Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR118W (RTC5)5.431ON56756727920.0
Smik_15.2965.431ON56656724440.0
Suva_8.1715.431ON56756723250.0
Skud_15.2815.431ON56755523230.0
SAKL0G02464g5.431ON56355114460.0
NCAS0H020505.431ON57355314030.0
TDEL0E019405.431ON56757113660.0
NDAI0C016105.431ON58456813441e-180
Kwal_55.214375.431ON55455013331e-179
KLTH0F16126g5.431ON55455013021e-174
ZYRO0F09966g5.431ON55455012521e-166
Kpol_1016.75.431ON56254412131e-160
KLLA0E21143g5.431ON57255212091e-160
TPHA0H017905.431ON56555011881e-157
CAGL0L11616g5.431ON55555111761e-155
Ecym_47645.431ON56655611761e-155
KNAG0B042305.431ON57755911561e-152
AER258C5.431ON5575528991e-113
TBLA0A065305.431ON4925326581e-78
NDAI0D044604.229ON53052706.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR118W
         (567 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...  1080   0.0  
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   946   0.0  
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   900   0.0  
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   899   0.0  
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   561   0.0  
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   545   0.0  
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   530   0.0  
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   522   e-180
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   518   e-179
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   506   e-174
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   486   e-166
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   471   e-160
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   470   e-160
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   462   e-157
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   457   e-155
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   457   e-155
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   449   e-152
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   350   e-113
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   258   1e-78
NDAI0D04460 Chr4 complement(1048402..1049994) [1593 bp, 530 aa] ...    32   6.2  

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/567 (94%), Positives = 535/567 (94%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60
           MGQ               KKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI
Sbjct: 1   MGQSSSISSSNEEGSSHSKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60

Query: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120
           SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA
Sbjct: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120

Query: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIP 180
           KFLKTKSYDQLKLLFISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIP
Sbjct: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIP 180

Query: 181 ADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHS 240
           ADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHS
Sbjct: 181 ADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHS 240

Query: 241 ITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLS 300
           ITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLS
Sbjct: 241 ITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLS 300

Query: 301 TGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNP 360
           TGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNP
Sbjct: 301 TGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNP 360

Query: 361 RYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPR 420
           RYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPR
Sbjct: 361 RYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPR 420

Query: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGY 480
           QDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGY
Sbjct: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGY 480

Query: 481 GGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQI 540
           GGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGG                 SKRRQQI
Sbjct: 481 GGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQI 540

Query: 541 NLRSLGEDRALLEMAGLVGQHQGGGSM 567
           NLRSLGEDRALLEMAGLVGQHQGGGSM
Sbjct: 541 NLRSLGEDRALLEMAGLVGQHQGGGSM 567

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/567 (82%), Positives = 503/567 (88%), Gaps = 1/567 (0%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60
           MGQ               +KF N +D+L YFN KAQ+Q+T+PELVS KGNLQIE+LNTPI
Sbjct: 1   MGQSSSISSNNEEGSSHSRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60

Query: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120
           SHK LCN LYFPQNH +IVGIVTNMLRVLSNFPL+ SSYEPITGYGLLKCI+LLN++RC 
Sbjct: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120

Query: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIP 180
           KFLK KSYDQLKLLFISLSLQKTDKEELSE++EN+G KE  IKQIITGFDDVDTE+L +P
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180

Query: 181 ADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHS 240
           ADFMLQFLTWLLIL+V+CPTTNS ++N ET+ QW  FK+ A+NLLRTMNPDVV +IESH 
Sbjct: 181 ADFMLQFLTWLLILSVECPTTNSTINN-ETNVQWDKFKIPAMNLLRTMNPDVVNNIESHF 239

Query: 241 ITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLS 300
           IT+QQFSTAIRTVMPNLLKPLENLMEHF YLQHDLVD+DTNLSSIQDSK+MTPALLAQLS
Sbjct: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLS 299

Query: 301 TGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNP 360
           TGLPKELFI KLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSG+RITNSEEYAA KNP
Sbjct: 300 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNP 359

Query: 361 RYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPR 420
           RYRHFLEEFP LK+SDQ MDAS +NK+KTTFAVYIDDPWKVTNKDYFGDLNTRII+ISPR
Sbjct: 360 RYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 419

Query: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGY 480
           QDIYKVN+KGT+YFNTIGGGIGIG+KQPLIK ASKRY+PGNVSLTFDSTLEFAVFRNTGY
Sbjct: 420 QDIYKVNKKGTVYFNTIGGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGY 479

Query: 481 GGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQI 540
           GGSLDPGLLSMERKEENS +ELH LIQDVEVWGCGG                 SKRRQQI
Sbjct: 480 GGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQI 539

Query: 541 NLRSLGEDRALLEMAGLVGQHQGGGSM 567
           NLRSLGEDRALLEMAGLVGQHQGGGSM
Sbjct: 540 NLRSLGEDRALLEMAGLVGQHQGGGSM 566

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/567 (78%), Positives = 503/567 (88%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60
           MGQ               +KFTN+ D+LAYFN+KAQQQVT+PELVS KGNLQIED+NTPI
Sbjct: 1   MGQSSSTPSSNEEKSSNLRKFTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIEDMNTPI 60

Query: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120
           SHK+LC+ L+FPQ H ++ GIVTNMLRVLSNFPLM SSYEPITGYGLLKCILLLN+ RC 
Sbjct: 61  SHKSLCSVLHFPQKHTLLSGIVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRCG 120

Query: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIP 180
           K+LK KSYDQLKLLFISLSLQKTDKEELSEE+EN+  KE  IKQII  FDDVD+E+L +P
Sbjct: 121 KYLKFKSYDQLKLLFISLSLQKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYVP 180

Query: 181 ADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHS 240
           ADFMLQFL+WLLIL+V+CPT+NSK+ N++ +DQW +FK+SA+NLLRTMNPDVV + ESH 
Sbjct: 181 ADFMLQFLSWLLILSVECPTSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTESHL 240

Query: 241 ITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLS 300
           ITF QFST+IRTVMPNLLKPLENLMEHFFYL++DLV++DT+LSS++DS++MTPALL QLS
Sbjct: 241 ITFDQFSTSIRTVMPNLLKPLENLMEHFFYLENDLVNYDTSLSSVRDSRIMTPALLTQLS 300

Query: 301 TGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNP 360
           T LP+ELFI KLQSLYIGRKSGFSMRSLQAKVFKWMAPSIL+VSG RITNS+EYAA+KNP
Sbjct: 301 TVLPRELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYAAQKNP 360

Query: 361 RYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPR 420
           RYRHFLEEFPKLK+SDQ MDAS+ NK+KTTFAVYIDDPWKVTNKDYFGD+NTRII+ISPR
Sbjct: 361 RYRHFLEEFPKLKDSDQKMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPR 420

Query: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGY 480
           QDIYKVN+KGTIYFNTIGGGIGIGDKQPLIKPASKR+IPGNVSLTFDSTLEFAVFR+TGY
Sbjct: 421 QDIYKVNRKGTIYFNTIGGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVFRHTGY 480

Query: 481 GGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQI 540
           GGSL+PG LS+ERKEE+S +ELHFLIQDVEVWGCGG                 SKRRQQI
Sbjct: 481 GGSLEPGSLSVERKEEDSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRRQQI 540

Query: 541 NLRSLGEDRALLEMAGLVGQHQGGGSM 567
           NLRSLGEDRALLEMAGLVGQ++GGGSM
Sbjct: 541 NLRSLGEDRALLEMAGLVGQNRGGGSM 567

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/555 (81%), Positives = 489/555 (88%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60
           MGQ               KKFTN++D+L+YFNNKAQQQVTIPELVSFKGNLQIE+LNTPI
Sbjct: 1   MGQSSSVSSRNEEGSSSSKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60

Query: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120
           SHK L N L+FP NH ++VGIVTNMLRVLSNFPL+ SSYEPITG+GLLKCILLLNR RC 
Sbjct: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120

Query: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIP 180
           KFLK KSYDQLKLLFISLSLQKTDKEELSEE+E + N+E  +KQIIT FDDVDTEMLC+P
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCLP 180

Query: 181 ADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHS 240
           ADFMLQFL+WLLIL+V  PTTNSK DN +T++QW  FK+SA+NLLRTMNPDVV ++ESH 
Sbjct: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240

Query: 241 ITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLS 300
           ITF+QFSTAIRTVMPNL KPLENLMEHFFYL +DLV  D NLSSIQDS++MTPALLAQLS
Sbjct: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLS 300

Query: 301 TGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNP 360
           TGLPKELFI KLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNS+EYAAEKNP
Sbjct: 301 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNP 360

Query: 361 RYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPR 420
           RYRHFL+EFPKLK+SDQ MDASHL+K+KTTFAVYIDDPWKVTNKDYFGDLNTRII+ISPR
Sbjct: 361 RYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 420

Query: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGY 480
           QDIYKVNQKGTIYFNTIGGGIGIGDKQP IK ASKRYIPGNVSLTFDSTLEFAVFR+TGY
Sbjct: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGY 480

Query: 481 GGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQI 540
           GG LDPGLLSMERKEENS +ELHFLIQDVEVWGCGG                 SKRRQQI
Sbjct: 481 GGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQI 540

Query: 541 NLRSLGEDRALLEMA 555
           N RSLGEDRALLEMA
Sbjct: 541 NFRSLGEDRALLEMA 555

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/551 (51%), Positives = 382/551 (69%), Gaps = 7/551 (1%)

Query: 20  KFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIV 79
           +F +  D+L YF  +A +Q T PELV+FK NL+ +D N  +S + +   L  P  + ++ 
Sbjct: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76

Query: 80  GIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLS 139
            ++ N ++ LSNFPL++ SY+ IT  GLLK  +LL+  RC K++  K+YDQLKL++I+L+
Sbjct: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136

Query: 140 LQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCP 199
           L+KT KE     S  D  K    K II  ++ VD + L +PAD MLQ LT  L+L+  C 
Sbjct: 137 LRKTVKEL---PSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADSMLQLLTLSLVLSRHCT 193

Query: 200 TTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIRTVMPNL 257
             N+K+  +     W ++K +A+NLLRTMNPD+V   D     I+F+QFS AI  V P +
Sbjct: 194 VNNAKIRES-VFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQV 252

Query: 258 LKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYI 317
           LKPLE L+EH  YL  DL D   + S    SK++T  LLAQLST LPKEL   KL+ LY+
Sbjct: 253 LKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYV 312

Query: 318 GRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQ 377
           GR+SGFSMRS Q+K FKWMAPSIL++ GMRIT+ +EYA  KNPRY+ FLEE+P+LK+ DQ
Sbjct: 313 GRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQ 372

Query: 378 -MMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNT 436
            ++D   LN+RK  FAVY+++PWKVTNK+ FGDL T ++++SP+Q+++K  + G +YFNT
Sbjct: 373 HIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNT 432

Query: 437 IGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEE 496
           +GGGIG+G  QP+IKP  K+Y PGNVSLT DS+LEFA FR+ GYGG++ PG L  + +EE
Sbjct: 433 LGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGTLMTKLEEE 492

Query: 497 NSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMAG 556
            + +E  F++QDVEVWGCGG                 +KRRQ+INL+S+GEDRALLEMAG
Sbjct: 493 KTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAG 552

Query: 557 LVGQHQGGGSM 567
           LVGQHQ GGSM
Sbjct: 553 LVGQHQSGGSM 563

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/553 (47%), Positives = 374/553 (67%), Gaps = 12/553 (2%)

Query: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTP-----ISHKALCNSLYFPQNH 75
           F + +++   F  +     T  ELV+FK  +  E  ++      IS   L N L+ P+ +
Sbjct: 27  FNSEEELRESFKRRILCHFTPLELVAFKKKIGHEQTDSEAGVEYISKNELTNLLHLPREN 86

Query: 76  AMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLF 135
            ++V +   ++ +LSNFPL++     +T  GLL CI+LL++ RC +F+ + +YDQL L+F
Sbjct: 87  VLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLMCIILLSKERCHRFIGSNTYDQLGLIF 146

Query: 136 ISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILT 195
           I++SL   DK      +     K+L +++++  FD++  + L IPA  +LQFL+W L+L 
Sbjct: 147 IAMSLDYADKLLPYARTP----KKLNVEELLRTFDNIPIDELEIPAPVLLQFLSWGLLLL 202

Query: 196 VDCPTTNSKLDN-TETHDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTVM 254
           + CPT+N +L    E +  W +++ +A N++R+M+  ++ ++    I + QFS   + V+
Sbjct: 203 IKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRSMDQSIIRNLTDVRINYTQFSDVFKAVL 262

Query: 255 PNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQS 314
           PN   PLE+LM H  Y+  DL+DH+T    + +SK+M+  LLAQL+T LPKELF+ KLQ 
Sbjct: 263 PNFTTPLESLMGHLLYMDSDLIDHET--MPMNNSKLMSEPLLAQLATVLPKELFLSKLQK 320

Query: 315 LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKE 374
           LY+GR+SGFSMRSLQ+K F W APSIL+VSGM I++  +YA EKNPRY  FLE++PKLKE
Sbjct: 321 LYVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQYAKEKNPRYGKFLEQYPKLKE 380

Query: 375 SDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYF 434
             Q +DA H  ++K TFAVYIDDPW+VTNK++FG +N+ II+++PRQD++  ++   IYF
Sbjct: 381 EQQHLDACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVFHASKPNMIYF 440

Query: 435 NTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERK 494
           NT+GGGIG G+KQPLI  A K+YIPGNVSLT DSTLEFAVFR+ GYGG+  P  L  +R 
Sbjct: 441 NTVGGGIGFGNKQPLISNAHKKYIPGNVSLTIDSTLEFAVFRHIGYGGAFKPSALLTKRG 500

Query: 495 EENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEM 554
           +E+  +E+ F+IQDVEVWGCGG                 +KRRQ INL+SLGEDRALLEM
Sbjct: 501 KEDESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRRQHINLKSLGEDRALLEM 560

Query: 555 AGLVGQHQGGGSM 567
           AGLVGQ Q GGSM
Sbjct: 561 AGLVGQSQSGGSM 573

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/571 (47%), Positives = 374/571 (65%), Gaps = 8/571 (1%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60
           MGQ               ++FT++ +++ +F+ +A    T  EL +FK  L+ + L  P+
Sbjct: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60

Query: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120
             + L   L  P  + ++   V   +RVLSNFPLMK S++ +TG GLLK +LL N ++C 
Sbjct: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120

Query: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESEN---DGNKELTIKQIITGFDDVDTEML 177
           K++  K+YD +KLLFI+LS++K+ KEE S  S     DG   +    ++  ++++  + L
Sbjct: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSI---NLLRTYNNIVVDDL 177

Query: 178 CIPADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIE 237
            IPA  ++Q L WLLILT  CPT+N +      + +WG+FK++A NLLRTMN ++V ++E
Sbjct: 178 AIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLE 237

Query: 238 SHSITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSS-IQDSKVMTPALL 296
           S+S+ F+QFS AI TVMPN+ + L+N+MEH  Y   DLV   +N +  I  SK  T A+L
Sbjct: 238 SYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVL 297

Query: 297 AQLSTGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAA 356
           AQL T L  E+   K Q+LY+GR+SGFSMRSLQAKVFKWMAP+++++SG  + + E+++ 
Sbjct: 298 AQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFS- 356

Query: 357 EKNPRYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIE 416
           +KN RYR FL ++PKLK+ DQ +     NK K  FAVYI +PWK TNKDYFG   T I++
Sbjct: 357 KKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQ 416

Query: 417 ISPRQDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFR 476
           +SP QD++K      +YFNT+GGGIGIG+ QP IK   K Y PGNVSLT DSTLEFA FR
Sbjct: 417 LSPTQDVFKAASNEVMYFNTLGGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEFAAFR 476

Query: 477 NTGYGGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKR 536
           + GYGG+ +PGLL  +   E+ P+E+ FLIQDVEVWGCGG                 +KR
Sbjct: 477 HVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKR 536

Query: 537 RQQINLRSLGEDRALLEMAGLVGQHQGGGSM 567
           RQ INLRS GEDRALLEMAGLVG  Q GGSM
Sbjct: 537 RQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  522 bits (1344), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 261/568 (45%), Positives = 368/568 (64%), Gaps = 25/568 (4%)

Query: 20  KFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIV 79
           +F N+ ++  YF  +     T  EL+S+K  L  + L+  I+ + +   L+ P ++ ++ 
Sbjct: 22  QFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHDHLDDMITKEEIIQLLHLPDDNVILS 81

Query: 80  GIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLS 139
            ++ NM+  L NFP +      IT   LL CI+LL+  RC +F+ +KSYDQ+KLLFI L 
Sbjct: 82  NMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDNDRCQRFIGSKSYDQIKLLFILLC 141

Query: 140 LQKTDKE---------ELSEESENDGNKEL-------TIKQIITGFDDVDTEMLCIPADF 183
           L   +           +L E+SEN     +        +  I+  ++ +  + L +PA  
Sbjct: 142 LSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYNLTDILQSYNGISIDDLSVPALS 201

Query: 184 MLQFLTWLLILTVDCPTTNSK-LDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHSIT 242
           + +  TW LI+++ CPT N K L N   ++ W  ++ ++LN+LR+M+  +V +++ + I+
Sbjct: 202 LSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKASLNILRSMDSSIVSNLDDYRIS 261

Query: 243 FQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTG 302
           F QF     +V+PN   PLEN+M H  Y+  DL++H   +  I  SK+M+ +LLAQLST 
Sbjct: 262 FTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLINHP--VMEIPKSKLMSESLLAQLSTT 319

Query: 303 LPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRY 362
           LPKELFI KLQ LYIGR+SGFSMRSLQ+K FKW+AP+IL+VSG+ I N EEY    NPR+
Sbjct: 320 LPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEEY---NNPRF 376

Query: 363 RHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQD 422
           + FL+EFPKL +++Q ++  H  K+K +FAVYID+PW+VTNK++FGDLN+RIIE+SPRQD
Sbjct: 377 KRFLQEFPKLNDNEQSLEPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPRQD 436

Query: 423 IYK-VNQKGTIYFNTIGGGIGIGDKQPLIKPA--SKRYIPGNVSLTFDSTLEFAVFRNTG 479
           I+K +     IYFNTIG GIGIGDKQP +     S++Y PGNVSLT +STLEFAVFR+ G
Sbjct: 437 IFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRHVG 496

Query: 480 YGGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQ 539
           +GG+  P  L  +R  E   +E+ F+IQDVEVWGCGG                 +KRRQQ
Sbjct: 497 HGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRRQQ 556

Query: 540 INLRSLGEDRALLEMAGLVGQHQGGGSM 567
           +NL+S+ EDRALLEM GLVGQHQ GGSM
Sbjct: 557 VNLKSISEDRALLEMVGLVGQHQSGGSM 584

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  518 bits (1333), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 262/550 (47%), Positives = 363/550 (66%), Gaps = 14/550 (2%)

Query: 20  KFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIV 79
           +F + KD++ +F+ KA + +T PELVSFK N+  +DL+  ++   L   L     +  + 
Sbjct: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76

Query: 80  GIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLS 139
            ++ N ++ LSNFP ++  YE IT  GLLK  +LLN+ARC  ++K K YD  KL++ISL+
Sbjct: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136

Query: 140 LQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCP 199
           L KT KE  S  +     + L   +II  F+ V  E L +P++ ML+F+T +L ++    
Sbjct: 137 LNKTVKEVSSSSNSQ---ESLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193

Query: 200 TTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVV--GDIESHSITFQQFSTAIRTVMPNL 257
             NSKLD     + W +F+  AL++LRTMN ++    D+  + ITF QF + I TV PNL
Sbjct: 194 IKNSKLD-PNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNL 252

Query: 258 LKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYI 317
           L P E+LMEH  +L  DLVD D +   + +SK+++  LLAQL+T  P+EL   +LQ LY+
Sbjct: 253 LLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYV 312

Query: 318 GRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQ 377
           GR SGFSMRS QAK FKWMAPSIL++ G+RI N EEYA  KN RY++FLEE+P+LKE DQ
Sbjct: 313 GRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQ 372

Query: 378 MMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTI 437
           ++      K+K  FAVY++ PWKVTN + FGDL T II++SP Q++YK ++ G IYFNT+
Sbjct: 373 VLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTL 432

Query: 438 GGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEEN 497
           GGGIG+G  QP++KP S++Y+PGNVSLT D  LEFAVFR+ G+GGS+ P    +      
Sbjct: 433 GGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN----- 487

Query: 498 SPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMAGL 557
              E  FLIQD+E WGCGG                 ++RRQ+INL+S+ +DRALLEMAGL
Sbjct: 488 ---EHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGL 544

Query: 558 VGQHQGGGSM 567
           VGQ+Q GGS+
Sbjct: 545 VGQNQSGGSI 554

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  506 bits (1302), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 253/550 (46%), Positives = 362/550 (65%), Gaps = 16/550 (2%)

Query: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIVG 80
           F +  D+L++++ KA + V+ PELVS+KGN+  + L+  ++ K L   L     +  + G
Sbjct: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEG 77

Query: 81  IVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSL 140
           ++ N ++ L+NFPL+K  YE +T  G+LK  +LLN+ RC ++++ K Y+  KL++ISL+L
Sbjct: 78  LLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLAL 137

Query: 141 QKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPT 200
            K  KE  S  + ND    L   ++I  F++V  E L +PA+ ML+FLT +L ++     
Sbjct: 138 NKAVKEMSSLPNSNDS---LDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVI 194

Query: 201 TNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIRTVMPNLL 258
            NS+LD     ++W +FK  AL++LRTMN D++   D   + I++ QF   I +V PNLL
Sbjct: 195 KNSRLD-VNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLL 253

Query: 259 KPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIG 318
            PLE LMEH  +L  DLVD + +   I  SK++T  LLAQL+T  P+EL   +LQ LY+G
Sbjct: 254 VPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVG 313

Query: 319 RKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQM 378
           R SGFSMRS QAK FKWMAPSIL+V G RI + ++YA  KN RY+ FL+E+P+LK+ DQ 
Sbjct: 314 RDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQH 373

Query: 379 MDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTIG 438
           +  +   KRK  FA+ I++PWKVTN + FGD+ T I+++SP Q++YK ++ G +YFNT+G
Sbjct: 374 ILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLG 433

Query: 439 GGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENS 498
           GGIGIG  QP+IK +  +++PGNVSLT D  LEFA FRN G+GGS+ P          N+
Sbjct: 434 GGIGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS---------NT 484

Query: 499 PYELH-FLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMAGL 557
           P   H FLIQD+E WGCGG                 ++RRQ+INL+S+ +DRALLE+AGL
Sbjct: 485 PTSEHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGL 544

Query: 558 VGQHQGGGSM 567
           VGQ+Q GGS+
Sbjct: 545 VGQNQSGGSV 554

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  486 bits (1252), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 260/550 (47%), Positives = 364/550 (66%), Gaps = 14/550 (2%)

Query: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIVG 80
           FT++ DIL  FN++A +Q T+ ELVSFK  L  +DLN  ++++ L   L  PQ+  ++  
Sbjct: 16  FTSNSDILKSFNDRALKQFTVTELVSFKNKLG-KDLNERLTNEELTKWLSVPQDEILLRE 74

Query: 81  IVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSL 140
           ++ N ++VL NFPLMK+SYE +TG G+LK I+L N  RC K++K+++YDQLKL FI+LS+
Sbjct: 75  LLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALSI 134

Query: 141 QKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPT 200
           +KT KE+ +  S +   +   + +I+  FD +    L +P  +M+ F++WLLILT  CP 
Sbjct: 135 RKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCPI 194

Query: 201 TNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTVMPNLLKP 260
            N KL+N    D W ++  SA  +LR+M P      ES  I ++ F+  +R++ P++  P
Sbjct: 195 NNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDESSWIEYEPFAHTMRSIAPHIFDP 250

Query: 261 LENLMEHFFYLQHDLVDH-DTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIGR 319
           L  +MEH  +   +LVD    N   I  SK++  ALLAQ+S+ L K+L I+ LQ LY+GR
Sbjct: 251 LTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALSKQLPIYHLQRLYLGR 310

Query: 320 KSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQMM 379
             GFSMRS QAKVFKW AP+I+++ G RI + EEY+  KN R+R FL E+PKLK SD   
Sbjct: 311 DHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSDMDT 369

Query: 380 DASHL--NKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTI 437
           +   +   K K   AVY+ DPWK+TNK++FG  +T I+++SP Q+++  +++  +YFNTI
Sbjct: 370 EVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTI 429

Query: 438 GGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEEN 497
           GGGIGIG+KQP+IK  +K Y PGNVSLT DS LEFAV R+ G GG L PGL+  ++    
Sbjct: 430 GGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKD--- 486

Query: 498 SPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMAGL 557
             +E+  L+QDVEVWGCGG                 +KRRQQINLRS+GEDRALLEMAGL
Sbjct: 487 --FEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRRQQINLRSIGEDRALLEMAGL 544

Query: 558 VGQHQGGGSM 567
           VGQ Q GGS+
Sbjct: 545 VGQAQSGGSV 554

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  471 bits (1213), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 246/544 (45%), Positives = 357/544 (65%), Gaps = 8/544 (1%)

Query: 25  KDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIVGIVTN 84
           +DIL +FNN++   +   E+  FK  L  +DL+ P++       L    +++ +  ++ N
Sbjct: 26  EDILDFFNNRSLSILLPMEIECFKSRLGDKDLSDPLTKDEFNTLLRIADSNSQLQILLWN 85

Query: 85  MLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSLQKTD 144
               +S FP + +  E +TG+G+LK I+LL R R  K+L   +   +KL+FI L    T 
Sbjct: 86  FFLKISAFPFLSNRSESMTGFGILKGIILLTRERIKKYLGWSNAKLIKLIFIGL----TS 141

Query: 145 KEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPTTNSK 204
           +E++  ++E    K   I+ ++   D +D     +    ML F+TWLL+L+V CPT+N K
Sbjct: 142 QEKVGVKTEASVFK---IQHVLDTLDGIDLASSTVKDTDMLSFITWLLLLSVHCPTSNCK 198

Query: 205 LDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTVMPNLLKPLENL 264
           L+    +D+W ++++ A +++R+MN  +    +   I++  FS  I  V  N++ PLEN+
Sbjct: 199 LNEKSLYDKWKDYEIVASSMVRSMNKKITTTGKGIGISYSDFSHTIVAVSKNVMSPLENI 258

Query: 265 MEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIGRKSGFS 324
           +EH  Y Q DL++     + ++++K+MT  L+AQL T LP E+ + +LQ LY+GR+SG+S
Sbjct: 259 VEHMLYKQDDLLEFPCLDTFLKETKLMTYPLVAQLCTVLPNEIVMSQLQKLYVGRESGYS 318

Query: 325 MRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQMMDASHL 384
           MRSLQ+KVF W A +IL+VSG RI +  EY+  KNPRY+ FLEE+PKLK+ DQ MD  H 
Sbjct: 319 MRSLQSKVFNWKAATILLVSGTRIVDDIEYSENKNPRYKRFLEEYPKLKDEDQEMDDCHN 378

Query: 385 NKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTIGGGIGIG 444
            K+K TFAVYID+PW+VTNK+YFG+  T IIE+SPRQD +   + G++YFNTIGGGIGIG
Sbjct: 379 LKKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQDKFNSLKVGSVYFNTIGGGIGIG 438

Query: 445 DKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSPYELHF 504
           + QP+ K  S RY PGNVSLT D+TLEF VFR+TGYGG++ P  L  +  EEN  +E+ F
Sbjct: 439 NNQPVTKLNSVRYAPGNVSLTLDNTLEFGVFRHTGYGGTIGPSELLKKNNEENKAFEIRF 498

Query: 505 LIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMAGLVGQH-QG 563
           LI+DVEVWGCGG                 +KRRQ+INL+++GEDRALLEMAG++GQH Q 
Sbjct: 499 LIRDVEVWGCGGEKELEEQLREWKWEEAEAKRRQEINLKTMGEDRALLEMAGIIGQHGQS 558

Query: 564 GGSM 567
           GGS+
Sbjct: 559 GGSI 562

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  470 bits (1209), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 262/552 (47%), Positives = 357/552 (64%), Gaps = 14/552 (2%)

Query: 27  ILAYFNNKAQQQVTIPELVSFKGNL-QIEDLNTPISHKALCNSLYFPQNHAMIVGIVTNM 85
           ++ +FN++  +Q+T  EL+SFK N+ + ++LN  +    +    Y P++ A+++ +  NM
Sbjct: 24  LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNM 83

Query: 86  LRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSLQKTDK 145
              L+NFPL++ SYE +T   LLK  LLL + R  K+   K Y+ LK+LFI+LSL+K  K
Sbjct: 84  FHTLANFPLLQDSYEKVTFKTLLKATLLLVKERAIKYTDWKKYNDLKMLFITLSLEKNIK 143

Query: 146 EE-LSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPTTNSK 204
            E L + S     K+   K +I  ++  D + L + A+ +L FL  +L L+  C   N K
Sbjct: 144 AEPLMDSSALSDCKDW--KGVIRSYNGTDFDELKVNANNLLHFLALILALSRCCILNNCK 201

Query: 205 LDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIRTVMPNLLKPLE 262
           +DN        +FK  ALN++RTMNP+++   D    SIT+ QFS A+  V PNLL PL+
Sbjct: 202 IDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLK 261

Query: 263 NLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIGRKSG 322
            LMEH  Y+  DLVD D        +K++  + L+QL+T LPKE+   + Q LY+GR+SG
Sbjct: 262 MLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESG 321

Query: 323 FSMRSLQAKVFKWMAPSILVVSGMRITNSEE-----YAAEKNPRYRHFLEEFPKLKESDQ 377
           FSMRS Q+KVFKWMAP+IL V GMRI + ++     YA  KNPRYR+FL+E+ KLK  DQ
Sbjct: 322 FSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAV-KNPRYRNFLQEYGKLKSEDQ 380

Query: 378 MMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVN--QKGTIYFN 435
            +D     KRK  FAV I DPWKV+NKD FGD +T+II++ PRQ+I+  +  + G +YFN
Sbjct: 381 HLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFN 440

Query: 436 TIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKE 495
           T+GGGIGIG  QP+IK   K+Y PGNVSLT DS+LEF +FR+ G GGS  PG L   R E
Sbjct: 441 TVGGGIGIGSSQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGE 500

Query: 496 ENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMA 555
           E + +E  F+IQDVEVWGCGG                 +KRRQ+INL+S+GEDRALLEMA
Sbjct: 501 ERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMA 560

Query: 556 GLVGQHQGGGSM 567
           GLVGQHQ GGS+
Sbjct: 561 GLVGQHQSGGSI 572

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  462 bits (1188), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 234/550 (42%), Positives = 356/550 (64%), Gaps = 5/550 (0%)

Query: 19  KKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMI 78
           K  T+  +I+ YFN +   Q +  EL+ FK  L+I+D +T I    +   L        +
Sbjct: 20  KDLTSELEIVDYFNKRVISQFSNIELLCFKHLLEIDDYSTIIDDAVVYKLLQIQDVSDRL 79

Query: 79  VGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISL 138
             ++ N ++ L+NFP + +  + +T YGLLK I++L + +  K+      + LK+LFI+L
Sbjct: 80  RNLILNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQKFIKYTNNNQLNMLKILFIAL 139

Query: 139 SLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDC 198
                D+EE +++  +  N  ++I  I+T +D +    + + +  M+ FLTW+L L+  C
Sbjct: 140 G--DYDREEDNKKILDCHN--ISISTILTTYDGIPIHDISVSSSNMISFLTWILALSNVC 195

Query: 199 PTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTVMPNLL 258
           PT NS +D       W  ++ SA++L+R+MNPD++   ++ +I F QF TA+ T+MP++ 
Sbjct: 196 PTNNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIKPDDNQNILFIQFKTALETIMPHVY 255

Query: 259 KPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIG 318
            PLE+L+ H  +++  L+       S Q+SK+MT A+ +QLST L  ++ I KL  LY G
Sbjct: 256 LPLEHLLNHLLFMESSLIKSQEIEISFQESKLMTFAVASQLSTLLRNDVVISKLHKLYSG 315

Query: 319 RKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQM 378
           R+SGFSMRS Q+K FKW AP+IL++SGMR+T+  EYA +KNPRY+ F++++P+L++ DQ 
Sbjct: 316 RESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLRDLDQN 375

Query: 379 MDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTIG 438
           ++  H   RK TFAVY+D+PWKV+NK  FG L T I+E+SPRQD ++  + G IYFNT+G
Sbjct: 376 LEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVIYFNTVG 435

Query: 439 GGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENS 498
           GGIGIG  QP+ K  S  Y PGNVSLT D++LEF  FR+TGYGGS++P  +  ++++   
Sbjct: 436 GGIGIGSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQKKEDATR 495

Query: 499 PYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMAGLV 558
            +E+ FLIQD+EVWGCGG                 +K+RQ++NL+S+GEDRALLEMAG++
Sbjct: 496 TFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALLEMAGII 555

Query: 559 GQH-QGGGSM 567
           G H   GGS+
Sbjct: 556 GNHAHSGGSL 565

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  457 bits (1176), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 236/551 (42%), Positives = 337/551 (61%), Gaps = 17/551 (3%)

Query: 20  KFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIV 79
           +F    +IL YFN +  +  T+ E+ +FK      DLN PI    +  +LY       + 
Sbjct: 19  QFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNEPIDDTLIKEALYLDA-QPNVW 77

Query: 80  GIVTNMLRVLSNFPLMKSSY-EPITGYGLLKCILLLNRARCAKFLKTK--SYDQLKLLFI 136
             V+  +R+L NFPL      + ITG+GLLK I ++N  R  K + T    YD    + +
Sbjct: 78  SAVSETIRLLQNFPLFHQPIADSITGFGLLKVIAIINVKRFEKLVNTTITRYD----ITV 133

Query: 137 SLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTV 196
           +L L    KE     SEN   K   +  I+  +D ++ E + IP D ++  + WLL L  
Sbjct: 134 TLGLCGQAKE-----SENK-IKSTNLGDILKTYDHIEIESIHIPYDKLILLVAWLLTLVT 187

Query: 197 DCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTVMPN 256
              TTN K++ ++T   W NFK SA+++  T++   +G+     I       A  T+M +
Sbjct: 188 GVATTNCKVELSDTIANWNNFKSSAISIANTISTSALGNANDIGIPATDILNAFNTIMIS 247

Query: 257 LLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLY 316
           L+  + NL EH  +   DL+DH  +L+++    V+TP+L AQ+  GLP  + I KLQ LY
Sbjct: 248 LVPYMSNLFEHLLFGVDDLIDHVNDLANLSHQDVLTPSLYAQVIIGLPNSITITKLQKLY 307

Query: 317 IGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESD 376
           +G++SGFSMRSLQ+KVF+W AP++++VSG RI++ E YA  KNPRYR FL  FPKL+E+D
Sbjct: 308 VGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDESYADSKNPRYRSFLYSFPKLREND 367

Query: 377 QMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNT 436
           Q +DA HL K+K T+AVYID+PWKV+NK+ FG  N  I+E++P+Q  Y+   + T+YFNT
Sbjct: 368 QNLDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKTYQSCMERTMYFNT 427

Query: 437 IGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEE 496
           IGGGIG+G +QP++K    ++IPGN+SLT DS+LEF VFR+ G GG     LL     ++
Sbjct: 428 IGGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFGVFRHVGAGGGFKTSLLD---NDD 484

Query: 497 NSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMAG 556
           +  +E+ F+IQ+VEVWGCGG                 +KRRQ INL+SL ED+ALLEM G
Sbjct: 485 SKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRRQTINLQSLSEDKALLEMVG 544

Query: 557 LVGQHQGGGSM 567
           LVGQHQ GGS+
Sbjct: 545 LVGQHQSGGSV 555

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  457 bits (1176), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 246/556 (44%), Positives = 346/556 (62%), Gaps = 17/556 (3%)

Query: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIE-DLNTPISHKALCNSLYFPQNHAMIV 79
           F + K+IL +F+N+A +Q+   ELV+F+ N+ ++ DL   +S + L      P++    V
Sbjct: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFV 78

Query: 80  GIVTNMLRVLSNFPLMK--SSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFIS 137
            +   M+   S FPLM   +  +  T  GL+K  LL +  +  K+ + K+YDQ+ L+FI 
Sbjct: 79  KVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFIL 138

Query: 138 LSLQ---KTDKEELSEE-SENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLI 193
           L+L+   K  K+EL    S  D  K      I+  F+D++ E + + AD +LQF+T+LL+
Sbjct: 139 LALEPHAKVSKKELGRPPSSYDARK------IMESFNDINLETIEVSADDLLQFMTFLLV 192

Query: 194 LTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIR 251
           +T  C   N ++ N   ++ W +++  ALN+LRTMNP +V   D   + +T  QF   I 
Sbjct: 193 ITKYCIFENVEV-NPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCIT 251

Query: 252 TVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHK 311
            V PNLL PL   M+H  Y    LV       + + S VMT  LLAQL T  PK +    
Sbjct: 252 AVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQN 311

Query: 312 LQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPK 371
           L+ L+I ++SGFS+RS QAKV  WMAPSIL+VSGM+I +  +  A KN RY+ FL+E+PK
Sbjct: 312 LKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLA-KNQRYKSFLQEYPK 370

Query: 372 LKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGT 431
           LK+ DQ  D+    KRK TFAV++ + WKVTNK+ FG+L T I+++SPRQ++++ ++ G 
Sbjct: 371 LKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGN 430

Query: 432 IYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSM 491
           IYFNT+GGGIGIG+ QP+IK + K+Y PGNVSLT D + EF VFRN G+GGS+ PG L +
Sbjct: 431 IYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFL 490

Query: 492 ERKEENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRAL 551
           ER +     E  F+IQDVEVWGCGG                 S+RRQ INL S+GED+AL
Sbjct: 491 ERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKAL 550

Query: 552 LEMAGLVGQHQGGGSM 567
           LEM GLVG HQ GGS+
Sbjct: 551 LEMVGLVGHHQSGGSL 566

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  449 bits (1156), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 234/559 (41%), Positives = 337/559 (60%), Gaps = 21/559 (3%)

Query: 24  SKDILAYFNNKAQQQVTIPELVSFKGNLQI-EDLNTPISHKALCNSLYFP------QNHA 76
           +++I   +N++  +Q    EL +FK  + +   LN  +  + L   L  P      Q   
Sbjct: 25  TEEIEQEYNDRVLRQFNASELYTFKCRVGMTRQLNDVVLEQELLEWLCLPLEGHLQQPSK 84

Query: 77  MIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFI 136
           ++VG++    +VL  FP + ++   +T   LLK ++L+NR +C K++  KSY+ L+L+F+
Sbjct: 85  LLVGVI----KVLGQFPFISNTGGNLTAVSLLKAVILINRGKCLKYIGNKSYNHLELIFM 140

Query: 137 SLSLQKTDKEELSEESENDGNKELTIKQIITGFD---DVDTEMLCIPADFMLQFLTWLLI 193
           +L L +   +   +ES  D  +   I+++I+ +D   D  +E + + AD +LQF T LL+
Sbjct: 141 ALYLAQDSHDSTKKESY-DPKEPHNIEKVISSYDGNSDCVSE-ITVQADNLLQFTTMLLL 198

Query: 194 LTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTV 253
           L+   P  NS++D     + W  ++ SA N++RTMN  ++   ++H+I+F QF   I  +
Sbjct: 199 LSARIPRPNSQIDLKTADNDWAKYEKSAYNVIRTMNSSIISSCQTHTISFHQFYDVISIL 258

Query: 254 MPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELF-IHKL 312
           +P +L  L+NL++H  Y    LVDH     +  ++KVM     A L   L  + + I KL
Sbjct: 259 LPTILTTLDNLLQHLLYTPDQLVDHTALGPTFTETKVMNHGSFALLQFALADKGYPISKL 318

Query: 313 QSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKL 372
           Q LY+GR SGFSMRS Q KVF W AP++L VSG RI + ++Y+  KNPRY  FLE+F KL
Sbjct: 319 QKLYVGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRIQDDDDYSKNKNPRYSKFLEDFRKL 378

Query: 373 KESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTI 432
           +++DQ +    L KRK  F +YI+ PW+VTNKDYF    T I ++SP  DI+K N+   +
Sbjct: 379 RDTDQQLSPCLLKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKANRDDVV 438

Query: 433 YFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSME 492
           YFNT+GGGIGIGD QP  K   + Y PGN+SLT DS+LEF  FRN G GG  +PG L   
Sbjct: 439 YFNTMGGGIGIGDTQPYTKVNYREYRPGNISLTLDSSLEFGAFRNVGPGGMFEPGALFTR 498

Query: 493 RKEE----NSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGED 548
           R  +    ++ YEL FLIQDVEVWGCGG                 +KRRQ +NL+SL ED
Sbjct: 499 RNGDGVVTSNSYELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRRQHVNLKSLSED 558

Query: 549 RALLEMAGLVGQHQGGGSM 567
           RALLEMAGLVGQHQ GGS+
Sbjct: 559 RALLEMAGLVGQHQSGGSI 577

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/552 (36%), Positives = 299/552 (54%), Gaps = 18/552 (3%)

Query: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNL--QIEDLNTPISHKALCNSLYFPQNHAMI 78
           FT+   ++A+FN +A +Q++  E  +F  N+   IE     +  +AL      P +    
Sbjct: 19  FTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEE-LDLQALATLYGVPADVPWF 77

Query: 79  VGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISL 138
             +    +  L++FPLM     P T  GLLK  LL N+ R A++   KSYD   L+   L
Sbjct: 78  TEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDVASLV---L 133

Query: 139 SLQKTDKEELSEESEN-DGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVD 197
           +L    ++   E  +  DG+K      +I   D      L +  + ++++  ++  ++  
Sbjct: 134 ALLAPPRDACDENVDQFDGDK------LIDTLDGTFIAELEVRPNKLVRYSPFIAQISQV 187

Query: 198 CPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIRTVMP 255
           C  +N  L  +     W       L LLR+++  +V   D  S SIT+QQF+  +R+V P
Sbjct: 188 CNGSNEPLSRS-MFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFP 246

Query: 256 NLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSL 315
           N+   L   +E  FY++ D  +      + + S ++T  LL QLST  P+      +Q L
Sbjct: 247 NVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQRL 306

Query: 316 YIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKES 375
           ++   +GFSM   QAKVFKWMAP+IL VSG RI + +E    KN RY+ FL+++P LK++
Sbjct: 307 FVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQD-DEIVCTKNKRYKAFLQDYPALKDA 365

Query: 376 DQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFN 435
           +Q +      KR   +A+++ DPWK+TNKD FGD++T II+++PRQ I+K  +   IYFN
Sbjct: 366 EQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIYFN 425

Query: 436 TIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKE 495
            +GGGIG G  QP +KPA KRY PGNVS T D ++EFAVFRN G GG    G       E
Sbjct: 426 AVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPAE 485

Query: 496 ENSPYELHFLIQDVEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMA 555
           +   YE   +I+D+EVWG GG                 + +R+ I      EDRALLEMA
Sbjct: 486 QPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEMA 545

Query: 556 GLVGQHQGGGSM 567
           G+VG +Q GGS+
Sbjct: 546 GIVGHYQSGGSV 557

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  258 bits (658), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 174/532 (32%), Positives = 277/532 (52%), Gaps = 63/532 (11%)

Query: 32  NNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIVGIVTNMLRVLSN 91
           N   ++  T+ EL++F+  +    L+  IS K +    Y P +   +  +    +R L+ 
Sbjct: 18  NTLIKEIFTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNK 76

Query: 92  FPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSLQKTDKEELSEE 151
           +P   S+   ITGY  LK I LLN+ R  K      +  +K++F+ LS            
Sbjct: 77  YP---SNDNIITGYSYLKIITLLNKKRRNKMFPKIEW--IKIIFMCLS------------ 119

Query: 152 SENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPTTNSKLDNTET- 210
                ++E+      T  D      + +  + +++F++ LL L ++C T    ++   T 
Sbjct: 120 -----DEEVQFPCWETTHD------IHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTF 168

Query: 211 --HDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTVMPNLLKPLENLMEHF 268
             HD    ++ SA  ++R M    V + E+           +  ++PN+   L+NL+EH 
Sbjct: 169 NDHDWDTYWRKSASCIVRDMKECNVEEFEN-----------VLLIVPNIFDCLKNLIEHS 217

Query: 269 FYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIGRKSGFSMRSL 328
            Y +  L +     S    +K M  A+L Q+   + K      +  LYIGR++G+SMRS 
Sbjct: 218 LYTKDQLKECPLGPSQFTKTK-MNQAILCQILLSMRKRSM--DISKLYIGRENGYSMRSF 274

Query: 329 QAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQMMDASHLNKRK 388
           Q+KVFKW AP+IL+++G +I N +EY +EKN RY+ FL  +P+LK+              
Sbjct: 275 QSKVFKWKAPTILLITGKKIINDQEY-SEKNNRYKSFLNSYPRLKDGKTTFQTP----LH 329

Query: 389 TTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTIGGGIGIGDKQP 448
            TFA+YI++PWK+T K YFG L+T+II++SPRQD++       +YF+T   GIGIG++  
Sbjct: 330 YTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH- 386

Query: 449 LIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSPYELHFLIQD 508
               +  +Y PGNVS+T DSTLEFAVFR++G      PG+           +E+   IQ 
Sbjct: 387 --MSSDNKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRLHIQS 438

Query: 509 VEVWGCGGXXXXXXXXXXXXXXXXXSKRRQQINLRSLGEDRALLEMAGLVGQ 560
           VEVWGCGG                 ++RRQ +++  + EDRALLE+AG++G+
Sbjct: 439 VEVWGCGGAKELAEQKHEWEWEEREAQRRQHVSMH-VTEDRALLELAGIIGE 489

>NDAI0D04460 Chr4 complement(1048402..1049994) [1593 bp, 530 aa]
           {ON} Anc_4.229 YDL054C
          Length = 530

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 258 LKPLENLMEHFFYLQHDLVDHD-TNLSSIQDSKVMTPALLAQLSTGLPKELF 308
           L PLE  + +   L H L+ H+ T LSS   S     + LA+LSTGL  +LF
Sbjct: 330 LGPLEMFVTNMSSLSHLLIKHETTTLSSQILSIYAFSSTLARLSTGLTMDLF 381

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,314,217
Number of extensions: 2607592
Number of successful extensions: 7821
Number of sequences better than 10.0: 31
Number of HSP's gapped: 7968
Number of HSP's successfully gapped: 32
Length of query: 567
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 452
Effective length of database: 40,294,809
Effective search space: 18213253668
Effective search space used: 18213253668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)