAVLTALKDGYRHIDTA 53
           + K  +L+ G +IP +   G GT  ++S+E DA          K  L  +  G  HID A
Sbjct: 3   TQKFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVP-GVVHIDAA 61

Query: 54  AIYRNEDQVGQAIKDSGVPREEIFVTTKLWCTQH--HEPEVALDQSLKRLGLDYVDLYLM 111
            IYR   ++G A+KD+  PR+EIF+T K    +     P+VAL+ SLK+LG+DYVDLYL+
Sbjct: 62  EIYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLL 121

Query: 112 HWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNF 171
           H P       I  E  L V                    W+ ++EL K+GK K +GVSNF
Sbjct: 122 HSP-------IIKESKLDVEA-----------------NWKYLEELYKSGKAKNIGVSNF 157

Query: 172 SINNLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPL 229
           ++ +L+ LLA    ++ P  NQ+E  P L      ++ F +  GI++EAYSPLG    PL
Sbjct: 158 AVKDLEKLLAVA--EVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLG----PL 211

Query: 230 LKEP----------VILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFT 279
            + P           I E++KK N     +++SW  +RG + +  S   +RI+  + IF+
Sbjct: 212 QRRPEDADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFS 271

Query: 280 LS 281
            S
Sbjct: 272 FS 273

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  151 bits (382), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 96/310 (30%), Positives = 162/310 (52%), Gaps = 30/310 (9%)

Query: 9   TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK- 67
           + +++LN G ++P +GLG W+  +N     +  A+K GYR  D A  Y NE +VG+ I+ 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 68  ---DSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122
              +  V R+++FV +KLW   HH   V  AL ++L  +GLDY+DLY +H+P      YI
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAF--KYI 119

Query: 123 KNEDI----LSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKD 178
             E+         T+ +    +   +   I T+  +++    G  K++G+SNF  + ++D
Sbjct: 120 PFEEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQD 179

Query: 179 LLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG------------STD 226
           LL  +G ++ P A Q+E HP L Q+ L+ FCK   I V AYS  G               
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKAT 237

Query: 227 APLLKEPVILEIAKKN-NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLST 282
             L +  VI ++++ +       V++ W  QRG  V+PKS   +R+  N +I   F+L+ 
Sbjct: 238 QTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTE 297

Query: 283 EDFEAINNIS 292
           ++ + I+ ++
Sbjct: 298 QELKKISALN 307

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  147 bits (370), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 102/312 (32%), Positives = 160/312 (51%), Gaps = 29/312 (9%)

Query: 8   STKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQ--- 64
           +++ + LN G Q+P +GLG W+         V  A+K GYR  D A  Y NE +VGQ   
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 65  -AIKDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLDPAY 121
            AI +  V RE++FV +KLW + H    V  AL ++L+ + L+Y+DL+ +H+P  L   Y
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFP--LAFKY 121

Query: 122 IKNEDILS---VPTKKDGSRAV-DITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLK 177
           +  E+          +D  + V  +     I T+  ++E  K G  K++G+SNF    + 
Sbjct: 122 VPFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILIH 181

Query: 178 DLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLG-----STDAPLLKE 232
           DLLA  G  + P   Q+E HP L Q++LI +C  + I V AYS  G       D+ L K 
Sbjct: 182 DLLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKS 239

Query: 233 -PVILE------IAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI---FTLST 282
            P + E      IA  + V    V++ W  QR   ++PKS   +R+  N +I    TL+ 
Sbjct: 240 TPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLTE 299

Query: 283 EDFEAINNISKE 294
            + + I+ ++K+
Sbjct: 300 AELQEISALNKD 311

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  141 bits (355), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 150/310 (48%), Gaps = 55/310 (17%)

Query: 10  KILSLNTGAQIPQI---GLGTWQSKENDAYKAVLTALKD---------GYRHIDTAAIYR 57
           +   LN G ++P +   G GT   K N+  +     L D         G  H+D A  Y 
Sbjct: 5   EFFKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYM 64

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKLWCTQH--HEPEVALDQSLKRLGLDYVDLYLMHWPA 115
              +VG+A+ ++  PR+EIF+T K W        P V L+  LKRLGL+YVDLYL+H P 
Sbjct: 65  TYREVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSP- 123

Query: 116 RLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINN 175
                +I  E                   ++  + W +M+EL  +GK K +GVSNF+  +
Sbjct: 124 -----FISKE----------------TNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKED 162

Query: 176 LKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLKEP 233
           L+ +L  +  K+ P  NQ+E +  L      + NFCK   I + AYSPLG    PL K+P
Sbjct: 163 LERVL--KVCKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKP 216

Query: 234 V----------ILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTE 283
                      I ++A+  N  PG V++ W  +RG V +  S   +RIK  ++IF    +
Sbjct: 217 ADGNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLK 276

Query: 284 DFEAINNISK 293
           D E +  I+K
Sbjct: 277 DDE-VTEITK 285

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  137 bits (346), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 150/302 (49%), Gaps = 55/302 (18%)

Query: 10  KILSLNTGAQIPQI---GLGT--WQSKENDA---------YKAVLTALKDGYRHIDTAAI 55
           +  +LN G +IP I   G GT  ++++E DA          K  LT    G  HID A I
Sbjct: 6   EFFTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTL--PGIVHIDAAEI 63

Query: 56  YRNEDQVGQAIKDSGVPREEIFVTTKLWCTQ---HHEPEVALDQSLKRLGLDYVDLYLMH 112
           YR   +V  A+++S  PR+EIF+T K + TQ     +P   L+ SLK LGLDYVDLYL+H
Sbjct: 64  YRTYPEVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLH 122

Query: 113 WPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFS 172
            P      +IKN   L                    + W+ M++L K+GK K +GVSNF 
Sbjct: 123 SP------FIKNGSTLE-------------------ECWKQMEKLYKSGKAKNIGVSNFR 157

Query: 173 INNLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGS----TD 226
           + +L+ +L  +   + P  NQ+E +  L      ++ FCK   I +EAY+PLG      D
Sbjct: 158 VEDLEKIL--KIATIKPQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQD 215

Query: 227 APLLK--EPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTED 284
            P  K     I E++KK N     +++ W  +RG + +  S  P R+   + +F+   E 
Sbjct: 216 TPEAKPFYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLES 275

Query: 285 FE 286
            E
Sbjct: 276 SE 277

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  136 bits (342), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/307 (31%), Positives = 156/307 (50%), Gaps = 49/307 (15%)

Query: 10  KILSLNTGAQIPQI---GLGT--WQSKENDA------YKAVLTALK-DGYRHIDTAAIYR 57
           + ++LN G +IP I   G GT  ++ +E DA       + ++ ALK  G  HID A IYR
Sbjct: 6   QFITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYR 65

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKLWCTQ---HHEPEVALDQSLKRLGLDYVDLYLMHWP 114
              +VG+A+  +  PR EIF+T K + TQ      P V LD +LK++G DYVDLYL+H P
Sbjct: 66  TYPEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSP 124

Query: 115 ARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSIN 174
                 ++  E                   +   + W+ M++L ++GK K +GVSNF++ 
Sbjct: 125 ------FVSKE----------------TNGFTLEEAWKDMEQLYRSGKAKNIGVSNFAMK 162

Query: 175 NLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLG------STD 226
           +L+ +L  +  ++ P  NQ+E  P L      +  FC+   I++EAYSPLG      + D
Sbjct: 163 DLERIL--KVAEIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKD 220

Query: 227 APLLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFE 286
             L     + E+++K       + + W  +RG + +  S  P RI   + +F+    D E
Sbjct: 221 ESLPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTD-E 279

Query: 287 AINNISK 293
            +N I++
Sbjct: 280 EVNQITE 286

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  134 bits (337), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 104/329 (31%), Positives = 160/329 (48%), Gaps = 58/329 (17%)

Query: 8   STKILSLNTGAQIPQIGL-----------GTWQSKENDAYKAVLTALK-DGYRHIDTAAI 55
           + K   LN G QIP I +           G+  +  ++  + +  AL   G  HID A  
Sbjct: 4   TQKFFDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAEC 63

Query: 56  YRNEDQVGQAIKDSGVPREEIFVTTKLWCTQH---HEPEVALDQSLKRLGLDYVDLYLMH 112
           Y    ++ +A+K+S  PR EIF+T K + TQ    ++P   L+  LK LGLDYVDLYL+H
Sbjct: 64  YGTYPELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIH 122

Query: 113 WPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFS 172
            P   DP +              GS  ++       K W+ M+ L K GK K++GVSNFS
Sbjct: 123 SPF-FDPEF-------------KGSLTLE-------KVWKDMETLYKEGKAKSIGVSNFS 161

Query: 173 INNLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLL 230
           + N++++L   G K  P  NQ+E +  L      ++N+C+   I +EAYSPLG    PL 
Sbjct: 162 VKNIEEILKIAGIK--PQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQ 215

Query: 231 KEP----------VILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTL 280
           K P           I E+A K       ++++W   RG + +  S    RI   + IF+ 
Sbjct: 216 KRPENSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSF 275

Query: 281 S-TEDFEAINNISKEKGEKRVVHPNWSPF 308
           + T+D   ++ ++K   E+  +   W+ F
Sbjct: 276 NLTKD--EVDTLTKLGLEQPALRIYWTNF 302

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  130 bits (327), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 150/306 (49%), Gaps = 62/306 (20%)

Query: 13  SLNTGAQIPQI---GLGT-WQSKEN----------DAYKAVLTALKDGYRHIDTAAIYRN 58
           +LN G ++P I   G GT W   E           D  K  LT    G  HID A +YR 
Sbjct: 10  TLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTL--PGIVHIDAAEVYRT 67

Query: 59  EDQVGQAIKDSG--VPREEIFVTTKLWCTQ---HHEPEVALDQSLKRLGLDYVDLYLMHW 113
             +VG+A+++S    PR+EIF+T K + TQ      P V L   LK+LGLDYVDLYL+H 
Sbjct: 68  YPEVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHS 126

Query: 114 PARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSI 173
           P      +I  E        K+G        +   + W+ M++L K GK K +GVSNFS+
Sbjct: 127 P------FISKE--------KNG--------FTMEEAWKYMEDLYKAGKVKNIGVSNFSM 164

Query: 174 NNLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLK 231
            +L+ +L S   ++ P  NQ+E +  L      ++NFC+   I V AY+PLG    PL +
Sbjct: 165 ADLQRILKS--CEVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLG----PLQR 218

Query: 232 EP----------VILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLS 281
           +            + ++A+K +     +++ W  +RG + +  S    RIK  + +FT  
Sbjct: 219 KSKNFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFD 278

Query: 282 TEDFEA 287
             D E 
Sbjct: 279 LTDSEV 284

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  130 bits (327), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 156/311 (50%), Gaps = 57/311 (18%)

Query: 10  KILSLNTGAQIPQI---GLGT--WQSKENDA------YKAVLTALK-DGYRHIDTAAIYR 57
           K + LN G +IP I   G GT  +++ E DA       + ++ AL+  G  HID A IYR
Sbjct: 6   KFIVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYR 65

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKLWCTQ---HHEPEVALDQSLKRLGLDYVDLYLMHWP 114
              +VG+A+  +  PR+EIF+T K + TQ      P   L+ SLK++G DYVDLYL+H P
Sbjct: 66  TYPEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSP 124

Query: 115 ARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSIN 174
                 ++  E                   +   + W+ M++L K GK K +GVSNF++ 
Sbjct: 125 ------FVSKE----------------ANGFTLEEAWKDMEQLYKAGKAKNIGVSNFAVK 162

Query: 175 NLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLKE 232
           +L+ +L  +  ++ P  NQ+E  P L      +  FC+   I++EAYSPL    APL K+
Sbjct: 163 DLEKIL--KIAEVKPQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPL----APLQKK 216

Query: 233 PV----------ILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLST 282
                       + E+++K       +++ W  +RG + +  S  P RI   + +F+   
Sbjct: 217 TAQDDSKPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDL 276

Query: 283 EDFEAINNISK 293
            D E ++ I++
Sbjct: 277 TD-EEVDEITE 286

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  129 bits (325), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/323 (29%), Positives = 159/323 (49%), Gaps = 56/323 (17%)

Query: 15  NTGAQIPQIGLGT---WQSKENDAYK----------AVLTALKDGYRHIDTAAIYRNEDQ 61
            +G +IP IG G+   W+  +    K           V +A+  G+ HID A  Y+   +
Sbjct: 12  GSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAYKTHPE 71

Query: 62  VGQAIKDSGVPREEIFVTTKL--WC---TQHHEPEVALDQSLKRLGLDYVDLYLMHWPAR 116
           VG+ +K+SGVPR+++++T K   W     +   P  +L  SL+++ + YVDLYL+H P  
Sbjct: 72  VGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLLHVP-- 129

Query: 117 LDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNL 176
                      ++V T       +D+      + W  M+E+   G  K +GVSNF + +L
Sbjct: 130 ----------FITVQTA-----GIDLK-----EAWRQMEEIYDRGLAKNIGVSNFDVESL 169

Query: 177 KDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLK--- 231
           + +  ++  K  P  NQ+E +  L Q    +I +CK   IVVE YSPL     PL K   
Sbjct: 170 EYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPL----VPLTKGRP 223

Query: 232 ---EPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFE 286
              + ++  +A+K +     +++ W  Q G VV+  S    R+K +  I  F L+ EDF+
Sbjct: 224 GPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFD 283

Query: 287 AINNISKEKGEKRVVHPNWSPFE 309
           +I  I +EK  +  +   +S ++
Sbjct: 284 SITKIGREKIFRGFMGEQYSKYD 306

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/313 (30%), Positives = 155/313 (49%), Gaps = 56/313 (17%)

Query: 10  KILSLNTGAQIPQI---GLGT--WQSKENDA------YKAVLTALK-DGYRHIDTAAIYR 57
           +  +LN G +IP I   G GT  ++++E DA       + ++ ALK  G  HID A IYR
Sbjct: 6   QFFTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYR 65

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKL--WCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPA 115
              +VG+A+  +  PR  IF+T K          P   LD +LK++G DYVDLYL+H P 
Sbjct: 66  TYPEVGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSP- 124

Query: 116 RLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINN 175
                ++  E                +   +  + W+ M++L K+GK K +GVSNF++ +
Sbjct: 125 -----FVSKE----------------VNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVED 163

Query: 176 LKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLKEP 233
           L+ +L  +  ++ P  NQ+E  P L      +  FC+   I+VEAYSPLG    PL K+ 
Sbjct: 164 LQRIL--KVAEVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLG----PLQKKT 217

Query: 234 V----------ILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFT--LS 281
                      + E+++K       +++ W  +RG + +  S  P RI   + +F+  L+
Sbjct: 218 AQDDSQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLT 277

Query: 282 TEDFEAINNISKE 294
            E+ + I  +  E
Sbjct: 278 AEEVDKITELGLE 290

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  129 bits (323), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 102/334 (30%), Positives = 157/334 (47%), Gaps = 62/334 (18%)

Query: 8   STKILSLNTGAQIPQIGL--------------GTWQSKENDAYKAVLTALKDGYRHIDTA 53
           S +  +LN G +IP I +              G +  +  D  +  LT    G  HID A
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTL--PGIIHIDAA 61

Query: 54  AIYRNEDQVGQAIKDSGVPREEIFVTTKLWCTQ---HHEPEVALDQSLKRLGLDYVDLYL 110
            +Y    +V +A+K +   R+EIF+T K +         P   L +SLK L LDYVDLYL
Sbjct: 62  EMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYL 121

Query: 111 MHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSN 170
           +H P      +I  E                   +   + W+ M++L K GK K +GVSN
Sbjct: 122 LHSP------FITKES----------------CGYTMEEAWKQMEKLYKDGKAKNIGVSN 159

Query: 171 FSINNLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAP 228
           FS+++LK +L  +  ++ P  NQ+E +  L      ++ FC+   I+VEAYSPLG    P
Sbjct: 160 FSVDDLKRIL--KICEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLG----P 213

Query: 229 LLKEPV----------ILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIF 278
           L K+P           I E+AKK     G V++ W  +R  + +  S   +RIK  + +F
Sbjct: 214 LRKKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLF 273

Query: 279 T--LSTEDFEAINNISKEKGEKRVV-HPNWSPFE 309
           +  L++E+ E I  +       R+    N+S F+
Sbjct: 274 SFDLTSEEVEKITKLGLAHEPSRLYWKNNYSQFD 307

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  125 bits (315), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 148/309 (47%), Gaps = 56/309 (18%)

Query: 15  NTGAQIPQIGLGT---WQSKENDAYK----------AVLTALKDGYRHIDTAAIYRNEDQ 61
            +G ++P IG G+   W+  + +  K           V  A+K G+ HID A  Y+   +
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  VGQAIKDSGVPREEIFVTTKL----WCTQHHE-PEVALDQSLKRLGLDYVDLYLMHWPAR 116
           VG  I +SGVPRE+++VT K     W  +  + P  +L+ SL ++ + YVDLYL+H P  
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVP-- 129

Query: 117 LDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNL 176
               +I  E           +  +D+      + W  M+E+   G  K +GVSNF + +L
Sbjct: 130 ----FINPE-----------TAGIDLK-----EAWRQMEEIYDRGWAKNIGVSNFDVESL 169

Query: 177 KDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLK--- 231
           + +      K  P  NQ+E    + Q    +I++CK  GI +E YSPL     PL K   
Sbjct: 170 EYIRTI--GKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPL----VPLTKGKP 223

Query: 232 ---EPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFE 286
              + ++  +AKK       +++ W VQ G + +  S    RI  +  I  F LS+EDF 
Sbjct: 224 GPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFT 283

Query: 287 AINNISKEK 295
           +I  + K K
Sbjct: 284 SITEVGKTK 292

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  124 bits (311), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/312 (30%), Positives = 152/312 (48%), Gaps = 60/312 (19%)

Query: 10  KILSLNTGAQIPQ---IGLGT--WQSKEN---------DAYKAVLTALKDGYRHIDTAAI 55
           +  +LN G +IP    IG GT  ++++EN         D  K  LT    G  HID A I
Sbjct: 6   EFFTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTL--PGVVHIDAAEI 63

Query: 56  YRNEDQVGQAIKDSGVPREEIFVTTKLWCTQH--HEPEVALDQSLKRLGLDYVDLYLMHW 113
           YR   ++G+A++++  PR EI++T K   +      P V  +  LK LG+DY+DLYL+H 
Sbjct: 64  YRTYPELGKALRETKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHS 123

Query: 114 PARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSI 173
           P               +   ++G        +   + W+ ++EL K+GK K +GVSNF+ 
Sbjct: 124 PF--------------ITEGRNG--------FTLEQAWKYLEELYKSGKAKNIGVSNFAK 161

Query: 174 NNLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLK 231
            +L+ +L  +  ++ P  NQ+E    L      + NF K   I++EAYSPLG    PL +
Sbjct: 162 EDLERIL--KIAEIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLG----PLQR 215

Query: 232 EP----------VILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFT-- 279
            P           I E+A+K       V++ W  +RG + +  S  P R+   + IFT  
Sbjct: 216 RPEEADSLPFYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFD 275

Query: 280 LSTEDFEAINNI 291
           L++ + E I  +
Sbjct: 276 LTSTEVEKITEL 287

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  122 bits (307), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 149/312 (47%), Gaps = 62/312 (19%)

Query: 15  NTGAQIPQIGLGT---WQSKENDA----------YKAVLTALKDGYRHIDTAAIYRNEDQ 61
            T   IP +G GT   W+  + +              ++TA+  G+ HIDTA  Y   ++
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGQAIKDSGVPREEIFVT--------TKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHW 113
           VG+A++ S +PR+++F+T        T L C+    P  A  + L+ LG+ Y DLY++H 
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSG---PIQAAKKGLEALGIKYFDLYMLHR 129

Query: 114 PARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSI 173
           P           DI    TK++    +D+      + W  ++EL + G  KA+GVSNF +
Sbjct: 130 P-----------DI----TKENA--GIDLQ-----EAWRQVEELYEAGIAKAIGVSNFPL 167

Query: 174 NNLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLK 231
             LK + +    +  P  +QVE HP L      ++ +C++K IVVEAYSPL    APL +
Sbjct: 168 ETLKQMESY--CRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APLFR 221

Query: 232 ------EPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKT--NRKIFTLSTE 283
                 + ++  + KK       +V+ W + RG V L  S   +RI        F L   
Sbjct: 222 ARPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKS 281

Query: 284 DFEAINNISKEK 295
           D E IN +  +K
Sbjct: 282 DVELINEVGSKK 293

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  121 bits (304), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/322 (29%), Positives = 154/322 (47%), Gaps = 56/322 (17%)

Query: 16  TGAQIPQIGLGT---WQ-SKENDAYKAVL---------TALKDGYRHIDTAAIYRNEDQV 62
           +G  +P IG G+   W+ +K +   K V           A++ G+ HIDTA  Y+   +V
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GQAIKDSGVPREEIFVTTKL--WCTQHHE---PEVALDQSLKRLGLDYVDLYLMHWPARL 117
           G  I ++ VPRE +++T K   W  +  +   P  +L  SLK + LDYVDLY++H P   
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIHVP--- 130

Query: 118 DPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLK 177
                      ++ TK  G   +D+      + W  M+E+      + +GVSNF + +L+
Sbjct: 131 -----------NITTKTAG---IDLK-----EAWLQMEEIYTRKMARNIGVSNFDVESLE 171

Query: 178 DLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLK---- 231
            + +    K  P  NQ+E    + Q    ++ +C+   IVVE YSPL     PL K    
Sbjct: 172 YIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPL----VPLTKGKPG 225

Query: 232 --EPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEA 287
             + ++  IA K       V++ W  Q G VV+  +   +R+  +  I  F LS EDF+ 
Sbjct: 226 PLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQ 285

Query: 288 INNISKEKGEKRVVHPNWSPFE 309
           I N+ +EK  +  +H  +  ++
Sbjct: 286 ITNVGREKILRNYMHMLYEKYD 307

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  120 bits (302), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 99/324 (30%), Positives = 149/324 (45%), Gaps = 56/324 (17%)

Query: 10  KILSLNTGAQIPQ---IGLGTWQSKENDAY--------KAVLTALKDGYRHIDTAAIYRN 58
           +  +LN G +I     IG GT    E  A+        +A       G  H+D A  YR 
Sbjct: 6   QFFTLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRT 65

Query: 59  EDQVGQAIKDSGVPREEIFVTTKLWCTQH--HEPEVALDQSLKRLGLDYVDLYLMHWPAR 116
             ++ +A+K+S  PR EIF+T K          P  AL+ +L  LGLDYVDLY++H+P  
Sbjct: 66  YPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP-E 124

Query: 117 LDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNL 176
            DP Y      LS+ T                  W  M+ L K GK K +GVSNFSI +L
Sbjct: 125 FDPEYKD----LSIET-----------------AW--MELLYKEGKAKNIGVSNFSIEHL 161

Query: 177 KDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLKEP- 233
           + ++     K  P  NQ+E +  L      ++ +C+  G  +EAYSPL    APL ++P 
Sbjct: 162 ERVMKIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPK 215

Query: 234 ---------VILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTED 284
                     I E++ K       +++ W  +RG V +  S   +RI   + +F+    D
Sbjct: 216 NFNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTD 275

Query: 285 FEAINNISKEKGEKRVVHPNWSPF 308
            E ++ I+K   E+  +   W+ F
Sbjct: 276 -EEVDKITKLGLEQPALRLYWNEF 298

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  117 bits (293), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 139/305 (45%), Gaps = 47/305 (15%)

Query: 11  ILSLNTGAQIPQ---IGLGT-WQSKENDAYKAVLTALKD--------GYRHIDTAAIYRN 58
            ++LN G ++P    IG GT W  K+   +      ++         G  HID A +Y  
Sbjct: 7   FVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYGT 66

Query: 59  EDQVGQAIKDSGVPREEIFVTTK--LWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPAR 116
             ++  A++ +  PR EIF+T K  L      +P   L+ SLK   LDYVDLYL+H P  
Sbjct: 67  YPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLLHSPF- 125

Query: 117 LDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNL 176
                        V  +K G              W  M++L K GK K +GVSNFS+ +L
Sbjct: 126 -------------VAKEKPG--------LTLEGAWRQMEQLYKDGKAKNIGVSNFSVEDL 164

Query: 177 KDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLGSTDAPLLKEP- 233
           K +L+    ++ P  NQ+E HP L      ++ FC+ + I +EA++PLG       ++  
Sbjct: 165 KRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKTQEDEN 222

Query: 234 -----VILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAI 288
                 I  ++ K       +++ W  +RG + +  S   DRI   + +F    ED E +
Sbjct: 223 DEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLED-EEV 281

Query: 289 NNISK 293
             I++
Sbjct: 282 TKITR 286

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  116 bits (291), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 89/319 (27%), Positives = 157/319 (49%), Gaps = 45/319 (14%)

Query: 9   TKILSLNTGAQIPQI---GLGTWQSKEN--DAY-----KAVLTALK-DGYRHIDTAAIYR 57
           T +++LN G +IP I   G GT   K N  D Y     K +  AL+  G  HID A +Y+
Sbjct: 5   TSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQ 64

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKLWCTQHHE--PEVALDQSLKRLGLDYVDLYLMHWPA 115
              +VG+A+++S  PR+EIF+T K    +     P+  L  +L+++GL+YVDLYL+H+P 
Sbjct: 65  THAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFPI 124

Query: 116 RLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINN 175
            +DP                      + ++   + W++M++L   G  K +GVSNF + +
Sbjct: 125 -IDPK---------------------LYDFTLEEAWKMMEDLYNEGLAKNIGVSNFRVED 162

Query: 176 LKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYS---PLGSTDAPLL 230
           L+ L  S+   + P  NQ+E +  L      + ++C    I +EA+    PL   +   L
Sbjct: 163 LEQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKDL 220

Query: 231 KEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLS-TEDFEAIN 289
               + ++A+K +     +++ W  QR  + +  S  P+R++    IF+   T+D   + 
Sbjct: 221 LPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQD--EVE 278

Query: 290 NISKEKGEKRVVHPNWSPF 308
            I+K   +   +   W+ +
Sbjct: 279 FITKLGSQHDTIRKYWNVY 297

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  116 bits (291), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/298 (28%), Positives = 145/298 (48%), Gaps = 46/298 (15%)

Query: 10  KILSLNTGAQIPQI---GLGT-W---QSKENDAYKAVLTALK-----DGYRHIDTAAIYR 57
           +  +LN G +IP +   G GT W   +  E++  K ++  +K      G  H+D A  Y 
Sbjct: 25  EFFTLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYN 84

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPA 115
              ++GQA+++S  PR+EIF+T K   T  +   V    +  +K++G+DYVDLYL+H P 
Sbjct: 85  TYQELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPL 144

Query: 116 RLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINN 175
                         +  +K+G    ++        W+ +++L + GK K +GVSNF + +
Sbjct: 145 --------------IEKEKNGVTLEEV--------WKDLEKLYEAGKAKNIGVSNFRVED 182

Query: 176 LKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLG-----STDAP 228
           L+ +L     K+ P  NQ+E H  L      ++ F +   I +EAY+PLG      +DA 
Sbjct: 183 LQRILKVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAG 240

Query: 229 LLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFE 286
                 + E+AKK       V++ W  +R  + +  S  P RI+  + +F+    D E
Sbjct: 241 DFYN-YVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEE 297

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  114 bits (285), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 139/291 (47%), Gaps = 46/291 (15%)

Query: 10  KILSLNTGAQIPQ---IGLGT--WQSKENDA------YKAVLTALK-DGYRHIDTAAIYR 57
           +  +LN G +IP    IG GT  ++ +E DA       K +  AL   G  H+D A +YR
Sbjct: 6   EFFTLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYR 65

Query: 58  NEDQVGQAIKDSGVPREEIFVTTKLWCTQH--HEPEVALDQSLKRLGLDYVDLYLMHWPA 115
              +  +A+K++  PR EIFVT K    +   ++P   LD  LKR GL+YVDLYL+H P 
Sbjct: 66  TYPEFSEALKNTKKPRNEIFVTDKYSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPF 125

Query: 116 RLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINN 175
                            +K+G        +   + W  ++EL   GK K +GVSNF + +
Sbjct: 126 --------------ASKEKNG--------FTIEEAWAQLEELYHEGKAKNIGVSNFRVED 163

Query: 176 LKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPLG---STDAPLL 230
           L+ +L     K+ P  NQ+E    L      ++ F +   I +EAY+PLG     D    
Sbjct: 164 LEKILKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQ 221

Query: 231 KEPV---ILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIF 278
            +P    I ++ +K +     +++ W  +RG + +  S  P RI+  + +F
Sbjct: 222 AKPFYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLF 272

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  108 bits (271), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 98/321 (30%), Positives = 150/321 (46%), Gaps = 60/321 (18%)

Query: 8   STKILSLNTGAQIPQI---GLGTWQSKE---NDAYKAVLTALKD-----GYRHIDTAAIY 56
           + +  +LN G  IP I   G+G   +K     D  K ++  LK+     G+ HI TA  Y
Sbjct: 5   TKRFFTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFY 64

Query: 57  RNEDQVGQAIKDSGVPREEIFVTTKLWCTQ---HHEPEVALDQSLKRLGLDYVDLYLMHW 113
            N   +  A+K S  PR EI++T K +C+Q      P  AL++SL RLG DYVDLYL+H 
Sbjct: 65  PNNGLLSAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHN 123

Query: 114 PARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSI 173
           P  LD          S P      +A           W+ M+ L KTGK K +GVSNF I
Sbjct: 124 PC-LD----------SSPNGISLEKA-----------WKQMELLYKTGKVKNIGVSNFRI 161

Query: 174 NNLKDLLASQGNKLTPAANQVEIHPLLPQD--ELINFCKSKGIVVEAYSPL--------G 223
            +L+ L   +  ++ P  N++E H  L      +  + K+  +++  YSPL         
Sbjct: 162 EDLERL---KDAEIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTED 218

Query: 224 STDAPLLKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI-----F 278
             D P  +   I+ +A+K N     +++ W    G  VLP   N  ++K  ++      F
Sbjct: 219 FMDFPFYR--YIIGLAEKYNKTEAQILLHWMNCLG--VLPVITN-TKVKWYKEASDIISF 273

Query: 279 TLSTEDFEAINNISKEKGEKR 299
            L++E+ + I  + K+    R
Sbjct: 274 ELTSEELDMITELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 78.6 bits (192), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 51/83 (61%), Gaps = 4/83 (4%)

Query: 14 LNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK----DS 69
          LN G QIP IG G ++  + D    V +ALKDGYRHIDTA +YRN+ +  Q ++    ++
Sbjct: 15 LNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKYLDET 74

Query: 70 GVPREEIFVTTKLWCTQHHEPEV 92
          G  RE I+ TTKLW +Q    E 
Sbjct: 75 GEARENIWFTTKLWDSQFGREET 97

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 78/180 (43%), Gaps = 32/180 (17%)

Query: 50  IDTAA--IYRNE-DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVAL--DQSLKRLGLD 104
           ID AA  IY+    +VG+A+  +  P+ EIF+T K          +A+  D +LK++ ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVE 66

Query: 105 YVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTK 164
           YVD++ +H P     A + N                       +K       L ++ K  
Sbjct: 67  YVDMHFLHSPFVFKQANVLN-----------------------LKDAMHTDHLRRSNKAN 103

Query: 165 AVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPL 222
             G S+ ++  L+ +L ++  +  P  NQ+++   L      +   C+   I++  YS L
Sbjct: 104 NRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL 161

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 75/329 (22%), Positives = 122/329 (37%), Gaps = 100/329 (30%)

Query: 15  NTGAQIPQIGLG--TWQSK------END---AYKAVLTALKDGYRHIDTAAIYRNEDQ-- 61
           NTG ++  I +G  ++ SK      E+D    +K +  A   G R  DTA +Y N +   
Sbjct: 11  NTGLKVSPIIIGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESEI 70

Query: 62  -VGQAIKDSGVPREEIFVTTKLWCTQHHE---------PEVALDQ--------------- 96
            +G+ +K+  +PRE + + TKL+   +           PE  L+                
Sbjct: 71  ILGEFLKNYKIPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSA 130

Query: 97  --SLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELM 154
             S++RLG  Y D+  +H   R DP           P               F +T   +
Sbjct: 131 RDSVRRLGT-YADIIQIH---RADP---------DTP---------------FEETMRAL 162

Query: 155 QELPKTGKTKAVGVSNFSINNLKDL-LASQGNKLTPAANQVEIHPLLPQD---ELINFCK 210
            ++   G T+ +G S+       ++   ++ N      N    + LL ++   ELI F K
Sbjct: 163 NDIVVDGLTRYIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPFAK 222

Query: 211 SKGIVVEAYSPL---------GSTDAPLLKEPV-------------------ILEIAKKN 242
              I +  +SPL         G T     K+                     + EIAKK 
Sbjct: 223 RHNIALTPWSPLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKR 282

Query: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRI 271
           N +   V + W +Q+G   +      DRI
Sbjct: 283 NTKMATVALYWVIQKGCFPIVGMSKIDRI 311

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 108/276 (39%), Gaps = 79/276 (28%)

Query: 15  NTGAQIPQI--GLGTWQSKE---------NDAYKAVLTALKDGYRHIDTAAIYRN---ED 60
           NTG +I  I  G  ++ SK+         N+ +K + TA   G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPIIVGCMSYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGYSNGQSEI 70

Query: 61  QVGQAIKDSGVPREEIFVTTKLWC-----------------------------TQHHEPE 91
            +G+ +K+  +PRE + + TK+W                              ++ H  E
Sbjct: 71  LLGEFLKEYEIPRETVIIMTKVWAPVDSSLEGFQRTGPMNEDQKVHFANQQGLSRKHIIE 130

Query: 92  VALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTW 151
            A   S++RLG  Y+D+Y +H   +  P                             +T 
Sbjct: 131 -ACKNSVRRLG-TYIDVYQIHRADQDTP---------------------------MEETM 161

Query: 152 ELMQELPKTGKTKAVGVSNFSINNLKDL-LASQGNKLTPAANQVEIHPLLPQD---ELIN 207
             + ++ + G T+ +G S+       +    ++ N  +   N  + + LL ++   E+I 
Sbjct: 162 RALNDVVQQGLTRYIGASSMLGTEFAEYQFIAEKNGWSKFVNMQDCYNLLYREEEREMIP 221

Query: 208 FCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNN 243
           + K  GI    +SPL      LL  PV +   +++N
Sbjct: 222 YIKKHGIAQTPWSPL---QRGLLSRPVEVSSYREDN 254

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 107/273 (39%), Gaps = 75/273 (27%)

Query: 15  NTGAQIPQIGLG-------TW----QSKENDAYKAVLTALKDGYRHIDTAAIYRN---ED 60
           NTG ++  + +G       TW    Q  + +A+K +  A   G R  DTA +Y N   E 
Sbjct: 11  NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEI 70

Query: 61  QVGQAIKDSGVPREEIFVTTKLWC---------TQHHEPEVALD---------------- 95
            +G+ ++   +PRE + + TKL            ++  PE+ L+                
Sbjct: 71  ILGEFLRKYNIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSS 130

Query: 96  -QSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELM 154
             S+KRLG  Y+D+  +H   R DP           P               F +T   +
Sbjct: 131 RASVKRLG-TYIDILQIH---RGDP---------DTP---------------FEETMGAL 162

Query: 155 QELPKTGKTKAVGVSNFSINNLKDL--LASQGNKLTPAANQVEIHPLLPQD--ELINFCK 210
            ++   G T+ VG S        ++  +A +        +Q   H +  +D  ELI F K
Sbjct: 163 NDVVIEGLTRYVGASLMLATEFAEMQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAK 222

Query: 211 SKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNN 243
              I +  +SPL   +  LL  P+  E  + N+
Sbjct: 223 RHNIALTPFSPL---NRGLLCRPLGTETTRSNS 252

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 87/205 (42%), Gaps = 40/205 (19%)

Query: 27  TWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKL---- 82
           T+    N     ++T LK G + IDTA IY + ++   AI +  +P +   + TK     
Sbjct: 9   TFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNEK---AIGELQLP-DRFTIHTKASGFS 64

Query: 83  -WCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVD 141
             C        ++++SL  LG+  V+ +L+H P   DP          +P +        
Sbjct: 65  GGCLTRDNINKSIEESLSLLGVPSVETFLLHSP---DP---------EIPLE-------- 104

Query: 142 ITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL--LASQGNKLTPAANQVEIHPL 199
                  +T + +  L + GK +  G+SNFS  ++K +   A   + + P   Q   + L
Sbjct: 105 -------ETLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNAL 157

Query: 200 LPQ--DELINFCKSKGIVVEAYSPL 222
                ++L    K   I + AYSP+
Sbjct: 158 SRAIVNDLFPLLKELHISLYAYSPI 182

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 73/182 (40%), Gaps = 53/182 (29%)

Query: 42  ALKDGYRHIDTAAIYRNED----QVGQAIKDSGVPREEIFVTTKLWCTQHHE-------P 90
           A+  G   IDT+  Y   +    +  Q IKD   PREE F+ TK+      E        
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDE-FPREEYFICTKVGRVGRAEFNYSKENV 108

Query: 91  EVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKT 150
             ++ +S +RL  DY+DL  +H                            DI    + K 
Sbjct: 109 RFSVKRSCERLHTDYLDLVYLH----------------------------DIEYVEYDKI 140

Query: 151 WELMQELPK---TGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPLLPQDELIN 207
           WE ++EL K    G  + +G+S + ++ L  L  S+     P     EI PL   D +++
Sbjct: 141 WEALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVP-----EIGPL---DAVLS 190

Query: 208 FC 209
           +C
Sbjct: 191 YC 192

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 92/257 (35%), Gaps = 78/257 (30%)

Query: 15  NTGAQIPQIGLGT----------WQSKE-NDAYKAVLTALKDGYRHIDTAAIYRN---ED 60
           NTG +I     GT          W  +E  DAYK +  A   G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 61  QVGQAIKDSGVPREEIFVTTKLW-------------------------------CTQHHE 89
            +G  +K   +PRE + + TK++                                ++ H 
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHI 130

Query: 90  PEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIK 149
            E A   S++RLG  Y+D+Y +H      P                           F +
Sbjct: 131 LEAA-KNSVRRLG-TYIDVYQIHRCDHETP---------------------------FEE 161

Query: 150 TWELMQELPKTGKTKAVGVSNFSINNLKDL-LASQGNKLTPAANQVEIHPLLPQD---EL 205
           T   + ++ + G  + +G S+       +    ++ +      N    + LL ++   E+
Sbjct: 162 TMRALNDVVEQGYARYIGASSMLGTEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREM 221

Query: 206 INFCKSKGIVVEAYSPL 222
           + FCK   + +  +SPL
Sbjct: 222 LPFCKKNNVAITPWSPL 238

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 90/221 (40%), Gaps = 47/221 (21%)

Query: 18  AQIPQIGLGTW--QSKENDAYKAVLTALKD-GYRHIDTAAIYRNEDQVGQAIKDSGVPRE 74
           A++P+I  G +   +   D +  + + L++ G    DTA IY   ++   +I D G+  +
Sbjct: 2   AELPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSEK---SIGDLGIA-D 57

Query: 75  EIFVTTKLWCTQHHEPEVALD-------QSLKRLGLDYVDLYLMHWPARLDPAYIKNEDI 127
           ++ + TK       E  +  D       QS   L +D V++Y +H P  + P        
Sbjct: 58  DLVIDTK--ARSFEEGALTRDGIFESIKQSFDELKVDSVEIYYLHAPDPITP-------- 107

Query: 128 LSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL--LASQGN 185
                                +T + + EL K GK K  G+SN++ +++K +   A   N
Sbjct: 108 -------------------IEETIDAINELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKN 148

Query: 186 KLTPAANQVEIHPLLP--QDELINFCKSKGIVVEAYSPLGS 224
            + P   Q   +      + +L    +  GI   AYSP+  
Sbjct: 149 YVLPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYSPIAG 189

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 91/236 (38%), Gaps = 67/236 (28%)

Query: 35  AYKAVLTALKDGYRHIDTAAIYRNEDQ----VGQAIKDSGVPREEIFVTTKLWC------ 84
           +YK +  A   G R  DTA +Y N       +G+ +K+  + RE + + TKL+       
Sbjct: 19  SYKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEYNISRETVVIMTKLFAPVDDTL 78

Query: 85  -------------TQHHEPEVALDQ---------SLKRLGLDYVDLYLMHWPARLDPAYI 122
                        T H   +  L +         SL+RLG  Y+D+Y +H   R DP   
Sbjct: 79  PDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLG-TYIDVYQVH---RADP--- 131

Query: 123 KNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL-LA 181
                   P +               +T   + ++ + G T+ +G S+       +    
Sbjct: 132 ------DTPME---------------ETMRALNDVVQQGLTRYIGASSMLGTKFAEYQFI 170

Query: 182 SQGNKLTPAANQVEIHPLLPQD---ELINFCKSKGIVVEAYSPLGSTDAPLLKEPV 234
           ++ N  +   N  + + LL ++   E+I + K  GI    +SPL      LL  PV
Sbjct: 171 AEKNGWSKFVNMQDCYNLLYREEEREMIPYIKKHGIAQTPWSPL---QRGLLSRPV 223

>TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 65/319 (20%), Positives = 115/319 (36%), Gaps = 103/319 (32%)

Query: 15  NTGAQIPQIGLG--TWQSKE---------NDAYKAVLTALKDGYRHIDTAAIYRN---ED 60
           NTG +I  I +G  T+  KE          + ++ +      G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPIIIGCMTFGKKEWSDWIVSDKEEVFRLLKYCYDKGLRTYDTANTYSNGVSEQ 70

Query: 61  QVGQAIKDSGVPREEIFVTTKLWC--------------TQHHEPEVAL------------ 94
            +G+ +K   + RE + + +KL+                +  E ++ L            
Sbjct: 71  LLGEFLKRYNIRRETVVIMSKLFFPADDSLPDFQLTNGFKDEEEKLHLINQFGLNRRNVI 130

Query: 95  ---DQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTW 151
               QS++RLG  Y+D+  +H   R  P                           F +T 
Sbjct: 131 ESAKQSVERLG-TYMDVLQIHRCDRETP---------------------------FEETM 162

Query: 152 ELMQELPKTGKTKAVGVSNFSINNLKDL-LASQGNKLTPAANQVEIHPLLPQD---ELIN 207
             + ++   G TK +G S        ++   ++ +      N   +H L+ ++   ELI 
Sbjct: 163 RALNDVVNAGYTKYIGASLMRATEFAEMQFIAEKHDWHKFVNVQSLHNLIYREDERELIP 222

Query: 208 FCKSKGIVVEAYSPL---------------GSTDAPLLKEPV-------------ILEIA 239
           F K  GI +  YSPL                +TD  +L+  +             + +++
Sbjct: 223 FTKKHGIALTPYSPLQKGYLAKPYGTKTVRNTTDKHMLRIKIDNMRDSDKEIISRVEKVS 282

Query: 240 KKNNVQPGHVVISWHVQRG 258
           K   V    V ++W +Q+G
Sbjct: 283 KDKKVSMAEVSLAWLIQQG 301

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 60/306 (19%), Positives = 114/306 (37%), Gaps = 91/306 (29%)

Query: 42  ALKDGYRHIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKLWC------------TQ 86
           A   G R  DTA +Y N   E  +G+ ++   +PRE + + TK++             T+
Sbjct: 49  AYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVFFPVDDKMDISSNRTK 108

Query: 87  HHEPEV---------------ALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVP 131
             E  +               A+  S+KRLG  Y+D+Y +H      P            
Sbjct: 109 TEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIHRCDHETP------------ 155

Query: 132 TKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL-LASQGNKLTPA 190
                          F +T   + ++ + G  + +G S+       ++   ++ +     
Sbjct: 156 ---------------FEETMRALNDVVEQGDVRYLGASSMLAVEFAEMQFIAEKHGWHKF 200

Query: 191 ANQVEIHPLLPQD---ELINFCKSKGIVVEAYSPLG---------------STDAPLLKE 232
            N    + L+ ++   E+I FCK  GI +  +SP+                STD  L+  
Sbjct: 201 VNMQSCYNLVYREDEREMIPFCKRHGIALTPWSPIQKGLLARPLGSHTHRESTDGVLIAR 260

Query: 233 PV-------------ILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFT 279
            +             + ++A K N++   + + W +Q+G + +    + +R+    K  T
Sbjct: 261 KLNQFTESEKEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILGMSSIERVDEAIKTLT 320

Query: 280 LS-TED 284
              TED
Sbjct: 321 TKLTED 326

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 118/292 (40%), Gaps = 68/292 (23%)

Query: 23  IGLGTWQSK---------ENDAYKAVLTALKDGYRHIDTAAIYRN---EDQVGQAIKDSG 70
           +G  T+ SK         + + +K +     +G R  DTA +Y N   E  +G+ +K   
Sbjct: 21  VGCMTYGSKNWANWVLEDKEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFN 80

Query: 71  VPREEIFVTTKLWCTQHHEPEVALDQSL-----KRLGLDYVDLYLMHWPARLDPAYIKNE 125
           + RE + + +K++          +D+SL      ++  +Y+DL L  +   L+  +I   
Sbjct: 81  IKRETVVIMSKIF--------FPVDESLDLHQGSKVDQEYIDLQL-SFQQGLNRKHIMAG 131

Query: 126 DILSVPTKKDGSRAVDITNWNFIKTWELMQELPKT-------GKTKAVGVSNFSINNLKD 178
              SV  ++ G+  +DI   + +     M+E+ ++       G+ + +G S+       +
Sbjct: 132 VANSV--ERLGT-YIDILQIHRLDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAE 188

Query: 179 L--LASQGNKLTPAANQVEIHPLLPQDE--LINFCKSKGIVVEAYS---------PLGST 225
           L  +A Q         Q   + L  +DE  LI FCK  G+ +  +S         P   T
Sbjct: 189 LQFIAKQNGWFQFINVQSYYNVLNREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKT 248

Query: 226 DAPLLKEP-------------------VILEIAKKNNVQPGHVVISWHVQRG 258
              +L +P                   V+  IAKK  +    V ++W + +G
Sbjct: 249 GTRMLSDPTFIKMGLDKLDESDKEIIGVVEAIAKKKGISMAMVSMAWILNKG 300

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 21/99 (21%)

Query: 35  AYKAVLTALKDGYRHIDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL--------- 82
           A++ +    + G   IDTA  Y+NE+    +G+ +K   + R++I + TK          
Sbjct: 9   AFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKYEV 67

Query: 83  -------WCTQH-HEPEVALDQSLKRLGLDYVDLYLMHW 113
                  +C  H H   V++  SL++L  D++D+  +HW
Sbjct: 68  GGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 72/179 (40%), Gaps = 44/179 (24%)

Query: 41  TALKDGYRHIDTAAIYRN-EDQVGQAIKDSG--VPREEIFVTTKLWCTQHHEPEVALD-- 95
            A ++G   IDT+  Y N E  +G+A+ + G   PR+   + TK+        + + D  
Sbjct: 32  VAFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNV 91

Query: 96  -----QSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKT 150
                +S KRL  DY+DL  +H     D  ++  +D L                   +  
Sbjct: 92  RRSVVRSCKRLNSDYLDLVYLH-----DVEFVNMKDSL-------------------VAL 127

Query: 151 WELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFC 209
            EL ++L   G  K  G+S + ++ L  L +    K T            P D ++++C
Sbjct: 128 REL-KKLKNEGIIKRFGISGYPVDYLFHLSSYCAKKDTSIG---------PLDAILSYC 176

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 60/143 (41%), Gaps = 32/143 (22%)

Query: 2   PATLHDSTKILSLNTGAQIPQIGLG------TWQS-----KENDAYKAVLTALKDGYRHI 50
           P T     ++LS   G ++  + LG       W        +  A++ +    + G   I
Sbjct: 11  PPTELGRLRVLSKTAGIRVSPLILGGMSIGDAWSGFMGSMNKERAFELLDAFFEAGGNFI 70

Query: 51  DTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL----------------WCTQH-HEP 90
           DTA  Y+NE     +G+ +    + R++I + TK                 +C  H H  
Sbjct: 71  DTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYEVGKGRSANFCGNHKHSL 129

Query: 91  EVALDQSLKRLGLDYVDLYLMHW 113
            V++  SL++L  D++D+  +HW
Sbjct: 130 HVSVRDSLRKLQTDWIDILYVHW 152

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 14/83 (16%)

Query: 15 NTGAQIPQIGLGT-------WQS----KENDAYKAVLTALKDGYRHIDTAAIYRN---ED 60
          NTG +I  I +G        WQ+       +A+K +      G R  DTA +Y N   E 
Sbjct: 11 NTGIKISPIVVGCMSFGSKRWQAWIEDDREEAFKILKYCYDHGLRTFDTADVYSNGESEK 70

Query: 61 QVGQAIKDSGVPREEIFVTTKLW 83
           +G+ +K   + RE + + TK++
Sbjct: 71 FLGEFLKRYNIRRETVVILTKVY 93

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 21/99 (21%)

Query: 35  AYKAVLTALKDGYRHIDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL--------- 82
           A+K +    + G   IDTA  Y+NE     +G+ ++   + R++I + TK          
Sbjct: 55  AFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL-RDQIVIATKFSTDYKWYDV 113

Query: 83  -------WC-TQHHEPEVALDQSLKRLGLDYVDLYLMHW 113
                  +C    H   V++  SL++L  D++D+  +HW
Sbjct: 114 GKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 72/163 (44%), Gaps = 35/163 (21%)

Query: 37  KAVLTALKDGYRHIDTAAIYRN-EDQVGQAIKDSGVPREEIFVTTKL-------WCTQHH 88
           +  L   +  +  +DT+  Y + E  VGQA+++  +PR EI+V TK+       +     
Sbjct: 31  RKCLITHRRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRE 90

Query: 89  EPEVALDQSLKRLGLD--YVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWN 146
              +++ +S++RL  +  Y+D+  +H     D  +   E  L+                 
Sbjct: 91  NVRMSVMRSVERLVGEGGYLDVVYLH-----DVEFQPQEACLA----------------- 128

Query: 147 FIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTP 189
                + +Q+L + G  + VGVS + ++ L  L++   +  TP
Sbjct: 129 ---ALDELQKLKRAGIVRNVGVSGYPLSKLYSLVSLCYDAGTP 168

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 85/230 (36%), Gaps = 64/230 (27%)

Query: 28  WQSKENDAYKAVLTALKD-GYRHIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKLW 83
           W  ++ D    +L    D G R  DTA +Y N   E  VG+ +K   + RE + + TK++
Sbjct: 34  WVMEDKDEIFKILKHCYDRGLRTFDTADVYSNGISERLVGEFLKKYNIKRETVVIMTKIF 93

Query: 84  ------CTQHHEPEV----------------------ALDQSLKRLGLDYVDLYLMHWPA 115
                    HH   V                       +  S++RLG  Y+D+  +H   
Sbjct: 94  FPVDESLDLHHGSNVNQEAMELQLTLQRGLSRKHIIDGVANSVERLG-TYIDVLQIH--- 149

Query: 116 RLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINN 175
           RLD      E + S                        + ++  +G+ + +G S+     
Sbjct: 150 RLDEETSMEEIMRS------------------------LNDVVMSGQVRYIGASSMLATE 185

Query: 176 LKDL-LASQGN---KLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSP 221
             +L   ++ N   K   A +   +     + ELI FCK  G+ +  +SP
Sbjct: 186 FAELQFIAEKNGWFKFISAQSYYNLINREDERELIPFCKKHGVGLIPWSP 235

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 104/265 (39%), Gaps = 66/265 (24%)

Query: 46  GYRHIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLG 102
           G R  DTA  Y N   E  +G+ +K   + RE + + TK++          +D++L    
Sbjct: 30  GLRTFDTADYYSNGYSEILLGEFLKKYKIKRETVVILTKIF--------FPVDETL---- 77

Query: 103 LDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDG-SRAVDI--TNWNFIKTWELMQELP- 158
               DL+L   P  +D   + N+  LS     DG  R+V+   T  + ++     Q+ P 
Sbjct: 78  ----DLHLGEEPIGVDQLDVVNQRGLSRKHIVDGVKRSVERLGTYIDVLQIHRFDQDTPI 133

Query: 159 -----------KTGKTKAVGVSNFSINNLKDL-LASQGNKLTPAANQVEIHPLLPQD--- 203
                      + G  + +G S+       ++   ++  +     N   ++ L+ ++   
Sbjct: 134 KERMKALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEWFQFVNSQSLYNLIYREDER 193

Query: 204 ELINFCKSKGIVVEAYS---------PLGST-----DAPLLKEPV--------------I 235
           ELI FCK   I +  +S         P+GST     + P +K  +              +
Sbjct: 194 ELIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFVKCTLTKKLEKSDIEIINRV 253

Query: 236 LEIAKKNNVQPGHVVISWHVQRGYV 260
            E+AKK       +  +W + +G V
Sbjct: 254 EELAKKKKCSMAVISTAWVISKGCV 278

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 63/144 (43%), Gaps = 34/144 (23%)

Query: 2   PATLHDSTKILSLNTGAQIPQIGLG------TW------QSKENDAYKAVLTALKDGYRH 49
           P+T     ++LS + G ++  + LG       W       SKE  A++ +    + G   
Sbjct: 11  PSTELGRLRVLSKSAGIRVSPLILGGMSIGDAWSEILGSMSKER-AFELLDAFYEAGGNF 69

Query: 50  IDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL----------------WCTQHHEP 90
           IDTA  Y+NE     +G+ +    + R++I + TK                 +C  H   
Sbjct: 70  IDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYDVGGGKSANYCGNHKRS 128

Query: 91  -EVALDQSLKRLGLDYVDLYLMHW 113
             V++  SL++L  D++D+  +HW
Sbjct: 129 LHVSVRDSLRKLQTDWIDILYVHW 152

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 60/143 (41%), Gaps = 32/143 (22%)

Query: 2   PATLHDSTKILSLNTGAQIPQIGLG------TWQS-----KENDAYKAVLTALKDGYRHI 50
           P T     ++LS   G ++  + LG       W        +  A++ +    + G   I
Sbjct: 11  PPTELGRLRVLSKTAGIRVSPLILGGASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCI 70

Query: 51  DTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL----------------WCTQHHEP- 90
           DTA  Y+NE+    +G+ +    + R++I + TK                 +C  H    
Sbjct: 71  DTANSYQNEESEIWIGEWMASRKL-RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSL 129

Query: 91  EVALDQSLKRLGLDYVDLYLMHW 113
            V++  SL++L  D++D+  +HW
Sbjct: 130 HVSVRDSLRKLQTDWIDILYIHW 152

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 32/143 (22%)

Query: 2   PATLHDSTKILSLNTGAQIPQIGLG------TWQS-----KENDAYKAVLTALKDGYRHI 50
           P T     ++LS + G ++  + LG       W        +  A++ +    + G   +
Sbjct: 11  PPTELGRLRVLSKSAGIRVSPLILGGASIGNAWSEFMGAMNKEQAFELLDAFYEAGGNCV 70

Query: 51  DTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL----------------WCTQHHEP- 90
           DTA  Y+NE     +G+ +K   V R++I + TK                 +C  H    
Sbjct: 71  DTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKKYEAGDGKSANYCGNHRRSL 129

Query: 91  EVALDQSLKRLGLDYVDLYLMHW 113
            V++  SL++L  D++D+  +HW
Sbjct: 130 HVSVRDSLRKLQTDWIDILYIHW 152

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 83/227 (36%), Gaps = 59/227 (25%)

Query: 105 YVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTK 164
           YVD+Y    PARLD   IK       P +                T++ + E  K GK  
Sbjct: 120 YVDIY---EPARLDLELIKKTGESVFPRE----------------TFDTIVEYVKKGKIG 160

Query: 165 AVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPL-LPQDELINFCKSKGIVVEAYSPLG 223
            + +S  +   ++ +    G  L     ++ +    +  + +++ C   G+ + AYSPLG
Sbjct: 161 GISLSEVTAEQIRAIHKEYGEYLVCVEVELSMFSAEILSNGIVDTCNELGLPIVAYSPLG 220

Query: 224 ----------STDAPLLKEPVILE---------------------IAKK-NNVQPGHVVI 251
                     S+D P     + L+                     IAK+ +NV    V I
Sbjct: 221 RGLLTGALAKSSDIPAGDFRIQLKRFQDDAFAHNKSLVEFLENEIIAKRSDNVTLPQVAI 280

Query: 252 SW--HVQRGY-----VVLPKSVNPDRIKTNRKIFTLSTEDFEAINNI 291
            W   + + Y     + +P     D++ +N     LS E+   I+  
Sbjct: 281 GWIRAISKNYPNTKIIPIPSGTTVDKVTSNYSFIELSDEELAKIDKF 327

>Skud_3.183 Chr3 (296810..296845,296849..297115,297116..297466) [654
           bp, 217 aa] {ON} YCR107W (REAL)
          Length = 217

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 22/96 (22%)

Query: 39  VLTALKDGYRHIDTAAIYRNE---DQVGQAIKDSGVPREEIFVTTKL------------- 82
           +L A  +    ID A  Y NE   + +G+  K   + RE+I + TK              
Sbjct: 4   LLDAFYEACNFIDAANNYENEQWEEWIGEWTKSRKL-REKIVICTKYAGDYKKCEADEGK 62

Query: 83  ---WCTQH--HEPEVALDQSLKRLGLDYVDLYLMHW 113
              +C  H  H   V++  SL +L  D++D+  +HW
Sbjct: 63  SANYCGYHQKHSLHVSVRDSLHKLQTDWIDILYVHW 98

>TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.604
           YMR041C
          Length = 340

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 18/111 (16%)

Query: 20  IPQIGLG--TWQSKEND------AYKAVLTALKDGYRHIDTAAIYRNEDQV-GQAIKDSG 70
           +P + LG  T  S+ ND          +  A ++G   IDT+  Y + + + G+A+K   
Sbjct: 20  LPNLILGGATLSSQYNDDPNSIPIADMIRFAFRNGITAIDTSPYYGDSEIIYGKALKSIK 79

Query: 71  V--PREEIFVTTKLWCTQHHEPEVALD-------QSLKRLGLDYVDLYLMH 112
           +  PR+  F+ TK+     +E + + +       +S KRL  +Y+D+  +H
Sbjct: 80  IEFPRDTYFICTKVGRIGSNEFDYSANNVRKSILRSCKRLNTNYLDVVYLH 130

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 91/215 (42%), Gaps = 41/215 (19%)

Query: 19  QIPQI--GLGTWQS-KENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGVPREE 75
           Q P+I  G  T+ S  + +A K V    K     +DTA IY   ++   AI    +P+  
Sbjct: 3   QPPKIIYGAFTFASLTQEEASKFVDVLEKYKVEELDTARIYPGSEE---AIGKFELPKSF 59

Query: 76  IFVTTKLWCTQHHEPEVALDQSLKR----LGLDYVDLYLMHWPARLDPAYIKNEDILSVP 131
           I  T      +    + ++++S++     LG++ V+++ +H P   DPA          P
Sbjct: 60  IIDTKARGFGEGTLTKESINESIEESFGLLGVESVEIFYLHCP---DPA---------TP 107

Query: 132 TKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNK--LTP 189
            ++               T + +  L K GK K  GVSNFS  +++ + +    K  + P
Sbjct: 108 LEE---------------TLDAIDALYKEGKFKKFGVSNFSPEDVRKIYSYNKEKGYVLP 152

Query: 190 AANQVEIHPLLPQDE--LINFCKSKGIVVEAYSPL 222
              Q   + +  + E  L    +  G+   AYSP+
Sbjct: 153 TVYQGNYNAVGRKIETSLFPVLRELGLSFYAYSPI 187

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 103/258 (39%), Gaps = 67/258 (25%)

Query: 15  NTGAQIPQIGLG--TWQSKE---------NDAYKAVLTALKDGYRHIDTAAIYRN---ED 60
           NTG +I  I +G  ++ SKE          + +K +  A   G R  DTA +Y N   E 
Sbjct: 48  NTGLKISPIVVGCMSFGSKEWADWLIEDKEEVFKILKRAYDRGLRTYDTADVYSNGLSER 107

Query: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120
            +G+ ++   + RE + + TK++           D+S+             H  ++ D  
Sbjct: 108 ILGEFLRHYNINRETVVILTKVF--------FPTDESI-------------HVTSKFD-- 144

Query: 121 YIKNEDILSVPTKKDGSRA----------------VDITNWNFIKTWELMQELPKT---- 160
               +++L++  ++  SR                 +D+   + +     M+E+ +     
Sbjct: 145 -FSEQELLTLTNQRGLSRKHILAGVKASIERLGTYIDVLQIHRLDHETPMEEIMRALNDV 203

Query: 161 ---GKTKAVGVSNFSINNLKDL--LASQGNKLTPAANQVEIHPLLPQD--ELINFCKSKG 213
              G  + +G S+       +L  +A + +     ++Q     L  +D  ELI F K  G
Sbjct: 204 VTQGDVRYIGASSMLATEFAELNFIAERHDWFKFVSSQSYYSLLYREDERELIPFAKRHG 263

Query: 214 IVVEAYSPL--GSTDAPL 229
           I +  +SPL  G+   PL
Sbjct: 264 IALIPWSPLSGGALTRPL 281

>YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putative
           aryl-alcohol dehydrogenase; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; mutational analysis has not
           yet revealed a physiological role
          Length = 363

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 21/102 (20%)

Query: 32  ENDAYKAVLTALKDGYRHIDTAAIYRNEDQ---VGQAIKDSGVPREEIFVTTKL------ 82
           +N A++ + T  + G   ID A   +NE     +G+ I+   + R++I + TK       
Sbjct: 49  KNRAFELLDTFYEAGGNFIDAANNCQNEQSEEWIGEWIQSRRL-RDQIVIATKFIKSDKK 107

Query: 83  ----------WCTQHHEP-EVALDQSLKRLGLDYVDLYLMHW 113
                     +C  H     V++  SL++L  D++D+  +HW
Sbjct: 108 YKAGESNTANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 149

>NDAI0G02760 Chr7 (629341..644226) [14886 bp, 4961 aa] {ON} Anc_8.295
            YLR106C
          Length = 4961

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 72/164 (43%), Gaps = 31/164 (18%)

Query: 170  NFSINNLKDLLAS--------QGNKLTPAANQVEIHPLLPQDELI--NFCKSKGIVVEAY 219
            ++ +N+LKD+L S         G +    +  +++   L ++ +   NF   K   +   
Sbjct: 2131 SYIVNDLKDILRSLLSINMGIYGQETAAVSAGLDLFYFLLEEIVTPENFQIFKDKFISLL 2190

Query: 220  SPLGSTDAPLLKEPVILEIAKKNNVQPGHVVISWH-------VQRGYVVLPKSVNP---- 268
            S L S +A +     I +I+K NNV  G V   W        V++G+ ++  + N     
Sbjct: 2191 SHLHSNEALIDINERITKISKINNVSNG-VTFEWFDGMLVKAVEKGHWLVLDNANLCSPS 2249

Query: 269  --DRIKTNRKIFTLSTEDFEAINNISKEKGEKRVV--HPNWSPF 308
              DR+ +      L T+    IN  S+  GE RV+  HPN+  F
Sbjct: 2250 VLDRLNS-----LLETDGTLLINECSEANGEPRVIKPHPNFRLF 2288

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 62/145 (42%), Gaps = 36/145 (24%)

Query: 2   PATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTAL-------------KDGYR 48
           P T     +ILS N G ++  + LG       DA++  L ++             + G  
Sbjct: 11  PPTELGRLRILSKNAGIRVSPLVLGAMSI--GDAWEETLGSMDKQRSFELLDAFYEAGGN 68

Query: 49  HIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKL----------------WCTQHHE 89
            IDTA  Y+N   E+ +G+ +    + R++I + TK                 +   H  
Sbjct: 69  FIDTANNYQNGQSEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSANFSGNHRR 127

Query: 90  P-EVALDQSLKRLGLDYVDLYLMHW 113
             ++++  SL++L  D++D+  +HW
Sbjct: 128 SLQLSVRDSLRKLQTDWIDILYVHW 152

>Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig
           119] FULL
          Length = 67

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 253 WHVQRGYVVLPKSVNPDRIKTNRKIF 278
           W   +G+VVL KS NP+RI+ N  + 
Sbjct: 2   WSFLQGFVVLVKSSNPERIRQNLAVL 27

>KLTH0E02530g Chr5 complement(221189..232354) [11166 bp, 3721 aa] {ON}
            similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3721

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 43   LKDGYRHIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLG 102
            L+ G+R  D +A     +Q  +++ D   PR +IF T      Q+       DQ +KRL 
Sbjct: 2732 LECGWRVADWSADREALEQSVKSVMDVPTPRRQIFET--FLALQNFAETKKGDQEVKRLC 2789

Query: 103  LDYVDLYLMHW---PARLDPAY 121
             + + L L  W   P R  PA+
Sbjct: 2790 DEGIQLSLHAWASMPERFTPAH 2811

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 18/107 (16%)

Query: 23  IGLGTWQSKENDAYKAV--LTALKDGYRH----IDTAAIYR-NEDQVGQA---IKDSGVP 72
           +G  T  ++ ND    V  +  LK G+ H    IDT+  Y  +E   GQA   I+D   P
Sbjct: 24  LGGATVNTQYNDDPTKVPLVDMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDE-FP 82

Query: 73  REEIFVTTKLWCTQHHEPEVALD-------QSLKRLGLDYVDLYLMH 112
           R   ++ TK+   Q  E + + +       +S +RL  DY+DL  +H
Sbjct: 83  RNSYYICTKVGRIQLDEFDYSREHVRFSVLRSCQRLKTDYLDLVYLH 129

>SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly
          similar to uniprot|Q02895 Saccharomyces cerevisiae
          YPL088W Putative aryl alcohol dehydrogenase
          transcription is activated by paralogous transcription
          factors Yrm1p and Yrr1p along with genes involved in
          multidrug resistance
          Length = 342

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 32 ENDAYKAVLTALKDGYRHIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKLW 83
          E + +K +     +G R  DTA  Y N   E  VG+ +K   + RE + + TK++
Sbjct: 39 EEEIFKVLKHCYDNGLRTFDTADFYSNGLSERLVGKFLKRYNINRETVVILTKVF 93

>Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 59/151 (39%), Gaps = 24/151 (15%)

Query: 85  TQHHEPEVALDQSLKRLGLDYVDLYLMHWP-------ARLDPAYIKNEDILSVPTKKDGS 137
           T+  EP +      KR+  D   +    W        A L P Y +N     V       
Sbjct: 38  TESREPTIGAAFLTKRITRDDKAIKFEIWDTAGQERFAPLAPMYYRNAQAALV------- 90

Query: 138 RAVDITN-WNFIKTWELMQEL-PKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQVE 195
              DITN  +F K  + ++EL  K G    + +    + N  DLL  QG     A N+ E
Sbjct: 91  -VFDITNEQSFRKAQDWVEELHEKLGDNIIIAL----VGNKMDLLTMQGEISNRAVNEDE 145

Query: 196 IHPLLPQDELINF---CKSKGIVVEAYSPLG 223
           I  L  Q+ L+ F    K+   + E +  +G
Sbjct: 146 IQNLCQQENLLYFEVSAKTGKNIHEVFQAVG 176

>KLLA0A05951g Chr1 (552438..553298) [861 bp, 286 aa] {ON} highly
           similar to uniprot|Q75BM7 Ashbya gossypii ACR244C
           ACR244Cp and similar to YKR062W uniprot|P36145
           Saccharomyces cerevisiae YKR062W TFA2 TFIIE small
           subunit involved in RNA polymerase II transcription
           initiation
          Length = 286

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 31/71 (43%), Gaps = 11/71 (15%)

Query: 74  EEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTK 133
           +E FVT    C      E  L + L+ LGL          PA +DPA IKNE       K
Sbjct: 213 DEEFVTMWEACKLPQRSE--LPRKLQDLGLK---------PASVDPATIKNEQTTRKEVK 261

Query: 134 KDGSRAVDITN 144
           K  SR   +TN
Sbjct: 262 KRRSRKGKVTN 272

>KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON}
          highly similar to uniprot|Q02895 Saccharomyces
          cerevisiae YPL088W Putative aryl alcohol dehydrogenase
          transcription is activated by paralogous transcription
          factors Yrm1p and Yrr1p along with genes involved in
          multidrug resistance
          Length = 344

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 12/73 (16%)

Query: 23 IGLGTWQSKE-----NDAYKAVLTALKDGYRH----IDTAAIYRN---EDQVGQAIKDSG 70
          IG  ++ SK+      D  + + + LK  Y H     DTA  Y N   E  VG+ +K   
Sbjct: 21 IGCMSYGSKDWAAWVEDDKEKIFSTLKYCYDHGLRTFDTADFYSNGLSEKLVGEFLKKYN 80

Query: 71 VPREEIFVTTKLW 83
          + RE + + TK++
Sbjct: 81 IRRETVVILTKVY 93

>KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 338

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 90/213 (42%), Gaps = 19/213 (8%)

Query: 34  DAYKAVLTALKDGYRHIDTAAIYRN---EDQVGQAIKDSGVPREEIFVTTKLWCTQHHEP 90
           + +K +     +G R  DTA IY N   E  +G+ +++  + RE + + +K+    +   
Sbjct: 41  EIFKILKYCYDNGLRTFDTADIYSNGLSERLIGEFLRNYNINRETVVILSKV----NFPV 96

Query: 91  EVALDQSLKRL-GLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIK 149
           + +LD S+K +  +D V    +     L   +I +    SV         + I  ++   
Sbjct: 97  DESLDLSVKSIFNVDEVTALTLTNQRGLSRKHIIDGVAKSVERLGTYIDVLQIHRFDSET 156

Query: 150 TWE----LMQELPKTGKTKAVGVSNFSINNLKDL--LASQGNKLTPAANQVEIHPLLPQD 203
           T E     + ++ ++G  + +G S+       DL     +       ++Q + + L  +D
Sbjct: 157 TMEETMRALNDVVESGHARYIGASSMLATEFSDLQFTVERNGWFKFISSQSQYNLLYRED 216

Query: 204 --ELINFCKSKGIVVEAYSPLGSTDAPLLKEPV 234
             ELI + K  GI +  +SP       LL  PV
Sbjct: 217 ERELIPYAKRHGIGLIPWSP---NARGLLTRPV 246

>NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3.441
           YGR098C
          Length = 1648

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 109 YLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGV 168
           YL H+   +  AYI N D+     K+  +  + +   +FI  W L  EL +  + K   +
Sbjct: 581 YLYHYEVLIKSAYILNIDM-----KRHSTNNLLLLTRSFIDKWILRLELSQYKERKD-DI 634

Query: 169 SNFSINNLKDLL 180
           S+F +N +K L 
Sbjct: 635 SSFEVNFVKTLF 646

>KLTH0D13750g Chr4 complement(1120534..1121550) [1017 bp, 338 aa]
           {ON} similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W Hypothetical ORF
          Length = 338

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 149 KTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQVEI-HPLLPQDELIN 207
           +T+E + E  K G    + +S  +   ++ + A  G  +     +  + HP +  + +++
Sbjct: 141 ETFETLVEYIKKGSLGGLSLSEVNAEQIRAIHAKYGEYICCVEVEFSLYHPEILTNGIVD 200

Query: 208 FCKSKGIVVEAYSPL 222
            C   GI +  YSPL
Sbjct: 201 ACNELGIPIVCYSPL 215

>TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa]
          {ON} 
          Length = 344

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 14/86 (16%)

Query: 12 LSLNTGAQIPQIGLGT----------WQSKENDAYKAVLTALKD-GYRHIDTAAIYRNED 60
          L  N+G +I  I +G           W  ++ +   ++L    D G R  DTA +Y N  
Sbjct: 11 LGKNSGLKISPILVGCMSYGCKQWAEWVLEDKEKIFSILKHCYDHGLRTFDTADVYSNGA 70

Query: 61 Q---VGQAIKDSGVPREEIFVTTKLW 83
              VG+ +K   + RE + + TKL+
Sbjct: 71 SGRLVGEFLKKYNIDRETVVILTKLF 96

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 15/73 (20%)

Query: 151 WELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQV---------------E 195
           W  ++E    GK K + + NF INN+K       NK     N+                E
Sbjct: 291 WNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRITPEIIIEKIKSE 350

Query: 196 IHPLLPQDELINF 208
           + PL+P  E++++
Sbjct: 351 LLPLIPDFEILSY 363

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,175,745
Number of extensions: 1576138
Number of successful extensions: 4578
Number of sequences better than 10.0: 167
Number of HSP's gapped: 4326
Number of HSP's successfully gapped: 168
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)