Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR119C (RIO1)5.432ON48440121590.0
Skud_15.2825.432ON48539920280.0
Smik_15.2975.432ON48639920230.0
Suva_8.1725.432ON48639919810.0
KAFR0E039205.432ON49741316650.0
NCAS0F033605.432ON50943216470.0
SAKL0G02486g5.432ON50040016290.0
Kpol_1062.315.432ON51342616270.0
CAGL0L11594g5.432ON50741115940.0
KLTH0F16104g5.432ON54039815960.0
KNAG0C049305.432ON49641015820.0
Kwal_55.214335.432ON47640015790.0
TBLA0A037605.432ON50441015780.0
TDEL0E019305.432ON50238915730.0
KLLA0E21121g5.432ON52642215700.0
TPHA0E017805.432ON50842015680.0
AER257W5.432ON47739815490.0
NDAI0B056505.432ON46238515170.0
Ecym_47635.432ON53841615060.0
ZYRO0F09988g5.432ON46039413470.0
TPHA0H009202.44ON4292341312e-07
NCAS0G015802.44ON4242321284e-07
CAGL0H08019g2.44ON4252341276e-07
Suva_14.1362.44ON4262321269e-07
NDAI0F036002.44ON4212321232e-06
Smik_14.1252.44ON4202321195e-06
KAFR0A077602.44ON4252321196e-06
Skud_14.1292.44ON4252321161e-05
Kpol_400.72.44ON4252321133e-05
ABL166W2.44ON4142361106e-05
ZYRO0C10340g2.44ON4162361106e-05
TDEL0A008602.44ON4192321099e-05
SAKL0E13552g2.44ON4192321081e-04
KLTH0B07722g2.44ON4282331081e-04
Ecym_64492.44ON4172341072e-04
Kwal_23.45632.44ON4252331062e-04
YNL207W (RIO2)2.44ON4252321053e-04
KNAG0F010602.44ON4282371053e-04
KLLA0D19008g2.44ON4222321044e-04
TBLA0G003702.44ON444187840.11
SAKL0F06424g3.443ON2473119830.16
Ecym_11191.104ON791234780.54
KLLA0F15576g5.200ON51251780.57
KAFR0D019505.43ON262188731.6
TDEL0B039306.161ON107874689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR119C
         (484 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   836   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   785   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   783   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   767   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   645   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   639   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   632   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   631   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   618   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   619   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   613   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   612   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   612   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   610   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   609   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   608   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   601   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   588   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   584   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   523   0.0  
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    55   2e-07
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      54   4e-07
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    54   6e-07
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    53   9e-07
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    52   2e-06
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    50   5e-06
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    50   6e-06
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    49   1e-05
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    48   3e-05
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    47   6e-05
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    47   6e-05
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    47   9e-05
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    46   1e-04
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    46   1e-04
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    46   2e-04
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    45   2e-04
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    45   3e-04
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    45   3e-04
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    45   4e-04
TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44 ...    37   0.11 
SAKL0F06424g Chr6 (490525..497946) [7422 bp, 2473 aa] {ON} simil...    37   0.16 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    35   0.54 
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    35   0.57 
KAFR0D01950 Chr4 (393813..394601) [789 bp, 262 aa] {ON} Anc_5.43...    33   1.6  
TDEL0B03930 Chr2 (705201..708437) [3237 bp, 1078 aa] {ON} Anc_6....    31   9.0  

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/401 (100%), Positives = 401/401 (100%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120
           RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240
           PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL
Sbjct: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV
Sbjct: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300

Query: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHEC 401
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHEC
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHEC 401

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/399 (93%), Positives = 390/399 (97%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           MSLED+FD L+VSQ ASDHINNQLLEKYSHKIKTDELSFS+AKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120
           RTMRFLKSMV RGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG R 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240
           PAP+P+EVKNNVLVMEFLSRGNGFASPKL+DYPY++R+EIFHYYHTMVAYMRLLYQVCRL
Sbjct: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYNTI+H+DKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMG+SIFPERV
Sbjct: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300

Query: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE+LEKFKGDY+N+  LV YIA NLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/399 (94%), Positives = 388/399 (97%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           MSLED FD L+VSQ ASDHINNQLLEKYSHKIKTDELSF+RAKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120
           RTMRFLKSMV RGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETG+YEVLETDG R 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240
           PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPY++R EIFHYY+TMVAYMRLLYQVCRL
Sbjct: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYNTI+HDDKL+MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV
Sbjct: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300

Query: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE+LEKFK DY+N++ LV YIA NLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/399 (90%), Positives = 387/399 (96%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           MS EDKF+ L+VSQ ASDHINNQLL+K+SHKIKTDELSFS+AKTSKDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120
           RTMRFLKSMV RGVIADLNGCLSTGKEANVYHAFAGTGKAPV+DEETG+YEVLETDG RA
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVVDEETGKYEVLETDGLRA 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           EYAIKIYKTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLKRI+QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240
           PAPKP+EVKNNVLVMEFLSRG+GFASPKLKDYPYK+R+EIFHYY+TMVAYMRLLYQVCRL
Sbjct: 181 PAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYNTI+HDD+LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGI+IFPERV
Sbjct: 241 VHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFPERV 300

Query: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE LEKFKGDY N+  L+ YI+ NLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEF++ DH
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFNDNDH 399

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/413 (75%), Positives = 357/413 (86%), Gaps = 18/413 (4%)

Query: 1   MSLEDKFDSLSVS--QGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVL 58
           MS+EDKFD+L +S  +G+SDHINNQ+L+KY HKIKT+E S SR KT+KDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 59  DPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGK--------------APVID 104
           DPRTM+FL+++++RGVI+  +GCLSTGKEANVYHAFAGTG+               PV  
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 105 EETGQYEVLETDGS--RAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 162
            E    E  + + +  R EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180

Query: 163 WAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFH 222
           WAEKEFRNLKRIYQS VIPAPKPIE+KNNVLVMEFL+RG+GFASP+LKD+PYK+R+EIFH
Sbjct: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240

Query: 223 YYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIK 282
           YYHT+VAY+RLLYQVC LVHADLSEYNT+VH  +LY+IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300

Query: 283 NVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAE 342
           NVN YFEKMGI IFPER+IFQFVISETL+KF GDY +   L  Y+  NLPIK+T QDEAE
Sbjct: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360

Query: 343 DEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFD 395
           DEIFRSL+LVR+L GLEERDFDRYT+G+FDLLKSL+AHDNE+NFAASEQ+E +
Sbjct: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYELE 413

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/432 (71%), Positives = 358/432 (82%), Gaps = 34/432 (7%)

Query: 1   MSLEDKFDSLSVS-QGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLD 59
           MSLEDKFD L++S +  ++H NN++L+KY HK KTDE+SF+R+KT+KDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 60  PRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGK--APVIDE------------ 105
           PRTMRFLK++ +RGVI+D NGCLSTGKEANVYHAFAG  K  A V+ E            
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 106 ---------ETGQYEVLETD----------GSRAEYAIKIYKTSILVFKDRERYVDGEFR 146
                    +    E LET+            + EYA+KI+KTSILVFKDRERYVDGEFR
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180

Query: 147 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFAS 206
           FRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSGVIP PKPIEVKNNVLVMEFL RG+GFAS
Sbjct: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240

Query: 207 PKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSV 266
           P+LKD+PYK+R+EIFHYYHT+VAYMRL+YQ+CRLVHADLSEYN ++H DK+Y+IDVSQSV
Sbjct: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300

Query: 267 EPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAY 326
           EPEHPMSLDFLRMDIKN+N YFEKMGI IFPERVIFQF+IS+TLE F GDY + + L  Y
Sbjct: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360

Query: 327 IASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNF 386
           +A NLPIK +EQDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKSLIAHDNE+NF
Sbjct: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420

Query: 387 AASEQFEFDNAD 398
           +A+EQF+    D
Sbjct: 421 SAAEQFDLKAQD 432

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/400 (75%), Positives = 348/400 (87%), Gaps = 10/400 (2%)

Query: 1   MSLEDKFDSLSVSQGAS---DHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENV 57
           MS+E  F  L +  G     DH+N+++L+KYSH+IKTDELS +R KT+KDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 58  LDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117
           LDPRTMRFL+ +V+RGV++DLNGCLSTGKEANVYHAFAG    P  + E    + L    
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDEL---- 116

Query: 118 SRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177
            + EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 117 VKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 176

Query: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQV 237
           GVIP P+PIEV++NVLVMEFL+RGNGFASP+LKD+PYK+R+EI +YYHTMVAYMRLLYQV
Sbjct: 177 GVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQV 236

Query: 238 CRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297
           C+LVHADLSEYNTIVH D+LYMIDVSQSV+PEHPMSLDFLRMDIKN+N YFEK GI IFP
Sbjct: 237 CQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFP 296

Query: 298 ERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ERVIFQF+ISETL+KF+GDY+N   L  Y++ NLP+KST +DEAEDE+FRSLHLVR+L G
Sbjct: 297 ERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNG 356

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394
           LEERDFDR+TDGKFDLLKSLIAHDN++   NF ASEQFE 
Sbjct: 357 LEERDFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQFEI 396

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/426 (72%), Positives = 351/426 (82%), Gaps = 31/426 (7%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           MS ++KFD L +S    + +N ++LEKY HKIKTDELSF++ KT+KDKANRATVENVLDP
Sbjct: 1   MSFDEKFDRLKIS---GNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDP 57

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPV------------------ 102
           RTMRFLK++  RGVI+  NGCLSTGKEANVYHAFAG G +                    
Sbjct: 58  RTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVN 117

Query: 103 --IDEETG-QYEVLETDGS-------RAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRS 152
              +E+ G    V + DGS       R EYAIKIYKTSILVFKDRERYVDGE+RFRNSRS
Sbjct: 118 QDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177

Query: 153 QHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDY 212
           QHNPRKMIKIWAEKEFRNL+RI+QSGVIPAPKP+EVK+NVLVMEFL+RGNGFASP+LKDY
Sbjct: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237

Query: 213 PYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPM 272
           PYK+RDEIF YYH +VAYMRLLYQVCRLVHADLSEYNTIVH  KLYMIDVSQSVEPEHPM
Sbjct: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297

Query: 273 SLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLP 332
           SLDFLRMDIKNVN YFEKMGI IFPER+IFQFVISE LE FKGD N+   L  ++ +NLP
Sbjct: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357

Query: 333 IKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQF 392
           IKST++DEAEDE+FRSLHLVR+LGGLEERDFDR+TDGKFDLLK+LIA DN++NF ASEQ+
Sbjct: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQY 417

Query: 393 EFDNAD 398
             ++ D
Sbjct: 418 GMEDLD 423

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/411 (72%), Positives = 345/411 (83%), Gaps = 27/411 (6%)

Query: 3   LEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDPRT 62
           L DKF ++ VS   +DHINNQ+++KY HKIKTDELS ++AKT+KDKANRATVENVLDPRT
Sbjct: 4   LSDKFRNVKVS---TDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRT 60

Query: 63  MRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGT-----------------------GK 99
           MRFL ++V RGVIA LNGCLSTGKEANVYHAFAG+                       G 
Sbjct: 61  MRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGN 120

Query: 100 APVIDEETGQYEVLETDGSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKM 159
             + +      E L  +G R EYAIKIYKTSIL+FKDRERYVDGEFRFRNSRSQHNPRKM
Sbjct: 121 IDISENRAKTAEDLIREG-RKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKM 179

Query: 160 IKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDE 219
           IKIWAEKEFRNLKRIYQ GVIP+P+PIEVKNNVLVMEFL+RG+GFASPKL+DYPYK+R+E
Sbjct: 180 IKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREE 239

Query: 220 IFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRM 279
           I++YYH +V+YMRLLYQVCRLVHADLSEYNTIVH +KLYMIDVSQSVEPEHPMSLDFLRM
Sbjct: 240 IYYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRM 299

Query: 280 DIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQD 339
           DIKNVNLYFEKMGI IF E+ IFQFVI++TL+KF GD N+   L  Y+A+N+PIK T++D
Sbjct: 300 DIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQED 359

Query: 340 EAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE 390
           EAEDE+FRSLHLVR+L GLEERDFDR+TDGKFDLLKSL+A DN++N+ A++
Sbjct: 360 EAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAAQ 410

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/398 (75%), Positives = 343/398 (86%), Gaps = 10/398 (2%)

Query: 1   MSLEDKFDSLSVSQ--GAS-DHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENV 57
           MSLED    LS+ +  GA  DHIN Q+L+K++H IKTDELS +RAKTSKDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 58  LDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117
           LDPRTMRFL+++ +RGVI++ NGCLSTGKEANVYHAFAG G     +E+    +VL   G
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQ----KVLPNQG 168

Query: 118 SRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177
            R EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS
Sbjct: 169 ERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 228

Query: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQV 237
           GV+PAP+PIEVK+NVLVMEFL+RG+GFASPKLKD+PYK+RDE  +YYHTMVAY+RLLYQ 
Sbjct: 229 GVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQC 288

Query: 238 CRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297
           C+LVHADLSEYNTIVH+ KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M I IFP
Sbjct: 289 CQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFP 348

Query: 298 ERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ER IFQFVIS+ LEKF+G+Y N   L  Y+A  L  KS  +DEAEDE+FRSLHLVR+LGG
Sbjct: 349 ERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGG 408

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQF 392
           LEERDFDR+T GKFDLLKSLIAHDN++   NF ASEQ+
Sbjct: 409 LEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/410 (71%), Positives = 347/410 (84%), Gaps = 14/410 (3%)

Query: 1   MSLEDKFDSLSVSQGASDHI-NNQLLEKYSHKIKTDELSFSRAK-TSKDKANRATVENVL 58
           MS+E+KF+ LS+     D   NN+LL+KY+HKIK D+ SFS+ K T+KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 59  DPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTG----KAPVIDEET------- 107
           DPRTMRFL++++ RG+I+D NGCLSTGKEANVYHAFAG G       + DEE+       
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120

Query: 108 GQYEVLETDGSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 167
            +  V  + G + EYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180

Query: 168 FRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTM 227
           FRNLKRIYQSG +P PKP+EVKNNVLVMEFL+RG+GFASP+L+DYPYK+ D I  YY T+
Sbjct: 181 FRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240

Query: 228 VAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLY 287
           VAYMRL+YQVC LVHADLSEYN +VH+D+LY+IDVSQSV+PEHPMSLDFLRMDIKNVNLY
Sbjct: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300

Query: 288 FEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFR 347
           F KMGI IFPER+IFQFVISE+L+KF+GDY +   L  Y+ SNLP+K TEQDE EDE+FR
Sbjct: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360

Query: 348 SLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE-QFEFDN 396
           SL+LVR+L GLEERDFDR+T+GKFDLLKSL+AHD E+NF A+E QFEFD+
Sbjct: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEFDD 410

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/400 (74%), Positives = 340/400 (85%), Gaps = 10/400 (2%)

Query: 1   MSLEDKFDSLSVS---QGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENV 57
           MSL+D+ D+L +    +   DHIN Q+L+K++H IK DELS SR KTSKDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 58  LDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117
           LDPRTMRFL+++ +RGVI+  NGC+STGKEANVYHAFA  G      EE G  EVL    
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNT--EEAG--EVLPNLE 116

Query: 118 SRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 177
            R E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS
Sbjct: 117 ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 176

Query: 178 GVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQV 237
           G++PAP+P+EV++NVLVMEFLSRGNGFASP+LKDYPYK+R+E  HYY+TMVAY+RLLYQ 
Sbjct: 177 GLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQC 236

Query: 238 CRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFP 297
           C+LVHADLSEYN IVH+ +LY+IDVSQSV+PEHPMSLDFLRMDIKNVN YFE+M + +FP
Sbjct: 237 CQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFP 296

Query: 298 ERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ERVIFQFVISETL+KF GDY +   L  Y++ NLP+KS  QDEAEDE+FRSLHLVR+LGG
Sbjct: 297 ERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGG 356

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394
           LEERDFDR+T GKFDLLKSLIAHDNER    F ASEQFE 
Sbjct: 357 LEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/410 (71%), Positives = 343/410 (83%), Gaps = 17/410 (4%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           M L+D F  L +S   ++H NN++L+K+ HKIKTDE S SR KT+KDKANRATVENVLDP
Sbjct: 1   MVLDDDFQKLDLS---NNHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDP 57

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETD---- 116
           RTMRFLK++ +RG+I+D NGC+STGKEANVYHAFAG   +P   +    +E L       
Sbjct: 58  RTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYDPY 117

Query: 117 ----------GSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEK 166
                       R EYAIKIYKTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEK
Sbjct: 118 SNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEK 177

Query: 167 EFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHT 226
           EFRNLKRIYQS VIP PKPIEVKNNVLVMEFL+RG+GFASP+LKDYPYK+ ++I HYYHT
Sbjct: 178 EFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHYYHT 237

Query: 227 MVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNL 286
           M+ Y+RLLYQVCRLVHADLSEYNT+VH +KLY+IDVSQSVEPEHPMSLDFLRMDIKN+N 
Sbjct: 238 MIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKNINN 297

Query: 287 YFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIF 346
           YFE+MG++IF ER+IFQF ISETL+ F G+Y+N   L  Y+ +NLP+K   +D+AEDEIF
Sbjct: 298 YFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAEDEIF 357

Query: 347 RSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDN 396
           RSLHLVR+LGGLEERDFDRYTDGKFDLLKSLIAHDNE+NF+ASEQ+ F++
Sbjct: 358 RSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSASEQYNFED 407

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/389 (76%), Positives = 337/389 (86%), Gaps = 9/389 (2%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           MSLED+FD L +S G  +H N Q+L+K+S+ IKTDELSF+R+K+SKDKANRATVENVLDP
Sbjct: 1   MSLEDQFDRLDISHG-REHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDP 59

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120
           RTMRFLKSM+ RGVI++ NGCLSTGKEANVYHAFAG     + D + G  +     G + 
Sbjct: 60  RTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES---IEDSKDGHVQ-----GEKK 111

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI QSGVI
Sbjct: 112 ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVI 171

Query: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240
           PAPKP+EVKNNVLVMEFLSRG+GFASP+LKD+ + +R EI+HYYHTM+AY+RLLYQVCRL
Sbjct: 172 PAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRL 231

Query: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300
           VHADLSEYN IVHD KLY+IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMGI IFPER+
Sbjct: 232 VHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERL 291

Query: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISETLEKF G+  + + L  Y++  LP+KST  D  EDEIFRSLHLVR+L GLEE
Sbjct: 292 IFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEE 351

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAAS 389
           RDFDR+TDGKFDLLKSLIAHDNER+  A+
Sbjct: 352 RDFDRFTDGKFDLLKSLIAHDNERHLRAA 380

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/422 (70%), Positives = 350/422 (82%), Gaps = 31/422 (7%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           M+++DK + L+++    +H+N Q+LE+Y++ IKTDELS +R KTSKDKANRATVENVLDP
Sbjct: 2   MNIDDKLEKLNLA-NRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAG--------------TGKAPVIDEE 106
           RTMRFLKSM+ RG+++  NGCLSTGKEANVYHAFAG              T  AP   E 
Sbjct: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120

Query: 107 TGQYEV-----------LETD--GSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 153
           T Q  +             TD   ++ EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQ
Sbjct: 121 TKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180

Query: 154 HNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYP 213
           HNPRKMIKIWAEKEFRNLKRIYQSGVIP PKPIEV++NVLVMEFL+RG+GFASP+LKD+P
Sbjct: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240

Query: 214 YKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMS 273
           YK+R+EI HYY+ M+AYMRLLYQVCRLVHADLSEYN+IVH+DKLY+IDVSQSV+PEHPMS
Sbjct: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300

Query: 274 LDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPI 333
           LDFLRMDIKNVN YF+K+GI IFPERVIFQF+ISE L+KFKGDY +   L  Y+A NLP+
Sbjct: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360

Query: 334 KSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNER---NFAASE 390
           K T++DEAEDE+FRSLHL+R+LGGLEERDFDR+TDGKFDLLKSLIA++N +   NF ASE
Sbjct: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTASE 420

Query: 391 QF 392
           Q+
Sbjct: 421 QY 422

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/420 (71%), Positives = 344/420 (81%), Gaps = 26/420 (6%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           MSLE KFD L V +  S+HIN+++LEKY HKIKTDELS ++ KT+KDKANRATVENVLDP
Sbjct: 1   MSLEGKFDKLKVHE--SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDP 58

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKA-------PVIDEE------- 106
           RTM+ LK+++ RGVI + NGCLSTGKEANVYHAFAG GK        P I E        
Sbjct: 59  RTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKE 118

Query: 107 --TGQYEVLETDG--------SRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNP 156
              GQ EV              R EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNP
Sbjct: 119 LIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNP 178

Query: 157 RKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKN 216
           RKMIKIWAEKEFRNL+RI+QSG+IPAP+P+EVK N+LVMEFL RG+GFASP+L+D+ YK 
Sbjct: 179 RKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKT 238

Query: 217 RDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDF 276
           R+EI +YYHT+VAY+RLLYQVCRLVHADLSEYNTIVHDDKLY+IDVSQSVEPEHPMSLDF
Sbjct: 239 REEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDF 298

Query: 277 LRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKST 336
           LRMDIKNVN YFEKMGI IFPER+IFQFVIS  L+KF GD  +   L  YIA  LP+K T
Sbjct: 299 LRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCT 358

Query: 337 EQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDN 396
           ++DE +DEIFRSLHLVR+L GLEERDFDR+TDGKFDLLK+LIA DN++NF AS QF+F+N
Sbjct: 359 DEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQFDFNN 418

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/398 (71%), Positives = 340/398 (85%), Gaps = 21/398 (5%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           M LED+   L + +  +DH N ++LEK++++IKTDELS ++ KT+KDKANRATVENVLDP
Sbjct: 1   MDLEDQLRKLKL-RDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDP 59

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAG-TGKAPVIDEETGQYEVLETDGSR 119
           RTMRFL+++V RGV+++ NGCLSTGKEANVYHA +G T  AP                 +
Sbjct: 60  RTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAP----------------EK 103

Query: 120 AEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGV 179
           +EYA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIYQSGV
Sbjct: 104 SEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGV 163

Query: 180 IPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCR 239
           IP P+P+E+K+NVLVMEFL+RG+GFASP+LKDYP+K+RDEI+HYYH MV+Y+RLLYQVC+
Sbjct: 164 IPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQ 223

Query: 240 LVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPER 299
           LVHADLSEYN+IVH  KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N+YFE+MGI IFPER
Sbjct: 224 LVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPER 283

Query: 300 VIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359
           VIFQFVISETL+KF+GD  +   L +Y+A+NLP K T QDEAED++FRSLHLVR+LGGLE
Sbjct: 284 VIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLE 343

Query: 360 ERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394
           ERDFDR+TDGKFDLLKSLIA DN +    F ASEQ++ 
Sbjct: 344 ERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYDL 381

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/385 (72%), Positives = 326/385 (84%), Gaps = 21/385 (5%)

Query: 37  LSFSRAKTSKDKANRATVENVLDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAG 96
           +SF++ KT+KDKANRATVENVLDPRTM+FLK++ +RGVI+D NGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 97  TGKAPV-----------IDEETGQYEVLETD---------GSRAEYAIKIYKTSILVFKD 136
             K              IDEE  + E LET            + EYA+KI+KTSILVFKD
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALK-EKLETQINPEETRLQKDKKEYAVKIFKTSILVFKD 119

Query: 137 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVME 196
           RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIEVKNNVL+ME
Sbjct: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179

Query: 197 FLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDK 256
           FL+RG+GFASP+L+DYPYK+R+E+ HYYH  +AYMRL+YQVCRLVHADLSEYN ++H++ 
Sbjct: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239

Query: 257 LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGD 316
           +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N+YF++MGI IFPERVIFQF+ISETL+KF G+
Sbjct: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299

Query: 317 YNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKS 376
           YN+ + L  Y+A  LPIK T QDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKS
Sbjct: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359

Query: 377 LIAHDNERNFAASEQFEFDNADHEC 401
           LIAHDNE+NF+A+EQFE  + D E 
Sbjct: 360 LIAHDNEKNFSAAEQFEIQDDDEEI 384

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/416 (68%), Positives = 339/416 (81%), Gaps = 23/416 (5%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60
           M LE+K   L +    S+H N+++L+K++++IKTDELS +R KTSKDKANRATVENVLDP
Sbjct: 33  MDLENKLGRLKL-LDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDP 91

Query: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVL------- 113
           RTMRFL+S++ RG+I + NGCLSTGKEANVYHAF        +D    Q++V+       
Sbjct: 92  RTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGN-----AVDIVEKQHKVIRQSSICS 146

Query: 114 --ETDGSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 171
             E D  + EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL
Sbjct: 147 DSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 206

Query: 172 KRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYM 231
           KRIY +GVI  PKPIE+K+NVLVMEFL+RG+GFASPKLKDYPY +R EI+++YH MVAY+
Sbjct: 207 KRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYI 266

Query: 232 RLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKM 291
           RLLYQVC+LVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YF K+
Sbjct: 267 RLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKI 326

Query: 292 GISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHL 351
           GI++F ER IFQFVISE LEKFKGDY +   L  Y +  LP+K TE+DE EDEIFRSLHL
Sbjct: 327 GINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHL 386

Query: 352 VRSLGGLEERDFDRYTDGKFDLLKSLIAHDNE---RNFAASEQFEF-----DNADH 399
           VR+LGGLEE DFDR+T+GKFDLLKSL++ DN+   + F ASEQFE      D+ DH
Sbjct: 387 VRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDH 442

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/394 (64%), Positives = 307/394 (77%), Gaps = 25/394 (6%)

Query: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRA-KTSKDKANRATVENVLD 59
           MSLE +FD L VS+      N ++LEKY ++I+    +  +  KT KDK++RATVENVLD
Sbjct: 1   MSLETEFDRLHVSKHQD---NTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLD 57

Query: 60  PRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSR 119
           PRTM+FL ++  RGVI++ NGC+S+GKEANVYHAF   G+                    
Sbjct: 58  PRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEGQ-------------------- 97

Query: 120 AEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGV 179
            E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+ SGV
Sbjct: 98  -ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGV 156

Query: 180 IPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCR 239
           +P   P+EVK+NVLVM+FL+RG+G  SP+LKDY YK+  E+ HYY+  +AYMRLLYQVCR
Sbjct: 157 VPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCR 216

Query: 240 LVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPER 299
           LVHADLSEYN +VH + L++IDVSQSVEP HPMSLDFLRMDIKN+N YF KMG+S+F ER
Sbjct: 217 LVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQER 276

Query: 300 VIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359
           +IFQF+I+ETLE F+GDY     LV Y+  +LP+K+  +   EDEIFRSLHLVRSLGGLE
Sbjct: 277 MIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLE 336

Query: 360 ERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFE 393
           ERDFDR+TDGKFDLLKSLIA+DNERN    +Q E
Sbjct: 337 ERDFDRFTDGKFDLLKSLIANDNERNLQRPQQQE 370

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 104/234 (44%), Gaps = 45/234 (19%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LKS++ +  +  + G +  GKE+++Y             ++ G   VL+          +
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEG----------SDKNGNKRVLKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      R S    N   + K+ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCR--LVHA 243
            +   +V+VME +    G+   +L+    K++D I   Y  +   M+ + Q+    L+H 
Sbjct: 180 FDNSRHVIVMELI---RGYPMRRLR----KHKD-IPKLYSDL---MKFILQLANSGLIHC 228

Query: 244 DLSEYNTIVHDD-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           D +E+N ++ D+          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 229 DFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 101/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  I  + G +  GKE+++Y   A  G   V+                     +
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGNPRVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      RN++   N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FEVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +L+   +KN   I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIIVMELIK---GYPMRRLR--KHKN---IPKLYSDLMNFIVKLGN-SGLIHCDF 230

Query: 246 SEYNTIVHDD-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++ D           +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 102/234 (43%), Gaps = 43/234 (18%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           L++++ + V+  +   +  GKE+++Y      G A V+                     +
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQVSDRNGTAKVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      RNSR   N   + K+ A KEF  +  +Y  G I  P+ 
Sbjct: 127 LGRTSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQA 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
                +V+VM+ +   +G+   +L++  +KN  +++    T +  +        L+H D 
Sbjct: 180 YGCSRHVVVMDLI---DGYPMRRLRE--HKNIPKLYSDLMTFIVKL----ANSGLIHCDF 230

Query: 246 SEYNTIVHDDK---------LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++ +D+           +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 99/232 (42%), Gaps = 41/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  +   +  GKE+++Y      G   VI                     +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKDGNPRVIKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      R S    N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVRNNRDYL------RKSSQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +   NGF   +L+   +KN   I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELI---NGFPMRRLR--KHKN---IPKLYSDLMCFIVQLGN-SGLIHCDF 230

Query: 246 SEYNTIVHDD-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++ D+          +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNVMIKDELEDENDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/232 (18%), Positives = 106/232 (45%), Gaps = 40/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  + G +  GKE+++Y           + ++ G  +V++          +
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQ----------VSDKNGVSKVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      +N ++  N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPEP 180

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   ++++M  +    G+   +L+ +     + I   Y+ ++ ++  L     L+H D 
Sbjct: 181 FDNSRHIIIMGLIE---GYPMRRLRKH-----NNIPKLYNDLMKFIVRLAN-SGLIHCDF 231

Query: 246 SEYNTIVHDD-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++ D+          +ID  Q +  +HP +  + + D+  +  +F+K
Sbjct: 232 NEFNIMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 101/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  +   +  GKE+++Y      GK  V+                     +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGKPRVMK------------------IHR 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      RNS    N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHSVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +L+   +KN   I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRLR--KHKN---IPKLYSDLMCFIVELAN-SGLIHCDF 230

Query: 246 SEYNTI----VHDDK---LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +    V D+K     +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 106/232 (45%), Gaps = 40/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  + G +  GKE+++Y           + +  G  +V++          +
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYR----------VSDRNGTEKVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K++  Y+      +N+++  N   + KI A KE++ +  ++  G    P+ 
Sbjct: 127 LGRTSFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FDVPEA 180

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   + +VME +    G+   +L+   +KN   I   Y  +++++  L     L+H D 
Sbjct: 181 FDCSRHCIVMELIK---GYPMRRLR--KHKN---IPKLYSDLMSFIVKLGN-SGLIHCDF 231

Query: 246 SEYNTIV-------HDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++       +D    +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 232 NEFNIMIKDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 102/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  +   +  GKE+++Y           + ++ G   V++          +
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIYK----------VSDKNGNPRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      +NS    N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHSVRNNRDYL------KNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +L+   +KN   I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRLR--KHKN---IPKLYSDLMCFVVELAN-SGLIHCDF 230

Query: 246 SEYNTIVHDD-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +V D           +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMVKDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/232 (19%), Positives = 101/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LKS++ +  +  +   +  GKE+++Y A           +  G++ V++          +
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQA----------SDRNGEHRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      +      +   + ++ A KE++ +  +Y  G    PK 
Sbjct: 127 LGRTSFHTVKNNRDYL------KKYNQGASWMFLSRVAANKEYQFMSLLYSKG-FTVPKA 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    GF   +L+ +     D I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIK---GFPLRRLRKH-----DNIPKLYSDLMCFIVNLAN-SGLIHCDF 230

Query: 246 SEYNTIVHDDK-------LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++ D+K         +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKK 282

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 98/236 (41%), Gaps = 50/236 (21%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LKS++ +  I  +   +  GKE+++Y                       +D +     +K
Sbjct: 85  LKSLLEKNAIYSVGNTIGVGKESDIYQV---------------------SDAASQSLVMK 123

Query: 126 IY---KTSILVFKDRERYVDGEFRFRNSRSQH-NPRKMIKIWAEKEFRNLKRIYQSGVIP 181
           I+   +TS    K +  Y+         R Q  N  ++  + AE+E+  +  +Y  G   
Sbjct: 124 IHRLGRTSFHTVKTKREYL--------KRGQSANWMRLSHLSAEREYAYMCLLYSKG-FS 174

Query: 182 APKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLV 241
            PKP     + +VME++    G+   +L+ +       +   Y  ++A++  L     ++
Sbjct: 175 VPKPYANSRHAIVMEYI---RGYPMRRLRSHS-----NVPKLYSDLMAFVVKLANHG-MI 225

Query: 242 HADLSEYNTIVHDD-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           H D +E+N ++ DD          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 226 HCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCISIQHQEAEYYFKRDVDCIRRFFKK 281

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 100/236 (42%), Gaps = 48/236 (20%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           +K+M+ R  +  +   +  GKE+++Y           + +  G  +V++          +
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYK----------VSDRNGNAQVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      ++SR   +   +  + A KE+  L  ++  G    P+ 
Sbjct: 127 LGRTSFTSVRNNRDYL------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEA 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKN---RDEIFHYYHTMVAYMRLLYQVCRLVH 242
            +   ++++MEF           +K +P KN      I   Y  ++ +   L +   L+H
Sbjct: 180 FDNSRHMVLMEF-----------IKGFPMKNLRTHSNIPKLYSDLMKFAVDLAK-SGLIH 227

Query: 243 ADLSEYNTIVHDD--------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            D +E+N ++ D            +ID  Q +  +HP +  F R DI+ +  +F+K
Sbjct: 228 CDYNEFNIMIKDQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 95/232 (40%), Gaps = 41/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           +KSM+ R  +      +  GKE+++Y      G A V+                     +
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIYQVSDKNGVAKVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      + +    N   +  + A+KE++ +  +Y  G I  P+P
Sbjct: 127 LGRTSFHTVKNNRDYL------KKNAHGTNWMHLSLLAAQKEYQFMSLLYSKGFI-VPQP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   ++++ME +   +GF    L     +N   I   Y  ++ +   L     L+H D 
Sbjct: 180 YDNSRHIVLMELI---DGFPMRNL-----RNHSNIPKLYSDLMTFAVKLAN-SGLIHCDF 230

Query: 246 SEYNTIV-------HDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++        D    +ID  Q +  +H  +  + + DI+ +  +F K
Sbjct: 231 NEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECIRRFFRK 282

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/232 (19%), Positives = 98/232 (42%), Gaps = 42/232 (18%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  +   +  GKE+++Y           + +  G   V++          +
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIYQ----------VSDRNGNSRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+ G       R   +   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLYSKG-FKVPEP 178

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   ++++ME +    G+   +L+    K+ D    Y   M   + L      L+H D 
Sbjct: 179 FDNSRHIILMELIK---GYPMRRLR----KHHDLPKLYSDLMCFIVNLANH--GLIHCDF 229

Query: 246 SEYNTIVHDD-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++ D+          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 230 NEFNIMIKDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 102/233 (43%), Gaps = 44/233 (18%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           L++M++R  I  +   +  GKE++VY   A  G A V+                     +
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRVSAKDGSARVLKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYQSGVIPAPK 184
           + +TS    K+   Y+         R+Q      + ++ A KE++ +  ++  G    P+
Sbjct: 127 LGRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLHSKG-FTVPE 177

Query: 185 PIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHAD 244
           P +   ++++ME +   +G+    ++   +KN  ++  Y   M+  ++L      L+H D
Sbjct: 178 PFDNSRHMILMELI---DGYPMRNMR--LHKNLPKL--YSDLMLFIVKLANH--GLIHCD 228

Query: 245 LSEYNTIV-------HDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            +E+N ++        D+   +ID  Q +  +H  +  F + D+  +  +F+K
Sbjct: 229 FNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK 281

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/234 (18%), Positives = 97/234 (41%), Gaps = 46/234 (19%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LKS++ +  +  +   +  GKE+++Y     T +A V+                     +
Sbjct: 85  LKSLLNKNALYSVGNTIGVGKESDIYQVSTSTSEALVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+    R +++   H    +  + A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHTVKNNRDYLK---RGQSASWMH----LSSLAANKEYQFMNLLYSKG-FKVPRP 178

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCR--LVHA 243
            +   ++++ME+           +K YP +   E           M+ + Q+    L+H 
Sbjct: 179 YDNSRHIILMEY-----------IKGYPMRRLREHKDLPRLYSELMKFIVQLGNHGLIHC 227

Query: 244 DLSEYNTIVHDDK-------LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           D +E+N ++ D           +ID  Q +  +H  +  + + D++ +  +F+K
Sbjct: 228 DFNEFNIMIKDKTDGPDDLGFIVIDFPQCISIQHKDAEYYFQRDVECIRRFFKK 281

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/233 (18%), Positives = 102/233 (43%), Gaps = 44/233 (18%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  +   +  GKE++VY   A  G   V+                     +
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSAKDGTPRVLKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYQSGVIPAPK 184
           + +TS    K+   Y+         R+Q      + ++ A KE++ +  +Y  G +  P+
Sbjct: 127 LGRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLYSKGFV-VPE 177

Query: 185 PIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHAD 244
           P +   ++++M+ +   +G+   +++   +KN  ++   Y  +++++  L     L+H D
Sbjct: 178 PFDNSRHMILMQLI---DGYPMRRMR--SHKNLPKL---YSDLMSFIVKLANHG-LIHCD 228

Query: 245 LSEYNTIVH-------DDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            +E+N ++        D    +ID  Q +  +H  + ++ + D+  +  +F K
Sbjct: 229 FNEFNIMIKNKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK 281

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/232 (19%), Positives = 101/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  +   +  GKE+++Y           + ++ G   V++          +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYK----------VSDKNGNPRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    ++   Y+      + S    N   + ++ A KE++ +  +Y  G    P+P
Sbjct: 127 LGRTSFHSVRNNRDYL------KKSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +L+   +KN   I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRLR--KHKN---IPKLYSDLMCFIVDLAN-SGLIHCDF 230

Query: 246 SEYNTIVHDD-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++ D           +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/237 (18%), Positives = 102/237 (43%), Gaps = 48/237 (20%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LK+M+ R  +  +   +  GKE+++Y                       +D +  E  +K
Sbjct: 85  LKTMLNRDSLYSVGNTIGVGKESDIYKV---------------------SDKNGVEKVMK 123

Query: 126 IY---KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPA 182
           I+   +TS    ++   Y+      +NS++  N   + K+ A KE++ +  ++  G    
Sbjct: 124 IHRLGRTSFHTVRNNRDYLR-----KNSKNGANWMFLSKLAAAKEYQFMSLLHSRG-FRV 177

Query: 183 PKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVH 242
           P+P +   ++++ME +    GF   +L+ +       +   Y  ++ ++ L      L+H
Sbjct: 178 PEPFDHSRHIIIMELIK---GFPMTRLRKHQ-----NVPKLYSDLMKFI-LELGNSGLIH 228

Query: 243 ADLSEYNTIV---------HDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            D +E+N ++         +D    +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 229 CDFNEFNIMIKDKLDGSDPNDTGFIVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 104/232 (44%), Gaps = 42/232 (18%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           LKSM+ R  +  +   +  GKE+++Y           + + +G+ +VL+          +
Sbjct: 85  LKSMLNRDTLYSVGTTIGVGKESDIYQ----------VSDRSGESKVLKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      RN +S  +   + K+ A KE++ +  +Y       P+P
Sbjct: 127 LGRTSFHTIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRN-FEVPQP 178

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   + ++ME +    G+   +L    +KN  ++  Y   M   ++L      L+H D 
Sbjct: 179 FDNSRHCVLMEHI---RGYPMRRLG--KHKNLPKL--YSDLMCFIVKLANH--GLIHCDF 229

Query: 246 SEYNTIV------HDDKLY-MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++       DD  Y +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 230 NEFNIMIKDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44
           YNL207W
          Length = 444

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/187 (19%), Positives = 85/187 (45%), Gaps = 31/187 (16%)

Query: 66  LKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIK 125
           + S++    I  +   +  GKE+++Y           + +++G   V++          +
Sbjct: 85  MNSLLLHDTIYSIGHMIGIGKESDIYK----------VSDKSGNTRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKP 185
           + +TS    K+   Y+      +NS+   N   +  + A KE++ +  +Y S     PKP
Sbjct: 127 LGRTSFQTVKNNRDYLK-----KNSKIGTNWMVLSGLAALKEYQFMSILY-SNDFKVPKP 180

Query: 186 IEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   ++++ME +    G+   +L+    KN+ ++   Y+ ++ ++  L     L+H D 
Sbjct: 181 FDNSRHIIIMELIE---GYPMRRLRS---KNQLKLAKLYNELMCFIVKLAD-HGLIHCDF 233

Query: 246 SEYNTIV 252
           +E+N ++
Sbjct: 234 NEFNIMI 240

>SAKL0F06424g Chr6 (490525..497946) [7422 bp, 2473 aa] {ON} similar
           to uniprot|Q06116 Saccharomyces cerevisiae YPR117W
           Hypothetical ORF
          Length = 2473

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 59/119 (49%), Gaps = 20/119 (16%)

Query: 216 NRDEIFHYYHTMVAYMRLLYQVCRLV------HADLSEYNTIVHDDKLYMIDVSQSVEPE 269
           NR E+F   H ++A  ++ Y   + V      HA+ S+++   +D KL + + S S+   
Sbjct: 529 NRLEVFECIHELLAKSKICY--TKFVKPGSREHANSSKFSN--YDVKLRLKNASTSIMAS 584

Query: 270 H--PMSLDFLRMD-------IKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNN 319
           H  P  LD L  +       ++ +N+ F++  + + P     + VIS TL +  GD+NN
Sbjct: 585 HYLPEHLDTLEENGFNLTSCLRGLNMLFQESFVFLNPSGKTLK-VISGTLNRVTGDFNN 642

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 96/234 (41%), Gaps = 53/234 (22%)

Query: 40  SRAKTSKD--KANRATVENVLDPRTMRFLKSMVTRGV----IADLNGCLSTGKEANVYHA 93
           +R  TS D  +AN++    +   + ++    M T+GV    I  LN     G + N    
Sbjct: 198 ARVVTSDDYFQANKSVEVKI---KVLKLNALMETQGVGVSCIRSLNDLCGKGAQVNKVK- 253

Query: 94  FAGTGKAPVIDE----ETGQYEVLETDGSRAEYAIK----------------------IY 127
           F   G  P++ E    ET  Y  +   GS +    K                      ++
Sbjct: 254 FNFGGNLPIMQEQRIGETECYTAMLAVGSNSGDRFKNIVECINLLKDDIKVDVIQVSSLF 313

Query: 128 KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIE 187
           +T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+    +   P+ I+
Sbjct: 314 ETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRVKL--IENGPRCID 368

Query: 188 VKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLV 241
           +    +VM   S G          +   N DE+   +  M+    +L  +C LV
Sbjct: 369 LD---IVMMKKSDGQ---------HVLWNSDELVIPHSRMLERTFVLEPLCELV 410

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 131 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ S VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>KAFR0D01950 Chr4 (393813..394601) [789 bp, 262 aa] {ON} Anc_5.43
           YGR262C
          Length = 262

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 77/188 (40%), Gaps = 32/188 (17%)

Query: 145 FRFRNSRSQHNP---RKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVK--NNVLVMEFLS 199
            ++R S+   +P   + + K     E R L +++Q   I  PK I     N  + +EFL 
Sbjct: 50  IKYRPSKKYRHPTINKALTKHRTLSESRILAKLFQIKGIKVPKLIACDPYNGYIWLEFLG 109

Query: 200 RG--NGFASPKLKDYPYKNRDEIFH--YYHTMVAYMRLLYQVCRL-----VHADLSEYNT 250
               NGF    LK+Y + N  + +H    +T+V   ++  Q+  L      H DL+  N 
Sbjct: 110 EDLPNGFGFSNLKNYLWMNATDSYHDNVKNTLV---KVGEQIGLLHWNDYCHGDLTSSNI 166

Query: 251 IVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETL 310
           ++          ++S     P  +DF    I N+    E  G+ ++    + +  I  T 
Sbjct: 167 VLVK--------TESGGTWEPHLIDFGLSSISNL---VEDKGVDLY----VLERAIISTH 211

Query: 311 EKFKGDYN 318
             F   YN
Sbjct: 212 SSFSDKYN 219

>TDEL0B03930 Chr2 (705201..708437) [3237 bp, 1078 aa] {ON} Anc_6.161
           YBR245C
          Length = 1078

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 212 YPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHP 271
           +P   R   F+ +    A +++LY+  R+  A  +EY   + D K    D+S+  E E  
Sbjct: 739 HPRMPRPHAFYSHQLQPAQLKVLYEKERMWAAKKAEYEPNMEDVKATYGDISE--EDERN 796

Query: 272 MSLDFLRMDIKNVN 285
             L+ L++ I N  
Sbjct: 797 KKLELLKISIANAQ 810

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,481,362
Number of extensions: 2025799
Number of successful extensions: 6435
Number of sequences better than 10.0: 65
Number of HSP's gapped: 6507
Number of HSP's successfully gapped: 65
Length of query: 484
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 371
Effective length of database: 40,524,141
Effective search space: 15034456311
Effective search space used: 15034456311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)