Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR116C (RPO31)5.426ON1460146077250.0
Smik_15.2945.426ON1460146075630.0
Skud_15.2795.426ON1460146075120.0
Suva_8.1695.426ON1460146074630.0
NCAS0H020405.426ON1460146068910.0
NDAI0C016205.426ON1460146068840.0
TDEL0E019905.426ON1460146068220.0
KAFR0D050305.426ON1462145768210.0
SAKL0G02354g5.426ON1458146067360.0
Kpol_1016.95.426ON1460146067300.0
ZYRO0F09856g5.426ON1458146066690.0
CAGL0L11660g5.426ON1459145966680.0
KLTH0F16236g5.426ON1460146165700.0
TBLA0A037205.426ON1458146065620.0
KNAG0B042405.426ON1455146165120.0
AER252C5.426ON1459146064820.0
KLLA0E21253g5.426ON1457146064760.0
Ecym_55255.426ON1459146064580.0
TPHA0H017605.426ON1459145264170.0
Kwal_55.214595.426ON1148114551490.0
ZYRO0F05918g7.314ON1744151918820.0
Ecym_80657.314ON1743151218750.0
TPHA0A030707.314ON1719151418690.0
KNAG0C039707.314ON1721149918680.0
Suva_4.1047.314ON1733152318630.0
KAFR0B010607.314ON1685151918570.0
YDL140C (RPO21)7.314ON1733152318600.0
Smik_4.957.314ON1719152418580.0
KLLA0F05071g7.314ON1720150418570.0
KLTH0H02046g7.314ON1740153218510.0
Skud_4.1147.314ON1726152518500.0
Kwal_56.244897.314ON1728153618400.0
ADR086C7.314ON1745151318390.0
NDAI0A021307.314ON1729151818350.0
TBLA0F021707.314ON1726151718350.0
CAGL0I03828g7.314ON1715152018240.0
NCAS0A139007.314ON1716151418220.0
SAKL0F10472g7.314ON1730151618140.0
TDEL0C023207.314ON1727150017950.0
Kpol_162.1singletonON1311116716450.0
Kwal_55.21464singletonOFF32031714010.0
CAGL0E05500g7.51ON164398111531e-132
ZYRO0D04532g7.51ON166798411411e-130
TPHA0H028007.51ON1648107311391e-130
KLLA0F23243g7.51ON165398611331e-129
TDEL0H040007.51ON166596911291e-128
Kwal_26.69797.51ON165498511261e-128
YOR341W (RPA190)7.51ON166498311201e-127
Smik_15.5197.51ON166598711191e-127
KNAG0D049707.51ON167197711181e-127
KLTH0D01628g7.51ON165499011141e-126
KAFR0K005407.51ON166297111101e-126
Skud_15.5067.51ON166598511071e-125
NCAS0F007307.51ON167492311061e-125
Suva_8.3917.51ON166598711041e-125
TBLA0E019307.51ON165998311031e-125
NDAI0H012007.51ON166992411031e-125
ADR374C7.51ON164097910721e-121
SAKL0B10736g7.51ON165098310621e-119
Kpol_1040.37.51ON16569949741e-108
Kpol_1019.277.314ON3642901931e-14
Suva_13.4108.752ON267129890.074
KLTH0B07436g2.56ON92796840.42
Smik_13.4348.752ON267129810.62
YMR226C8.752ON267129781.6
TPHA0H014405.359ON875128782.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR116C
         (1460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2980   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2917   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2898   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2879   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2659   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2656   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2632   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2632   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2599   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2597   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2573   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2573   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2535   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2532   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2513   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2501   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2499   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2492   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2476   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  1988   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   729   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   726   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   724   0.0  
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   724   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   722   0.0  
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   719   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   721   0.0  
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   720   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   719   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   717   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   717   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   713   0.0  
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   712   0.0  
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   711   0.0  
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   711   0.0  
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   707   0.0  
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   706   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   703   0.0  
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   696   0.0  
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   638   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   544   0.0  
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   448   e-132
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   444   e-130
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   443   e-130
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   441   e-129
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   439   e-128
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   438   e-128
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   436   e-127
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   435   e-127
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   435   e-127
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   433   e-126
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   432   e-126
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   431   e-125
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   430   e-125
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   429   e-125
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   429   e-125
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   429   e-125
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   417   e-121
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   413   e-119
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   379   e-108
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    79   1e-14
Suva_13.410 Chr13 complement(702373..703176) [804 bp, 267 aa] {O...    39   0.074
KLTH0B07436g Chr2 (600260..603043) [2784 bp, 927 aa] {ON} some s...    37   0.42 
Smik_13.434 Chr13 complement(705526..706329) [804 bp, 267 aa] {O...    36   0.62 
YMR226C Chr13 complement(721593..722396) [804 bp, 267 aa] {ON} N...    35   1.6  
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    35   2.2  

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2980 bits (7725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1440/1460 (98%), Positives = 1440/1460 (98%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            LVPKRCLFESLSNEAALKAN
Sbjct: 1441 LVPKRCLFESLSNEAALKAN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2917 bits (7563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1410/1460 (96%), Positives = 1424/1460 (97%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVL HNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLKRNEDARRNLRYGDR+KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIE FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQD+GLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            +T NEIL PLEERLVRYDNSGCLVK E+LNKAEYVDQYDAERDFY SL+EYIN KATALA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            NLRKSRGML LLEPP KE + +DPD+ VPDNVKTSVSQLYRISEKSVRKFLEIAL+KYRK
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVA+YVQDVYKDNLSFIQVRIDLGTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRA+KLKIQASDVNIIGKDRIAINVFPEGYKA+SISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISE+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            LVPK CLFESLSNEAALKAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2898 bits (7512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1401/1460 (95%), Positives = 1417/1460 (97%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS+LECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSA+LLSETDK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVL HNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT+PSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQELI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIE FD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLP+EMSQNDGFVIIRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELITLFNKGELETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNN+D+GLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            +TANEIL PLEERLVRYDN G LVK ED ++AEYVDQYDAERDFY SLREYIN KATALA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            NLRKSRGM   LEPP KEL+GID DE VPDNV+TSVSQLYRISEKSVRKFLEIALFKYRK
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVA+YVQDVYKDNLSFIQVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AITRASKLKIQASDVNIIGKD+IAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            QQLRRALPDVVVKGLPDISRAVINIRDD KRELLVEGYGLRDVMCTDGVIGS+TTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            LVPK CLFESLSNEAALKAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2879 bits (7463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1385/1460 (94%), Positives = 1414/1460 (96%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAP+ANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLEC TCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVL HNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLK+NEDARRNLRYGDRMKLAK+LQIGDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL MMSDG+E FD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLIKP+H SPVVINLDAKNKVFVPPKSKSLP+EMSQNDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELIT FNKGELETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITF+NQD+GLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            ETAN+IL PLE+RLVRYDN G LVK ED +KAE+VDQYDAERDFY SLREYIN KAT LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            NLRKSRGML L+  P KELQG+DPDE VP NV+TSVSQLYRISE+SV+KFLEIALFKYRK
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVA+YVQDVYKDNLSFIQVRIDLGTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRASKLKIQA DV IIGKD+IAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            QQLRRALPDVVVKGL DISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGS+TTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSI+REINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGTN+SEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L+PK CLFESLSNEAALKAN
Sbjct: 1441 LIPKPCLFESLSNEAALKAN 1460

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2659 bits (6891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1274/1460 (87%), Positives = 1355/1460 (92%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSE PKRI GLEFSALSAADIVAQSE+EVS+RDLFDLEK R PK  GALD KMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CK CSAILL++ DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RQFL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WKEVL+H+PELER++KRC DDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK+NEDARRNLRYGDR+KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMS+G   FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            YY+WTGKQVFSLLI+PN  SPVVINLDAKNKVF+PPK K  PNEMS+NDG+V+IRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELI  F+KG+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNA+PVNFNRSWDHA NITF+N +KGLLPY IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            E  NEIL PLEERL+RYDN G LV ++D  KAEYVDQ+DAERDFY SLR+YI  KA  LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
             +RKSRGML +   P +EL+ +DPDE + +++K SV QLY+I+EKSV+ FLEIAL+KYRK
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSD+A+Y+QDVYKDNLSFIQVR+DLGTI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAIT+A KLKIQ SDVNI+GKD+IAINV+P+GYKAKSIST AKEPS N VFYRM
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            Q LRR LP +VVKG  DISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG +TTTNH+L
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV +VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PK  LFE LSN    K N
Sbjct: 1441 LKPKPTLFEKLSNCGTHKLN 1460

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2656 bits (6884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1269/1460 (86%), Positives = 1359/1460 (93%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSE PKRI GLEFSALSAADIVAQSEVE+S+RDLFDLEK R PK  GALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSAILLS+ D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RQFL+ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            D FRWVGKKSAPEKD WVG+WKEVL+H+PELER+VKRC DDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG+++TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYNR KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK NEDARRNLRYGDR+KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMM D    FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            +YLWTGKQ+FSLLIKPN +SPVVINLDAKNKV++PPK+K+ PNEMS+NDG+VIIRGSQIL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRMAKLCARFLGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELI  FNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNA+PVNFNRSWDHA NITF+    GLLPY IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            ET N IL PLE+RL+RYDN G +V  ED  KAEYVDQ+DAERDFY SLR+Y++ KA  L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++RKSRGML +++ PA+EL+ ++PDE VP+ ++ SV QLY+I+E  V+KFLEIAL+KYRK
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVA+Y+QDVYKDNLSFIQVRIDL TI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVA+TRA KLKI  SDVNIIGKD+IAINVFPEGYKAKSIST+AKEP+EN VFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            Q LRRALP +VVKGLP+I+RAVINIRDDGKRELLVEGYGLRDVMCTDGVIG +TTTNH+L
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV +VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT I+++ 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PK  LFE+L++  ++K N
Sbjct: 1441 LKPKPTLFENLTSSRSIKMN 1460

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2632 bits (6822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1255/1460 (85%), Positives = 1348/1460 (92%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVS TPKRI GLEFSALSAADIVAQSEVE+STRDLFDLE  RAP+A GALDPKMGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCSA+LL + D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPGVDNLRRMGIL K+LDQCKKQRRCL C                    IIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRW GKKS PEKD WVG+W EVL+HNPELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            +GL+KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK++EDARRNLRYGDR+KLAKNL++GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DR +LTQLLSMMSDG   FDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
             YLWTGKQVFSLLIKPN  SPVVINLDAKNKVF+PPKSKSLP+EMSQNDG+VIIRGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKE++VE AY KCDELI  +NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TFNN ++GL PY I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            E  ++IL PL  RL+RYDN G LV +E     EY+DQ DAER+FY SL+ ++ GKA  LA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++RK RGM  LL+ P  E + ID DE VP+N++ SV QL RI+  SVR+FL+IA+ KYR+
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGR+EKTLLSDVAFY+QDVY+DNLSF+QVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRA KLKIQASDV I+ KD+IAINVFPEGYKAKSISTSAKEP ENDVF+RM
Sbjct: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            QQLRR+LP +VVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM TDGV+G +T TNH+L
Sbjct: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT++ E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PK  LFESLS E A+KAN
Sbjct: 1441 LRPKPTLFESLSKETAIKAN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2632 bits (6821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1248/1457 (85%), Positives = 1353/1457 (92%), Gaps = 1/1457 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV+SE PK+I G+EFSALSA+DIVAQSEVE+S+RDLFDLE++R  K NGALDP+MGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSL C TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNCS++LLS+ DK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RQFLHELRRPG-VDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXII 179
            +++LHELR  G +DNL++MGILKK++DQCKKQRRCLHC                    II
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADC 239
            HDTFRWVGKKS PEKD W+G+W EVL+H+PELER+VKRC DDLNPLKTLNLFKQ++  DC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359
            KAGL+KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL 419
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 420  IVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPS 479
            ++NGPN+HPGANYLLK+NE+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLLSMMSDG   FDIPPPAIMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 600  PYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQI 659
            PYYLWTGKQ+FSLLIKPNH SPVVINLDAKNKV++PPKSKSLPNEMS+NDGFVIIRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 720  ADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
            ADDLK KKEELVEIAY KCD+LI  +NKG+LETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAI 959
            YDNTVRTS+NGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITFNN ++GLLPY +
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 960  METANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATAL 1019
            M+  NE+L PLEERLVRYDN G  V +EDL+K EY DQ+DAERDFY +LR YI  K+  L
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1020 ANLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYR 1079
            A++RKSRG+L LL  P +ELQ + PDE   D  ++SV QL +I+EK+V KFLEIAL KYR
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            KAR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGRVEKT+LSDVA+Y+QDVYKDNLSF+Q+RIDL TI+KLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1200 LTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIAVA+T+A KLKIQASDV+I G D++ +NVFPEG K+KSISTSAK+PSENDVFYR
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319
            MQQLRRALP +VVKGLP+I+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIGS+T TNHV
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LEV SVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT+I  +
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1440 DLVPKRCLFESLSNEAA 1456
            DL PK  LFESLS+ ++
Sbjct: 1441 DLKPKPTLFESLSSASS 1457

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2599 bits (6736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1239/1460 (84%), Positives = 1340/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PK+IKGLEFSALSA+DIVAQSEVE+STRDLFDLE  R PK  GALD KMGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CKNC++ILLS+ DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RQFL ELRRPGVDNLRRMG LKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ WVG+WK+VL HNPELERY+KRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+ V SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+HKLQ+L+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPN+HPGANYLLK+N+DARRNLRYGDRMKLAKNLQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMSDG   FD+PPPA+MKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            +YLWTGKQVFSLLI+PN  SPV+IN+DAKNKVF+PPK K LPNEMS NDGFV+IRGS+IL
Sbjct: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DLKQKKE+ VE AY KCDELI  FNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF ++D GLLPY I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            E  N IL PLE++LVR+DN G  + +ED  K EY+DQ+DAER+FY SLR+Y+  KAT LA
Sbjct: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
             +RK++G+  LL+ PA EL+ ++ DE  P+ + T+V+QL +IS+  V  FL IA+ KY +
Sbjct: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVND DERAARVVKGR+EKT+LSDV +Y+QDVYKDNLSFIQ ++DLGTI+KLQLEL
Sbjct: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRASKLKI  +DV+I+G+++I INVFPEGYKAKSISTSAKEPSEN VFYRM
Sbjct: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            Q LRRALP +VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGS+T TNH+L
Sbjct: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            E+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT+ISE+D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PK  LFESL N+ ALK +
Sbjct: 1439 LKPKHTLFESLCNDVALKTH 1458

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2597 bits (6730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1236/1460 (84%), Positives = 1335/1460 (91%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPK+I GLEFSALSA+DIVAQSEVEVSTRDLFDLE  RAPK  GALDPKMGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSS+EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCS+ILL++TD+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELRRPG+DNL+RM I+KKILDQCKKQRRCL C                    IIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKS+PEKD WVG+W++VLA+NPELER+ KR MDDLNPLKTLNLFKQI+  DCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVNP+M+PG+S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANY+LK NE+ARRNLRYGDR+K+AK L++GD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKD+F DRAT TQLLSMMSD    FDIPPP I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            Y LWTGKQ+FSLLIKPN +SPVVINLDAKNKVF+PPKSKSLPNEMSQNDGFV+IRGSQIL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            + LKQKKEELVEIAY KCDELI LF KG+LETQPGCNEEQTLEAKIGGLLSKVREEVGD+
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNF RSWDHA NITF+N  +GLLPYAI+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
               N+IL P EERL+RYDN G LVK  D  K E+VDQ D+ER+FY SLR+Y+  KA+ LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++RK +G+  L   P  E + +D DE      + +V +L +I+EK+V KFLEIA+ KYR+
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDND+RAARVVKGR+EKTLLSDVA+YVQDVYKDNLSF++V+IDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVA+TRA KLKIQ +DV I+ KD+I I+V+PEG KAKSISTS KEPSENDVFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            Q LRRALP +VV GLPDI+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIGS+TTTNHVL
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FK++K T I   D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PKR LFE+L  E ALK N
Sbjct: 1441 LKPKRTLFENLVAEPALKVN 1460

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2573 bits (6669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1227/1460 (84%), Positives = 1341/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEVE+STRDLFDLE  RAPK  GALDPKMGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSS+EC TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQGICK CS+ILL +TDK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            + FL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRW GKKS PEK+ W+G+W  VLAH+PELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+L+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPN +PGANYLLK++EDARRNLR+GDR+KLAKNL+IGD+VERHLEDGDVVLFNRQPSL
Sbjct: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+  +TQLLSMMSDG   FDIPPP I KP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
             YLWTGKQ+FSLLI+PN  SPVV+NLDAKNKV++PPKSKSLPNEMSQNDGFV+IRGSQIL
Sbjct: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGI+DVTPA
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            ++LK+KKEE+VE AY KCDELI LF+KG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  EELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TFNN D+GLLPY IM
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            +   EIL PLE RLVRYDN G  + +E+ ++ EY+DQ DAER FYHSLR++I  KA  LA
Sbjct: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
              R S+ M  L++ PA ELQ +D DE VP++++ SV Q+YRI++K VR+FL +A+ KYR+
Sbjct: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN++DERAARVVKGR+EKTLLSDVAFY+QDVY+DNLS++QVR+DL TIDKLQLEL
Sbjct: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVA+TRA KLKIQASDV+I+GKD+IAINVFP+G KAKSIST AKEPSEN+VFYRM
Sbjct: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            QQLRRALP +VVKGL DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G +T TNH+L
Sbjct: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGTN+SE+ 
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PK  LFESL NE ++K N
Sbjct: 1439 LKPKPTLFESLVNETSVKVN 1458

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2573 bits (6668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1235/1459 (84%), Positives = 1337/1459 (91%), Gaps = 3/1459 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV+ ETPKRI GLEFSALS ADIVAQSE+E+S+RDLFDLE +R+PK  GALDP+MGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            S+SS+EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSAILLSE DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPGVDNLRRM +LKK+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKS PEKD W+G+WKEVL+HNPELERYVKR  DDLNPLKTLNLFKQI S DCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT  +GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AG++KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPGSS GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL++L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLK+NE+ARRNLRYGDR KLA NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+A+LTQLLSMMSDG   FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
             YLWTGKQVFSLLIKPN NSPV INLDAKNKV++PPK K  PNEMSQNDGFVI+RGSQIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKE+LVEIAY KCDELI L+NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNN D+GLLPY I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            +T + IL PLE+RL+RYD  G  V  ED    +YVDQ+D+ER FY SLRE++  KA  LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPD-ETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYR 1079
             LRKSRG+  L++    EL+G DP+ E +   V+ S++QLYRI+E +V+KFLEIA+ KY 
Sbjct: 1021 KLRKSRGLPKLIK--KSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGR+EKTLLSDV +Y+QDVYK+N++++QV++DL TIDKLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198

Query: 1200 LTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIA+AITRA KLKIQ SDV ++GKD+IAINV PEG+ +K+ STS KEP+ENDVFYR
Sbjct: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319
            MQ LRRALP ++VKGL DI+RAVINIRDDGKRELLVEGYGLRDVMCTDGVIG++T TNHV
Sbjct: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318

Query: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LE+F+VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+I+E 
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438

Query: 1440 DLVPKRCLFESLSNEAALK 1458
            +L PKR LFESL++  A K
Sbjct: 1439 ELKPKRTLFESLTSNVANK 1457

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2535 bits (6570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1210/1461 (82%), Positives = 1317/1461 (90%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIVAQS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK C+A+LLSE DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
             QFL ELRRPG+DNLRRMGILKK++DQCKKQRRCL C                    I+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WK VLAHNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPN HPGANYLLK++E+ARRNLRYGDRMKLA+NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMSDG   FDIPPP+IMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            YY+WTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KSLPNEMS NDG+V+IRGS+IL
Sbjct: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKE +VE AY KCD LI LFNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN N+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TFN+ DK LLPY IM
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            +  N +L PLEE+LVRYDN G  +     ++ EY+DQ DAER+FY SLR+Y+  KA+ LA
Sbjct: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            N+R  +G+   L+ PA ELQ +D DE  P +   SV QL +IS K V KFLEIA+FKY K
Sbjct: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVAFY+QDVYKDN+SF+QV++DLGTI+KLQLEL
Sbjct: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDIAVAITRA+KLKI ASDV+I+GKD++ INV+PE  K KSISTSAKEP EN++FYRM
Sbjct: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            Q LRRALP +VVKGLPDI+RAVINI+DDG RELLVEGYGLR+VM TDGVIG +T TNH+L
Sbjct: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SI+ EI+YTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT+ISE D
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439

Query: 1441 LVPKRCLFESLSNE-AALKAN 1460
            L PK  LFESL +   ALK N
Sbjct: 1440 LAPKPTLFESLCDSVTALKVN 1460

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2532 bits (6562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1217/1460 (83%), Positives = 1316/1460 (90%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEV ++TRDL+DLE  RAPK +GALD +MGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS+LEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICK+C+A+LLS+ DK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNL+RMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK  PEKD WVG+W+EVL+HNPELER+VKR MDDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVNP ++PG+S G  KVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGN-KVKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PE+VTRYN+ KLQ L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALV 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK++E+ARRNLRYGD++KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  LNGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLLSMM DG   FDIPPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
             YLWTGKQ+FSLLIKPN NSPVVIN+DAKNKVF PPK KSLP+EMS NDGFV+IRGSQIL
Sbjct: 600  CYLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPD 719

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            D LK  KE LVEIAY KCDELI L+N+G+LETQPGCNEEQTLEAKI G+LSKVREEVGD+
Sbjct: 720  DKLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDI 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CINELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP +MEGNAQPVNFNRSWDHAYNI F+N DK + PY I+
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQIL 959

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            E  N+IL PLEE+L+RYDN G +V  E+  K E+VDQ DAER+FY+SLR+Y+  KA  LA
Sbjct: 960  EITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELA 1019

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++RKSRGM  LL  P  E + +D DE  PD+++ SV Q+ RI+E +VR+FL+IA+ KYR+
Sbjct: 1020 DVRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRR 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVA+Y+QD YKDN S+++V+IDLGTI+KLQLEL
Sbjct: 1140 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLEL 1199

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+ DIA AI RA KLKIQ  DV      +I I+V PE   +K IS SAKEP EN+VFYRM
Sbjct: 1200 TMSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            Q LRRALP +VVKGLPDI+RAVINIRD+GKRELLVEGYGLRDVMCTDGVIGS+TTTNHVL
Sbjct: 1259 QHLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1318

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV SVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1319 EVNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+I    
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGT 1438

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PKR LFESL  E  +K N
Sbjct: 1439 LKPKRTLFESLCKETNIKIN 1458

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2513 bits (6512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1198/1461 (81%), Positives = 1315/1461 (90%), Gaps = 7/1461 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV ET K+I G+EFSAL+AADIVAQSEVE++TRDLFDLEK R  K  GALD +MGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSS EC TCHGNLASCHGHFGH+KLALPVFH+GYFK+TIQILQ ICK+CSA+LLS+ D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNLR+M ILKK++DQCKKQRRCL C                    IIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK  PEKD W+GEW E+L H+PELER+VKRC DDLNPLKTL LFKQ+KS DCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++TV SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLK+NE+ARRNLRYGD++KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D  +LTQLLSMMSD    FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KS PNEMS NDGFVIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCAR+LGNRGFSIGI+DVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKEE+V  AY KCDELI +F  G+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            D+TVRTSANGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITFN  + GLLPY I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
               + +L PLEE+L+RYDN G +V +E ++   Y D++DAER FY SLR Y+  KA  LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPD-ETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYR 1079
             +R +RG+L + +       G D   E V   ++ SV Q+Y+I++K+V  FL IAL KY 
Sbjct: 1021 QIRNTRGLLEMTQ------NGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199
            IINAVLVN+ DERAARVVKGR+EKTLLSD+AFY+QDVY+ N+S++++R+DL TI+KLQLE
Sbjct: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194

Query: 1200 LTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LT+EDIAVA++RA KLKIQ +D++I+GKD+I +NV+PEG KAKSISTSAKEPSEN+VFY+
Sbjct: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319
            MQ LRR+LPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLR+VMCTDGVIGS+T TNHV
Sbjct: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314

Query: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LEV SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  ++SE+
Sbjct: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434

Query: 1440 DLVPKRCLFESLSNEAALKAN 1460
            DL  +  LFESL++E A+KAN
Sbjct: 1435 DLKVRPTLFESLASETAIKAN 1455

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2501 bits (6482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1200/1460 (82%), Positives = 1304/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQSEVE+ TRDLFDLE  RAPK  GALD +MGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHG LASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNC+ +LL+E DK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RQFL ELRRPG+DNLRRM  LKK+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD W+G+W +VL H+PELERY+KR M++LNPLKTLNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG  NGGGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGG-NGGGKTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+HKLQ+LI
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNG NVHPGANYLLK+NE+ARRNLRYGDR+KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT  Q+LSMMSDG   FDIPPPAIM+P
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            +YLWTGKQ+FSLLIKPN  SPV+INLDAKNKV++ PK+K+ PNEMS NDG+V+IRGS IL
Sbjct: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK  KEE+VEIAY KCDELI L+ +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+N+ DKG+LPY I+
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            E  N IL PLE++L RYDN G  +     N+  Y+DQ+DAER+FY SLR Y++ KA  LA
Sbjct: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++ KSRG+  L   PA ELQ +D D + P+    SV+QL +IS K VR FL+IA+ KYRK
Sbjct: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INA LVND+DERAARVVKGRVEKTLLSDV FY+QDVY+DN+SF+QV++DL TI+KLQLEL
Sbjct: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDIA+AIT A KLKI   DV+I+G+++I INV  +  KAKSIST A EP ENDVF++M
Sbjct: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            Q LRRALP +VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G +T TNH L
Sbjct: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+ VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGTNIS  D
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PK  LFE+L +   LK N
Sbjct: 1440 LKPKPTLFENLCSLNTLKVN 1459

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2499 bits (6476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1198/1460 (82%), Positives = 1301/1460 (89%), Gaps = 3/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKE V+   PK+IKG+ FSALSAADIV+QSEVE+STRDLFDL+  R+ K  GALDP+MGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ +CK C A+LLSE DK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FL ELRRPG+DNLRRM ILKKILDQCKKQRRC  C                    IIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ W+G+WK+VL +NPELERYVKRCMDDLNPLK LNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+HKLQ+L+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLK+NEDARRNLRYGDR+KLAK LQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRA LTQLLSMMSD    FDIPPP+IMKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            +YLWTGKQVFSLLIKP+  SPVVINLDAKNKV++PP  K  PNEMSQNDGFV+IRGS IL
Sbjct: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DLKQKKE++VE AY KCDELI LFNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T N+   GLLPY I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
               N IL PLE +L RYDN G  +++ED +K EY+DQ+DAER FY SLRE++  KA  LA
Sbjct: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            +LR  RG+  L++ PA+EL+  + DE VP ++  +++QL +IS+  V+KFL IA+ KY +
Sbjct: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDV+FYVQD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDI VAI +A KLKI  +D++IIGKD+I I V  +G   KSIST+ KEP  N+VFYRM
Sbjct: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            QQLRRALP +VVKG  DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGS+T TNH+L
Sbjct: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+ VLGIEAAR  II EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + E D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L PK  LFE+L  +  +KAN
Sbjct: 1439 LTPKPTLFETLC-DTVVKAN 1457

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2492 bits (6458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1197/1460 (81%), Positives = 1303/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PK+IKGL FSALSA+DIVAQSEVE+ TRDLFDLE  RAPK  GALD KMGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQ ICKNC+AILLSE +K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RQFL ELRRPG+DNLRRM  L+K+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ W+G+W +VL HNPELERY+KR MD+LNPLKTLNLFKQ+++ DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG + GG     IRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKP-IRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPE+VTRYN+HKLQ+LI
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLI 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANY+LK+NEDARRNLRYGDR+KLAKN+QIGDVVERH+EDGDVVLFNRQPSL
Sbjct: 420  INGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPII+ATQDFITGSYLISHKDSF+DRAT TQLLSMM+D    FD+PPPAI+KP
Sbjct: 540  LLTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
             YLWTGKQVFSLLI+PN  SPV+INLDAKNKV++PPK+KS PNEMS NDG+VIIRGS+IL
Sbjct: 600  CYLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
             GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 660  CGVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKEE+VEIAY KCDELI LF +GELETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  KELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNTVRTS+NG+VQFTYGGDGLDPL MEGNAQPVNFNRSWDHA NITFNN++ GLLPY IM
Sbjct: 900  DNTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIM 959

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            ET+N IL PLE +L+R DN G  +  +  +  EY+DQ DAERDFY SLR Y+  KA  LA
Sbjct: 960  ETSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLA 1019

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
             +RKS+G+  LLE PA+EL+ +D D +       S++QL +IS   V  FL IA+ KY K
Sbjct: 1020 QIRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INA+LVNDNDERAARVVKGR+EKTLLSDV FY+QDVY+DN+SFIQV++DL TI+KLQLEL
Sbjct: 1140 INALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLEL 1199

Query: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AI+RA KLKI   DV+IIGK++I I+V  +  K KSIST   EP+ENDVFYRM
Sbjct: 1200 TIEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRM 1259

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320
            Q LRRALP++VVKGLPDISRAVINI +DGKRELLVEGYGLRDVM TDGVIG +T TNH L
Sbjct: 1260 QHLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFL 1319

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVF VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1320 EVFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV+GTNIS  +
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDE 1439

Query: 1441 LVPKRCLFESLSNEAALKAN 1460
            L P   LFE+L N  ALK +
Sbjct: 1440 LKPNPTLFENLCNNTALKVS 1459

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2476 bits (6417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1182/1452 (81%), Positives = 1310/1452 (90%), Gaps = 4/1452 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV+SETPKRI GLEFSALS +DI+AQSEVE+STRDLFDLE  RAP   GALDPKMGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS+LEC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQILQG+CK+CSAILL++TDK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELR+P +DNL+RM ILKKILDQCKKQRRCL C                    IIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK+ PEKD W+G+W +VL +NPELE+++KRC DDLNPLKTLNLFKQIK+ DCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVN  ++PGS NGG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGS-NGGTKAKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+ VAKVLTYPEKVTRYN+ KLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLV 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK NE+ARRNLRYG+R KLAK L+IGD+VERHLEDGD+VLFNRQPSL
Sbjct: 420  MNGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKN 539

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMSD    FDIPPPAI K
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFK 599

Query: 600  PYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQI 659
            P  LWTGKQ+FSLLIKPN  SPVVINLDAKNKV++PP++KS P+EMS NDG+VIIRGS+I
Sbjct: 600  PQCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEI 659

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQE+ANAMNRMAKLCAR+LGNRGFSIGI+DVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 720  ADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
             ++LK KKE+LVEIAY KCDELI  +NKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD
Sbjct: 720  GEELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNS 839

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAI 959
            YDNT+RTS+NGIVQFTYGGDGLDPL+MEGNA+PVNF R+WDHA NITF+   KGLLPY I
Sbjct: 900  YDNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQI 959

Query: 960  METANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATAL 1019
            ++  N IL PLE  LVRY+N G  + ++D +K EYVDQ DA+RDFY S+REY+  KA  L
Sbjct: 960  IKQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQL 1019

Query: 1020 ANLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYR 1079
            A +RK+R +  L+  PA+ELQ ID DE +P NV+  V +L +ISE +V+KFLEIA+ KY 
Sbjct: 1020 AKIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYH 1079

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1139

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199
            II AVLVND+D RAARVVKGR+EKTLLSDVA+Y++DVY+DN +FI+++IDL TI+KLQLE
Sbjct: 1140 IIKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLE 1199

Query: 1200 LTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIA+AI++A KLKI +S+++I+G D+IAI+VF E   +KSISTS KE SEN VFY+
Sbjct: 1200 LTIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEA--SKSISTSLKESSENTVFYK 1257

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319
            MQ LRRALPDVVVKGL DISRAVINI+DD K ELLVEGYGLRDVMCTDGVIG++T+TNH+
Sbjct: 1258 MQTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHI 1317

Query: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LE+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1318 LEIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1377

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTMSIGTGSF VVK T +S +
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPE 1437

Query: 1440 DLVPKRCLFESL 1451
             + PKR LFESL
Sbjct: 1438 QVKPKRTLFESL 1449

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 1988 bits (5149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 944/1145 (82%), Positives = 1022/1145 (89%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIV QS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK+C+A+LLSE DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RQFL ELRRPG+DNLRRMGILKK++DQCKKQRRCL C                    I+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WK VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPN HPGANYLLK++E+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFY RA   QLLSMMSDG   FDIPPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660
            YY+WTGKQVFSLLI+PN  S VVINLDAKNKV++PPK K LPNEMS NDGFV+IRGSQIL
Sbjct: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKE +VE AY KCD+LI  FNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN N+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITFN+ DK LLPY IM
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959

Query: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020
            +  N IL PLEE+LVRYDN G  +     ++AE++DQ DAER+FY SLREY++ KA+ LA
Sbjct: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019

Query: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080
             +R  +G+   L+ PA ELQ +D DE  P  +  SV QL +IS K V KFLEIA+FKY K
Sbjct: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVL 1145
            INAVL
Sbjct: 1140 INAVL 1144

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1519 (34%), Positives = 776/1519 (51%), Gaps = 157/1519 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  +I A S  ++   +  D  + RA K  G  DP++G    SL
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
            +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E ++ Q   
Sbjct: 66   KCQTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNE-QMRQ 124

Query: 126  ELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFRW 185
             ++    D+ +R      +   CK +   + C                        T R 
Sbjct: 125  AIKIK--DSKKR---FNAVWSLCKAK---MICDTDVPSDEDPTQLISRGGCGNAQPTIRR 176

Query: 186  VGKKSAPEKDIWVGEWKE--VLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
             G K        VG WK+      N E E+ V      LN  + LN+FK I   D   LG
Sbjct: 177  DGLK-------LVGSWKKDKNSGDNEEPEQRV------LNMEEILNIFKHISPEDSWKLG 223

Query: 244  IDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224  FNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQG 362
              G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+G
Sbjct: 281  HNGAPHHTIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 334

Query: 363  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVN 422
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L+ N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVRN 394

Query: 423  GPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHR 482
            GPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLHK 452

Query: 483  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 542
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIV 512

Query: 543  TPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDIPPPAI 597
            +P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    IP PAI
Sbjct: 513  SPQSNKPCMGVVQDTLCGIRKLTLRDNFIE---LGQVLNMLYWVPDWDGV----IPTPAI 565

Query: 598  MKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDGFVIIR 655
            +KP  LWTGKQ+ S+ I      P  I+L    +    + PK          ++G ++I 
Sbjct: 566  LKPKPLWTGKQLLSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVID 609

Query: 656  GSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIN 715
            G QI+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI 
Sbjct: 610  G-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIG 667

Query: 716  D-VTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVR 774
            D +     ++Q  E + E A  K +++        L  + G    ++ E  +   L++ R
Sbjct: 668  DTIADGQTMRQITEAIAE-AKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEAR 726

Query: 775  EEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 834
            ++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 835  FPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 894
            F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 895  DLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQDK 952
            D+   YD T R S   I+QF YG DG+D   +E  A       +R+++  Y I   N D 
Sbjct: 847  DIMVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDY 906

Query: 953  GLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVD---------------- 996
             L P +++E+ +EI+G L+ + +  +    LV+     +  +VD                
Sbjct: 907  SLDP-SLLESGSEIIGDLKLQSLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQ 965

Query: 997  ------QYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETVPD 1050
                  + D  +    ++R+ + G       L   RG   +++   ++   +        
Sbjct: 966  NAQQTFRIDRSKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSR 1025

Query: 1051 NVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFH 1110
                 V Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL TFH
Sbjct: 1026 LASRRVIQEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1111 FAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSD 1168
            FAGVAS  VT GVPR+KEI+N +K + TP + A L  D   D+  A++++  +E T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKS 1145

Query: 1169 VAFYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQASDVNIIGKD 1228
            V    +  Y  +     +  D   I +L   L  ++   ++ + S   ++      +  D
Sbjct: 1146 VTVASEIYYDPDPRSTAIPEDEEII-QLHFSLLDDETEKSLAQQSPWLLR------LELD 1198

Query: 1229 RIAINVFPEGYKAKSISTSAKEPSENDVFY------------RMQQLR------------ 1264
            R A+N   +      +    KE  +ND+F             R + +R            
Sbjct: 1199 RAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLETEAEE 1256

Query: 1265 ---------RALPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDV 1303
                       L ++ ++G+ +I R V+   D       G+ +      L  +G  L +V
Sbjct: 1257 DHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEV 1316

Query: 1304 MCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMT 1363
            M   GV  SR  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1317 MTVPGVDASRIYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMT 1376

Query: 1364 YKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSI 1423
             +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   I
Sbjct: 1377 TQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPI 1436

Query: 1424 GTGSFKVVKGTNISEKDLV 1442
            GTG+F V+    I E+ LV
Sbjct: 1437 GTGAFDVM----IDEESLV 1451

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1512 (33%), Positives = 773/1512 (51%), Gaps = 148/1512 (9%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE-- 117

Query: 120  KRQFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                 +EL R  +   D  RR      +   CK +   + C                   
Sbjct: 118  ----YNELMRQAIKIKDPKRR---FNAVWSLCKSK---MVCDTEVPSEDDPSKYISRGGC 167

Query: 177  XIIHDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKS 236
                 + R  G          VG WK+   ++ + ++  KR    L+  + LN+FK I  
Sbjct: 168  GNAQPSIRKDGLS-------LVGTWKKD-KNSEDSDQPEKRI---LSAEEILNVFKHITP 216

Query: 237  ADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
             D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDSLRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297  SLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    R
Sbjct: 274  INVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRAR 328

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 417  QELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNR 476
             +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNR
Sbjct: 389  TQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNR 446

Query: 477  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 536
            QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 537  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFD 591
            V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    
Sbjct: 507  VPQQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV---- 559

Query: 592  IPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGF 651
            IP P I+KP  LW+GKQ+ S+ I PN    + +    +   ++ PK          ++G 
Sbjct: 560  IPKPTILKPKPLWSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPK----------DNGM 605

Query: 652  VIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFS 711
            +II G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS
Sbjct: 606  LIIDG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFS 663

Query: 712  IGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLS 771
            IGI D    +   ++  E + +A  +  E+        L  + G    ++ E  +   L+
Sbjct: 664  IGIGDTIADEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLN 723

Query: 772  KVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRS 831
            + R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+
Sbjct: 724  EARDKAGRSAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRT 783

Query: 832  LPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMK 891
            LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K
Sbjct: 784  LPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVK 843

Query: 892  SLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNN 949
            +LED+   YD T R S   I+QF YG DG+D   +E  +       + +++  Y I   N
Sbjct: 844  ALEDIMVHYDGTTRNSLGNIIQFVYGEDGMDASHIEKQSIDTIPGSDLAFEKRYRIDLLN 903

Query: 950  QDKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVD------------- 996
             + GL P +++E+A EI+G L+ + +  +    LV+   L ++ ++D             
Sbjct: 904  PEYGLDP-SLLESATEIMGDLKLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNIRR 962

Query: 997  ---------QYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDET 1047
                     + D  +    ++++ + G      NL   RG   +L+   +    +     
Sbjct: 963  IIQNAQQTFRIDTTKPTDLTIKDVVLGVRKLQDNLLVLRGSSNILKEAQENAVTLFCSLV 1022

Query: 1048 VPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLK 1107
                    V   YR+++++ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL 
Sbjct: 1023 RSRLATRRVLTEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1108 TFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTL 1165
            TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  D   D+  A++++  +E T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAIEHTT 1142

Query: 1166 LSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQASDVNII 1225
            L  V    +  Y  + S   +  D   I   QL  ++ D        + LK Q+  +  +
Sbjct: 1143 LKSVTVSSEIYYDPDPSSTVIEEDEEII---QLHFSLMDEET----ENSLKHQSPWLLRL 1195

Query: 1226 GKDRIAINVFPEGYKAKSISTSAKEPSENDVFY------------RMQQLR--------- 1264
              DR A+N   +      +    KE  +ND+F             R + +R         
Sbjct: 1196 ELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEA 1253

Query: 1265 -------------RALPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYG 1299
                           L  + ++G+ DI+R V+   D       G+        L  +G  
Sbjct: 1254 EAEEDHMLKKIENTMLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVN 1313

Query: 1300 LRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLG 1359
            L +VM   GV  +R  TN  +++ +VLGIEA R ++ RE+   +++ G  V+ RH+ LL 
Sbjct: 1314 LSEVMTVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLV 1373

Query: 1360 DVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQ 1419
            DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ
Sbjct: 1374 DVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQ 1433

Query: 1420 TMSIGTGSFKVV 1431
               IGTG+F V+
Sbjct: 1434 MAPIGTGAFDVM 1445

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1514 (34%), Positives = 776/1514 (51%), Gaps = 147/1514 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ + S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK--RQF 123
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + IC +C  +LL E ++  RQ 
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQV 125

Query: 124  LHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            +        D+ +R      I   CK +  C                           T 
Sbjct: 126  MSI-----KDSKKR---FNAIWTLCKTKTVC---ETDVPSEDDPTQLISRGGCGNAQPTI 174

Query: 184  RWVGKKSAPEKDIWVGEWKEVLAHNP--ELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+  A N   E E+ V      LN  + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKDKATNDGDEPEQRV------LNTEEILNIFKHISVHDSNT 221

Query: 242  LGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            LG +      RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  LGFNEQF--ARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  +A Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L +L+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLV 392

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDIPPP 595
            +++P+S +P +   QD + G   ++ +D F +   L QLL+M+      DGI    IP P
Sbjct: 511  IVSPQSNKPCMGIVQDTLCGIRKLTLRDCFIE---LDQLLNMLYWVPDWDGI----IPTP 563

Query: 596  AIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDGFVI 653
            AI+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +I
Sbjct: 564  AIIKPVPLWSGKQILSIAI------PKGIHLQRFDEGTTMLSPK----------DNGMLI 607

Query: 654  IRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIG 713
            I G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS G
Sbjct: 608  IDG-QIIFGVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTG 665

Query: 714  INDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKV 773
            I D        ++  E +  A  K +E+        L  + G    ++ E  +   L++ 
Sbjct: 666  IGDTIADGGTMKEITETIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEA 725

Query: 774  REEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 833
            R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726  RDKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLP 785

Query: 834  HFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 893
            HF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786  HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 894  EDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQD 951
            ED+   YD+T R S   ++QF YG DG+D   +E  +       + +++  Y I   + +
Sbjct: 846  EDIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRYRIDLMSPN 905

Query: 952  KGLLPYAIMETANEILGPLEERLVRYDNSGCLVK----------------------REDL 989
              L P +++E+  EI G ++ + +       LV                       R  +
Sbjct: 906  HALDP-SLLESGLEITGDVKLQSILDTEYKQLVDDRRFLRNVFIDGEPNWHLPVNIRRII 964

Query: 990  NKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETVP 1049
              A+   + D  +    ++ E I   A    NL   RG   ++E    +   +       
Sbjct: 965  QNAQQTFRIDHTKPSDLTINEVIRDVARLQENLLVLRGKGKIIEEAQNDAITLFCCLVRS 1024

Query: 1050 DNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTF 1109
                  V Q YR+++++ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL TF
Sbjct: 1025 RLAVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTF 1084

Query: 1110 HFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLS 1167
            HFAGVAS  VT GVPR+KEI+N +K + TP     L  +   D+  A++++  +E T L 
Sbjct: 1085 HFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIEHTTLK 1144

Query: 1168 DVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL---TIED 1204
             V      +Y  D    V  ++   IQ+   L        ID      L+LEL    + D
Sbjct: 1145 SVTVASEIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDRAAMND 1204

Query: 1205 IAVAITRASKLKIQAS---DVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQ 1261
              + + +  + KI+ +   D+++I  +  A  +       +  S  A+  +E D  + ++
Sbjct: 1205 KDLTMVQVGE-KIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAETEAEED--HMLK 1261

Query: 1262 QLRRA-LPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDG 1308
            ++    L  + ++G+ DI R V+   D       G+ +      L  +G  L +VM   G
Sbjct: 1262 KIENTMLESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLMEVMTVPG 1321

Query: 1309 VIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1368
            V GSR  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 VDGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGL 1381

Query: 1369 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSF 1428
              +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F
Sbjct: 1382 TSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAF 1441

Query: 1429 KVVKGTNISEKDLV 1442
             V+    I E+ LV
Sbjct: 1442 DVM----IDEESLV 1451

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1721

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1499 (34%), Positives = 780/1499 (52%), Gaps = 136/1499 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK--RQF 123
            +C TC   ++ C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E ++  RQ 
Sbjct: 66   KCQTCQEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQV 125

Query: 124  LHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            +  ++ P     +R      +   CK +   + C                        T 
Sbjct: 126  M-AIKDPK----KRFNATWAL---CKTK---MVCETDVPSENDPTKLVSRGGCGNTQPTV 174

Query: 184  RWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
            R  G K        VG WK       E E   +R    L+  + LN+FK I + D   LG
Sbjct: 175  RKDGLK-------LVGSWKR--KKTIEGEEPEQRV---LSTEEILNIFKHISTEDFIRLG 222

Query: 244  IDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 223  FNEEF--SRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 279

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQG 362
              G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+G
Sbjct: 280  HNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 333

Query: 363  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVN 422
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L+ N
Sbjct: 334  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 393

Query: 423  GPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHR 482
            GPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH+
Sbjct: 394  GPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 451

Query: 483  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 542
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 452  MSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 511

Query: 543  TPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDIPPPAI 597
            +P+S +P +   QD + G  +++ +D+F +   L  +L+M+      DG+    IP PAI
Sbjct: 512  SPQSNKPCMGIVQDTLCGIRILTLRDTFLE---LDHVLNMLYWVPDWDGV----IPTPAI 564

Query: 598  MKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGS 657
            +KP  LWTGKQ+ S+ I    N   +   D    +  P           +++G +II G 
Sbjct: 565  LKPKPLWTGKQILSVAIP---NGIHLQRFDEGTTLLSP-----------KDNGMLIIDG- 609

Query: 658  QILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIND- 716
            QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D 
Sbjct: 610  QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDT 668

Query: 717  VTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREE 776
            +     +K+  E + E A  K +E+        L  + G    ++ E  +   L++ R++
Sbjct: 669  IADGATIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 727

Query: 777  VGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 728  AGRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFS 787

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 788  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 847

Query: 897  SCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQDKGL 954
               YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N    L
Sbjct: 848  MVHYDNTTRNSLGNVIQFIYGEDGIDASYIEKQSLDTIGGSDAAFEKKYRIDLMNVQNSL 907

Query: 955  LPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQ--------------YDA 1000
             P  ++E+ +EI G L+ + +  +    LVK     +  +VD                +A
Sbjct: 908  DP-TLLESGSEITGDLKLQTLLDEEYKQLVKDRAFLRNVFVDGESNWPLPVNIRRIIQNA 966

Query: 1001 ERDFY--HS------LREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETVPDNV 1052
            ++ F   HS      +R+ I+      + L   RG   ++E    +   +          
Sbjct: 967  QQTFRIDHSKPSDLTIRDIIDSVNELQSKLLVLRGKSEIIERAQTDAVTLFCCLVRSRLA 1026

Query: 1053 KTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFA 1112
               V + YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFA
Sbjct: 1027 TRRVLKEYRLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1086

Query: 1113 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVA 1170
            GVAS  VT GVPR+KEI+N +K + TP +   L +D  +D+  A++++  +E T L  V 
Sbjct: 1087 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVT 1146

Query: 1171 -----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL-----TIEDI 1205
                 +Y  D    V +++   IQ+   L       ++D+     L+LEL       +D+
Sbjct: 1147 VASEIYYDPDPRSTVIEEDEEIIQLHFSLLDDEMESSLDQQSPWLLRLELDRAAMNDKDL 1206

Query: 1206 AVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRR 1265
             +        +   +D+ +I  +  A  +       +  S  A+  +E D  + ++++  
Sbjct: 1207 TMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEED--HMLKKIEN 1264

Query: 1266 A-LPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDGVIGS 1312
              L ++ ++G+ +I R V+   D       G+ +      L  +G  L +VM   GV  +
Sbjct: 1265 TMLENITLRGVENIERVVMMKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPGVDAT 1324

Query: 1313 RTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGIT 1372
            R  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +  +T
Sbjct: 1325 RIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVT 1384

Query: 1373 RFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            R G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1385 RHGFNRSNTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAFDVM 1443

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1523 (33%), Positives = 782/1523 (51%), Gaps = 165/1523 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D  +R G +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDTKKRFGAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLA----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+  A      PEL          L+  + LN+FK I + D
Sbjct: 174  VRKDGLK-------LVGSWKKDRATGDADEPELRV--------LSTEEILNIFKHISAKD 218

Query: 239  CELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  SSSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDI 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    I
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFV 652
            P PAI+KP  LW+GKQV S+ I    N   +   D    +  P           +++G +
Sbjct: 561  PTPAIIKPKPLWSGKQVLSVAIP---NGIHLQRFDEGTTLLSP-----------KDNGML 606

Query: 653  IIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSI 712
            II G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS 
Sbjct: 607  IIDG-QIVFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFST 664

Query: 713  GINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSK 772
            GI D        ++  E +  A  K  ++        L  + G    ++ E  +   L++
Sbjct: 665  GIGDTIADGPTMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQ 950
            LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N 
Sbjct: 845  LEDIMVHYDNTTRNSLGNVIQFIYGEDGMDASHIEKQSLDTIGGSDAAFEKRYRIDLLNP 904

Query: 951  DKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQ------------- 997
            D  L P +++E+ +EILG L+ +++  +    LVK     +  +VD              
Sbjct: 905  DHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRSFLRHIFVDGEANWPLPVNIRRI 963

Query: 998  -YDAERDFY--H------SLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETV 1048
              +A++ F+  H      ++++ + G      NL   RG   +++   ++   +      
Sbjct: 964  IQNAQQTFHIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLLR 1023

Query: 1049 PDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKT 1108
                   V Q Y++++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL T
Sbjct: 1024 SRLASRRVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  +E T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTL 1143

Query: 1167 SDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLE------- 1199
              V      +Y  D    V  ++   IQ+   L       + D+     L+LE       
Sbjct: 1144 KSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMN 1203

Query: 1200 ---LTIEDIAVAITRASKLKI-----QASDVNIIGKDRIAINVFPEGYKAKSISTSAKEP 1251
               LT+  +   I +  K  +     + +D  +I + R+   V P+   A++      E 
Sbjct: 1204 DKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRV---VRPKSLDAET------EA 1254

Query: 1252 SENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRD------------DGKRELLVEGYG 1299
             E+ +  +++     L ++ ++G+ +I R V+   D            + +  L  +G  
Sbjct: 1255 EEDHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVN 1312

Query: 1300 LRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLG 1359
            L +VM   G+  +R  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL 
Sbjct: 1313 LSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLV 1372

Query: 1360 DVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQ 1419
            DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ
Sbjct: 1373 DVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQ 1432

Query: 1420 TMSIGTGSFKVVKGTNISEKDLV 1442
               IGTG+F V+    I E+ LV
Sbjct: 1433 MAPIGTGAFDVM----IDEESLV 1451

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1685

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1519 (34%), Positives = 779/1519 (51%), Gaps = 157/1519 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  +V   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK--RQF 123
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E ++  RQ 
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQV 125

Query: 124  LHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            L +++ P     +R      +   CK +   + C                        T 
Sbjct: 126  L-KIKDPK----KR---FNAVWSLCKTK---MICETDVPSENDPTQLISRGGCGNAQPTV 174

Query: 184  RWVGKKSAPEKDIWVGEWKE--VLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+    +   E E+ V      L   + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPEDSTK 221

Query: 242  LGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            LG D      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  LGFDEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 392

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSD--GIEHFDIPPPAIM 598
            +++P+S +P +   QD + G  +++ KD+F +   +  +L  + D  GI    IP PAI+
Sbjct: 511  IVSPQSNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPDWDGI----IPTPAIL 566

Query: 599  KPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDGFVIIRG 656
            KP  LWTGKQ+ S  I      P  I+L    +    + PK          ++G +II G
Sbjct: 567  KPKPLWTGKQILSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG 610

Query: 657  SQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIND 716
             QI+ GV+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS GI D
Sbjct: 611  -QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGD 668

Query: 717  VTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREE 776
                 +  ++  E +  A  K +E+        L  + G    ++ E  +   L++ R++
Sbjct: 669  TIANGETIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 777  VGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRLAEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFS 788

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 897  SCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQDKGL 954
               YD T R S   I+QF YG DG+D   +E  +       + +++  Y I     +  L
Sbjct: 849  MVHYDGTTRNSLGNIIQFIYGEDGIDASHIEKQSLDTIGGSDAAFEKRYRIDLLKVENSL 908

Query: 955  LPYAIMETANEILGPLEERLVRYDNSGCLVK----------------------REDLNKA 992
             P +++E+ +EI G L+ +++  +    LV+                      R  +  A
Sbjct: 909  DP-SLLESGSEITGDLKLQVLLDEEYRQLVEDRAFLRKVFTDGESNWPLPVNIRRIIQNA 967

Query: 993  EYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETVPDNV 1052
            +   + D  +    ++R+ I G       L   RG   +++   ++   +          
Sbjct: 968  QQTFRIDHSKPSDLTIRDIIKGVRELQEKLLVLRGKNEIVQQAQQDAITLFCCLVRSRLA 1027

Query: 1053 KTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFA 1112
               V Q YR++++S    +     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFA
Sbjct: 1028 TRRVIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1113 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVA 1170
            GVAS  VT GVPR+KEI+N +K + TP +   L      D+  A+ ++  +E T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVT 1147

Query: 1171 -----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLE----------L 1200
                 +Y  D    V +D+   IQ+   L       ++D+     L+LE          L
Sbjct: 1148 VASEIYYDPDPRSTVIEDDEEIIQLHFSLLDEEMEASLDQQSPWLLRLELDRAAMNDKDL 1207

Query: 1201 TIEDIAVAITRASK--LKIQASDVN---IIGKDRIAINVFPEGYKAKSISTSAKEPSEND 1255
            T+  +   I    K  L +  S+ N   +I + R+   V P+G  A++      E  E+ 
Sbjct: 1208 TMGQVGERIKETFKKDLFVIWSEDNAEKLIIRCRV---VRPKGLDAET------EAEEDH 1258

Query: 1256 VFYRMQQLRRALPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDV 1303
            +  +++     L ++ ++G+ +I R V+   D       G+ +      L  +G  L +V
Sbjct: 1259 MLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVNLAEV 1316

Query: 1304 MCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMT 1363
            M   GV  +R  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1317 MTIPGVDTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMT 1376

Query: 1364 YKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSI 1423
             +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   I
Sbjct: 1377 CQGGLTSVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPI 1436

Query: 1424 GTGSFKVVKGTNISEKDLV 1442
            GTG+F    G  I E+ LV
Sbjct: 1437 GTGAF----GVMIDEESLV 1451

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1523 (33%), Positives = 782/1523 (51%), Gaps = 165/1523 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLA----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+  A      PEL          L+  + LN+FK I   D
Sbjct: 174  IRKDGLK-------LVGSWKKDRATGDADEPELRV--------LSTEEILNIFKHISVKD 218

Query: 239  CELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDI 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    I
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFV 652
            P PAI+KP  LW+GKQ+ S+ I    N   +   D    +  P           +++G +
Sbjct: 561  PTPAIIKPKPLWSGKQILSVAIP---NGIHLQRFDEGTTLLSP-----------KDNGML 606

Query: 653  IIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSI 712
            II G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS 
Sbjct: 607  IIDG-QIIFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFST 664

Query: 713  GINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSK 772
            GI D        ++  E +  A  K  ++        L  + G    ++ E  +   L++
Sbjct: 665  GIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQ 950
            LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y +   N 
Sbjct: 845  LEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNT 904

Query: 951  DKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQ------------- 997
            D  L P +++E+ +EILG L+ +++  +    LVK     +  +VD              
Sbjct: 905  DHTLDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRI 963

Query: 998  -YDAERDFY--H------SLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETV 1048
              +A++ F+  H      ++++ + G      NL   RG   +++   ++   +      
Sbjct: 964  IQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLR 1023

Query: 1049 PDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKT 1108
                   V Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL T
Sbjct: 1024 SRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTL 1143

Query: 1167 SDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLE------- 1199
              V      +Y  D    V  ++   IQ+   L       + D+     L+LE       
Sbjct: 1144 KSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMN 1203

Query: 1200 ---LTIEDIAVAITRASKLKI-----QASDVNIIGKDRIAINVFPEGYKAKSISTSAKEP 1251
               LT+  +   I +  K  +     + +D  +I + R+   V P+   A++      E 
Sbjct: 1204 DKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRV---VRPKSLDAET------EA 1254

Query: 1252 SENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRD------------DGKRELLVEGYG 1299
             E+ +  +++     L ++ ++G+ +I R V+   D            + +  L  +G  
Sbjct: 1255 EEDHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVN 1312

Query: 1300 LRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLG 1359
            L +VM   G+  +R  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL 
Sbjct: 1313 LSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLV 1372

Query: 1360 DVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQ 1419
            DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ
Sbjct: 1373 DVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQ 1432

Query: 1420 TMSIGTGSFKVVKGTNISEKDLV 1442
               IGTG+F V+    I E+ LV
Sbjct: 1433 MAPIGTGAFDVM----IDEESLV 1451

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
            YDL140C (REAL)
          Length = 1719

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1524 (33%), Positives = 784/1524 (51%), Gaps = 167/1524 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLA----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+  A      PEL          L+  + LN+FK I   D
Sbjct: 174  VRKDGLK-------LVGSWKKDRASGDAEEPELRV--------LSTEEILNIFKHISVKD 218

Query: 239  CELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDI 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    I
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFV 652
            P PAI+KP  LW+GKQ+ S+ I    N   +   D    +  P           +++G +
Sbjct: 561  PTPAIIKPKPLWSGKQILSVAIP---NGIHLQRFDEGTTLLSP-----------KDNGML 606

Query: 653  IIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSI 712
            II G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS 
Sbjct: 607  IIDG-QIIFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFST 664

Query: 713  GINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSK 772
            GI D        ++  E +  A  K  ++        L  + G    ++ E  +   L++
Sbjct: 665  GIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQ 950
            LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N 
Sbjct: 845  LEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLLNT 904

Query: 951  DKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQ------------- 997
            +  L P +++E+ +EILG L+ +++  +    LVK     +  +VD              
Sbjct: 905  EHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRI 963

Query: 998  -YDAERDFY--HSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDET------V 1048
              +A++ F+  H+    +  K   L  ++  +G L +L    + +Q    D        +
Sbjct: 964  IQNAQQTFHIDHTKPSDLTIKDIVLG-VKDLQGSLLVLRGKNEIIQNAQRDAVTLFCCLL 1022

Query: 1049 PDNVKT-SVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLK 1107
               + T  V Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL 
Sbjct: 1023 RSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1108 TFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKTL 1165
            TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTT 1142

Query: 1166 LSDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLE------ 1199
            L  V      +Y  D    V  ++   IQ+   L       + D+     L+LE      
Sbjct: 1143 LKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAM 1202

Query: 1200 ----LTIEDIAVAITRASKLKI-----QASDVNIIGKDRIAINVFPEGYKAKSISTSAKE 1250
                LT+  +   I +  K  +     + +D  +I + R+   V P+   A++      E
Sbjct: 1203 NDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRV---VRPKSLDAET------E 1253

Query: 1251 PSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRD------------DGKRELLVEGY 1298
              E+ +  +++     L ++ ++G+ +I R V+   D            + +  L  +G 
Sbjct: 1254 AEEDHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGV 1311

Query: 1299 GLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLL 1358
             L +VM   G+  +R  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL
Sbjct: 1312 NLSEVMTVPGIDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALL 1371

Query: 1359 GDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILG 1418
             DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILG
Sbjct: 1372 VDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILG 1431

Query: 1419 QTMSIGTGSFKVVKGTNISEKDLV 1442
            Q   IGTG+F V+    I E+ LV
Sbjct: 1432 QMAPIGTGAFDVM----IDEESLV 1451

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/1504 (33%), Positives = 781/1504 (51%), Gaps = 132/1504 (8%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M +   S  P R IK ++F   S  ++   S  ++   +  D  + +A K  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRGISVAKIEFPETMDESQMKA-KIGGLNDPRLG 59

Query: 60   VSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +A C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E +
Sbjct: 60   SIDRNYKCQTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDEYN 119

Query: 120  K--RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXX 177
            +  RQ + +++ P     RR   +  +   CK +   + C                    
Sbjct: 120  EQMRQAI-KIKDPK----RRFNAVWTL---CKAK---MVCETEVPSPDDPTVFLSRGGCG 168

Query: 178  IIHDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSA 237
             I  + R  G          VG WK+   +  + ++  KR    ++  + LN+FK I   
Sbjct: 169  HIQPSIRKDGLS-------LVGTWKKD-KNADDSDQPEKRI---ISAEEILNVFKHISPE 217

Query: 238  DCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSS 297
            D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  + 
Sbjct: 218  DGWRLGFNEDF--SRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANI 274

Query: 298  LIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRL 357
             ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    RL
Sbjct: 275  NVQKLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDI 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DGI    I
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGI----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFV 652
            P PAI+KP  LW+GKQV S+ I PN    + +        F+ PK          ++G +
Sbjct: 561  PTPAILKPVPLWSGKQVLSMAI-PNG---IHLQRFDDGTTFLSPK----------DNGML 606

Query: 653  IIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSI 712
            II G +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFSI
Sbjct: 607  IIDG-KIIFGVVDKKTVGSSSG-GLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFSI 664

Query: 713  GINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSK 772
            GI D    +   ++  E + +A  K +++        L  + G    ++ E  +   L++
Sbjct: 665  GIGDTIADEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQ 950
            LED+   YD T R S   ++QF YG DG+D   +E  +       + +++  Y I   N+
Sbjct: 845  LEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQSIDTIPGSDSAFERRYRIDLLNE 904

Query: 951  DKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVD-------------- 996
            +  L P +++E+ +EI+G  + +L+  D    LV    + +  +VD              
Sbjct: 905  EYALDP-SLLESGSEIIGDSKLQLLLNDEYKQLVDDRQILRRVFVDGEHNWPLPVNIKRI 963

Query: 997  --------QYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETV 1048
                    + D  +    ++ + I+G       L   RG   +L+   +    +      
Sbjct: 964  IQNSQQTFRIDQTKPTDLTIEDVISGVRKLQEKLLVVRGKSDILKEAQQNAITLFCCLLR 1023

Query: 1049 PDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKT 1108
                   V + YR++ ++    L     ++ ++ + PG  +G + AQSIGEP TQMTL T
Sbjct: 1024 SRLATRRVIEEYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K + TP +   L  +   D+  A+ ++  +E T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIRSAIEHTTL 1143

Query: 1167 SDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL-----T 1201
              V      +Y  D    V +D+   IQ+   L       ++D      L+LEL     T
Sbjct: 1144 KSVTVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLLRLELDRAAMT 1203

Query: 1202 IEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSIST--SAKEPSENDVFYR 1259
             +D+ +        +   +D+ +I  +  A  +       +   T  +  E  E+ +  +
Sbjct: 1204 DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVIRDPKTLDADVEAEEDHMLKK 1263

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMCTD 1307
            ++     L  + ++G+ DI+R V+   D       G+        L  +G  L +VM   
Sbjct: 1264 IEN--SMLEKITLRGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDGVNLSEVMTVS 1321

Query: 1308 GVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGE 1367
            GV GSR  TN  +++ +VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1322 GVDGSRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGF 1381

Query: 1368 VLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGS 1427
            ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+
Sbjct: 1382 LMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAPIGTGA 1441

Query: 1428 FKVV 1431
            F V+
Sbjct: 1442 FDVM 1445

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1532 (33%), Positives = 789/1532 (51%), Gaps = 170/1532 (11%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M E   S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIGY     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEHS 119

Query: 120  KRQFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                  EL R  +   D  RR      +   CK +  C                      
Sbjct: 120  ------ELMRQAIKIKDPKRR---FNAVWSLCKAKMVC------------------ETEV 152

Query: 177  XIIHDTFRWVGK------KSAPEKD--IWVGEWKEVLAHNP--ELERYVKRCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK+    +   + ER V      ++  +
Sbjct: 153  PSDNDPAQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRV------ISADE 206

Query: 227  TLNLFKQIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK I   D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGG 345
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S     
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 346  KVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYP 405
              +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 406  EKVTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERH 465
            E VT YN  +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 466  LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 526  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS- 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F +   L Q+L+M+  
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLYW 552

Query: 585  ----DGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKS 638
                DG+    IP P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK 
Sbjct: 553  IPDWDGV----IPTPIILKPKPLWSGKQILSIAI------PSGIHLQRFDEGTTLLSPK- 601

Query: 639  KSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMA 698
                     ++G +II G QI+ GV+DK  +G      + + + R+ GP+  A   + + 
Sbjct: 602  ---------DNGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQ 650

Query: 699  KLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNE 758
            K+   +L + GFSIGI D    +   ++  E + +A  K +E+        L  + G   
Sbjct: 651  KVVNFWLLHNGFSIGIGDTIADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTL 710

Query: 759  EQTLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQII 818
             ++ E  +   L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ +
Sbjct: 711  RESFEDSVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSV 770

Query: 819  SGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVK 878
             G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVK
Sbjct: 771  EGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVK 830

Query: 879  TAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRS 938
            TAETGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++   S
Sbjct: 831  TAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIAS 888

Query: 939  WDHAYNITFN----NQDKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEY 994
             D A+   F     N    L P +++E+ +EI+G L+ + +  +    LV+  +  +  +
Sbjct: 889  SDAAFERRFRIDLLNPRHALDP-SLLESGSEIIGDLKLQALLDEEFKQLVEDREFLRKIF 947

Query: 995  VD----------------------QYDAERDFYHSLREYINGKATALANLRKSRGMLGLL 1032
            VD                      + D  +    ++R+ + G       L   RG   +L
Sbjct: 948  VDGEQNWPLPVNIRRIIQNAQQTFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKIL 1007

Query: 1033 EPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAI 1092
            +   +    +             V Q YR+++++    L     ++ ++ + PG  +G +
Sbjct: 1008 QEAQQNAVTLFCCLLRSRLATRRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVL 1067

Query: 1093 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--D 1150
             AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  D+  D
Sbjct: 1068 AAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAAD 1127

Query: 1151 ERAARVVKGRVEKTLLSDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK 1195
            +  A++++  +E T L  +      +Y  D    V +++   IQ+   L       ++D 
Sbjct: 1128 QEKAKLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEEDEEIIQLHFSLMDEETEQSLDY 1187

Query: 1196 -----LQLEL---TIEDIAVAITRASKLKIQAS---DVNIIGKDRIAINVFPEGYKAKSI 1244
                 L+LEL    + D  + + +  + KI+ +   D+ +I  +  A  +       +  
Sbjct: 1188 QSPWLLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAEKLIIRCRVVRDP 1246

Query: 1245 ST--SAKEPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRD------DGKRE---- 1292
             T  +  E  E+ +  R++     L  + ++G+ DI+R V+   D       G+      
Sbjct: 1247 KTLDAEAEAEEDHMLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPE 1304

Query: 1293 --LLVEGYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSV 1350
              L  +G  L +VMC  GV  +R  TN  +++ +VLGIEA R ++ +E+   +++ G  V
Sbjct: 1305 WVLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYV 1364

Query: 1351 DPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEG 1410
            + RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   G
Sbjct: 1365 NYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRG 1424

Query: 1411 VSECIILGQTMSIGTGSFKVVKGTNISEKDLV 1442
            VSE ++LGQ   IGTG+F V+    I E+ LV
Sbjct: 1425 VSENVLLGQVAPIGTGAFDVM----IDEESLV 1452

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1525 (33%), Positives = 783/1525 (51%), Gaps = 169/1525 (11%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLAH----NPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+  A      PEL          L+  + LN+FK I   D
Sbjct: 174  VRKDGLK-------LVGSWKKDRASGDADEPELRV--------LSTEEILNIFKHISVED 218

Query: 239  CELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDI 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    I
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDG 650
            P PAI+KP  LW+GKQV S  I      P  I+L    +    + PK          ++G
Sbjct: 561  PTPAIIKPKPLWSGKQVLSAAI------PSGIHLQRFDEGTTLLSPK----------DNG 604

Query: 651  FVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGF 710
             +II G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GF
Sbjct: 605  MLIIDG-QIVFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGF 662

Query: 711  SIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLL 770
            S GI D        ++  E +  A  K  ++        L  + G    ++ E  +   L
Sbjct: 663  STGIGDTIADGPTMREITETIAEAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFL 722

Query: 771  SKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDR 830
            ++ R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 723  NEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDR 782

Query: 831  SLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLM 890
            +LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783  TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 891  KSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFN 948
            K+LED+   YDNT R S   ++QF YG DG+D   +E  +       +++++  Y I   
Sbjct: 843  KALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDKAFEKRYRIDLL 902

Query: 949  NQDKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQ----------- 997
            N +  L P +++E+ +EILG L+ +++  +    LVK     +  +VD            
Sbjct: 903  NPEHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPMPVNIR 961

Query: 998  ---YDAERDFY--HS------LREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDE 1046
                +A++ F+  H+      ++E + G      NL   RG   +++   ++   +    
Sbjct: 962  RIIQNAQQTFHIDHTRPSDLTIKEIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCL 1021

Query: 1047 TVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTL 1106
                     + Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL
Sbjct: 1022 FRSRLATRRILQEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1107 KTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKT 1164
             TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHT 1141

Query: 1165 LLSDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLE----- 1199
             L  V      +Y  D    V  ++   IQ+   L       + D+     L+LE     
Sbjct: 1142 TLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAA 1201

Query: 1200 -----LTIEDIAVAITRASKLKI-----QASDVNIIGKDRIAINVFPEGYKAKSISTSAK 1249
                 LT+  +   I +  K  +     + +D  +I + R+   V P+   A++      
Sbjct: 1202 MNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRV---VRPKSLDAET------ 1252

Query: 1250 EPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRD------------DGKRELLVEG 1297
            E  E+ +  +++     L ++ ++G+ +I R V+   D            + +  L  +G
Sbjct: 1253 EAEEDHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDG 1310

Query: 1298 YGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQL 1357
              L +VM   G+  +R  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ L
Sbjct: 1311 VNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMAL 1370

Query: 1358 LGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIIL 1417
            L DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +IL
Sbjct: 1371 LVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVIL 1430

Query: 1418 GQTMSIGTGSFKVVKGTNISEKDLV 1442
            GQ   IGTG+F V+    I E+ LV
Sbjct: 1431 GQMAPIGTGAFDVM----IDEESLV 1451

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1536 (33%), Positives = 774/1536 (50%), Gaps = 178/1536 (11%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M E   S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIGY     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEHS 119

Query: 120  KRQFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                  EL +  +   D  RR      +   CK +  C                      
Sbjct: 120  ------ELMKQAIKIKDPKRR---FNAVWSLCKVKMVC------------------ETEV 152

Query: 177  XIIHDTFRWVGK------KSAPEKD--IWVGEWKEVLAHNP--ELERYVKRCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK+    +   + ER +      ++  +
Sbjct: 153  PSDNDPSQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRI------ISADE 206

Query: 227  TLNLFKQIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK I   D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGG 345
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S     
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 346  KVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYP 405
              +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 406  EKVTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERH 465
            E VT YN  +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 466  LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 526  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS- 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F +   L Q+L+M+  
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LEQVLNMLYW 552

Query: 585  ----DGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKS 638
                DG+    IP P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK 
Sbjct: 553  IPDWDGV----IPTPIILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPK- 601

Query: 639  KSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMA 698
                     ++G +II G QI+ GV+DK  +G      + + + R+ GP+  A   + + 
Sbjct: 602  ---------DNGMLIIDG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPKICARLFSNLQ 650

Query: 699  KLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNE 758
            K+   +L + GFSIGI D    +   ++  + + +A  K +E+        L  + G   
Sbjct: 651  KVVNYWLLHNGFSIGIGDTIADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTL 710

Query: 759  EQTLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQII 818
             ++ E  +   L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ +
Sbjct: 711  RESFEDNVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSV 770

Query: 819  SGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVK 878
             G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVK
Sbjct: 771  EGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVK 830

Query: 879  TAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNA--QPVNFN 936
            TAETGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E  A       +
Sbjct: 831  TAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQAIDTIACSD 890

Query: 937  RSWDHAYNITFNNQDKGLLPYAIMETANEILGPL-------EERLVRYDNSGCLVK---- 985
             +++  + I   N    L P +++E+ +EI+G L       EE     ++   L K    
Sbjct: 891  AAFERRFKIDLLNPKHALDP-SLLESGSEIIGDLKLQALLDEEFKQLSEDRQFLRKIFVD 949

Query: 986  -----------REDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEP 1034
                       R  +  A+   + D  +    S+R+ I G       L   RG   +L+ 
Sbjct: 950  GEQNWPLPVNIRRIIQNAQQTFRIDHTKPTDLSIRDVIYGVKELQEKLLVLRGKSKILQE 1009

Query: 1035 PAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGA 1094
                   +             V Q YR+++++    L     ++ ++ + PG  +G + A
Sbjct: 1010 AQVNAVTLFCCLLRSRLASRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAA 1069

Query: 1095 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--DER 1152
            QSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  ++  D+ 
Sbjct: 1070 QSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQE 1129

Query: 1153 AARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRA 1212
             A++++  +E T L  +     ++Y D      V  D   I +L   L  E+   ++   
Sbjct: 1130 KAKLIRSAIEHTTLKSITV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDYQ 1188

Query: 1213 SKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQ---------- 1262
            S   ++      +  DR A+N   +      +    KE  +ND+F    +          
Sbjct: 1189 SPWLLR------LELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLVIRC 1240

Query: 1263 --------------------LRR----ALPDVVVKGLPDISRAVINIRDDG--------- 1289
                                L+R     L  + ++G+ DI+R V+   D           
Sbjct: 1241 RVVRDPKTLDAEAEAEEDHMLKRIENTMLESITLRGVEDITRVVMMKYDRKVPSPAGDYH 1300

Query: 1290 ---KRELLVEGYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNH 1346
               +  L  +G  L +VMC  GV  +R  TN  +++ +VLGIEA R ++ +E+   +++ 
Sbjct: 1301 KIPEWVLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASD 1360

Query: 1347 GMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKD 1406
            G  V+ RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D
Sbjct: 1361 GSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELD 1420

Query: 1407 AVEGVSECIILGQTMSIGTGSFKVVKGTNISEKDLV 1442
               GVSE ++LGQ   IGTG+F V+    I E+ LV
Sbjct: 1421 DCRGVSENVLLGQVAPIGTGAFDVM----IDEESLV 1452

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL140C
            (RPO21)
          Length = 1745

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1513 (33%), Positives = 766/1513 (50%), Gaps = 150/1513 (9%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE-- 117

Query: 120  KRQFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                 +EL R  +   D  RR      +   CK +   + C                   
Sbjct: 118  ----YNELMRQAIKIKDPKRR---FNAVWSLCKAK---MVCDTEVPSEDDPSKYISRGGC 167

Query: 177  XIIHDTFRWVGKKSAPEKDIWVGEWKEVL----AHNPELERYVKRCMDDLNPLKTLNLFK 232
                 + R  G          VG WK+      A  PE     KR    ++  + LN+FK
Sbjct: 168  GNAQPSIRKDGLS-------LVGTWKKDKNAEDADQPE-----KRI---ISAEEILNVFK 212

Query: 233  QIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEI 292
             I   D   LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I
Sbjct: 213  HISPEDSWRLGFNEDF--SRPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDI 269

Query: 293  VWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRG 352
            +  +  ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+ 
Sbjct: 270  LKANINVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKS 324

Query: 353  FCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN 412
               RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN
Sbjct: 325  IRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYN 384

Query: 413  RHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVV 472
              +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D V
Sbjct: 385  IDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPV 442

Query: 473  LFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
            LFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE  
Sbjct: 443  LFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELS 502

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGI 587
             L  V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+
Sbjct: 503  QLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV 559

Query: 588  EHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEM 645
                IP P I+KP  LW+GKQ+ S+ I      P  I+L    +   ++ PK        
Sbjct: 560  ----IPTPTILKPKPLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSPK-------- 601

Query: 646  SQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFL 705
              ++G +II G QI+ GV+DK  +G      + + + R+ GP+  A     + K+   +L
Sbjct: 602  --DNGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWL 657

Query: 706  GNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAK 765
             + GFSIGI D    +   ++  + + +A  K +E+        L  + G    ++ E  
Sbjct: 658  LHNGFSIGIGDTIADEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDN 717

Query: 766  IGGLLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPD 825
            +   L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  
Sbjct: 718  VVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAF 777

Query: 826  GFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYM 885
            GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+
Sbjct: 778  GFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYI 837

Query: 886  SRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAY 943
             RRL+K+LED+   YD T R S   I+QF YG DG+D   +E  +       + +++  Y
Sbjct: 838  QRRLVKALEDIMVHYDGTTRNSLGNIIQFVYGEDGMDAAHIEKQSIDTIPGSDLAFEKRY 897

Query: 944  NITFNNQDKGLLPYAIMETANEILGPLEERLVRYDNSGCLVK------------------ 985
             I   N +  L P  ++E+  EI+G L+ + +  +    LV+                  
Sbjct: 898  RIDLLNPNYALDP-NLLESGTEIVGDLKLQNLLDEEYKQLVQDRHFLRKIFMDGEHNWPL 956

Query: 986  ----REDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQG 1041
                R  +  A+   + D+ +    S+++ + G       L   RG   +L+   +    
Sbjct: 957  PVNIRRIIQNAQQTFRIDSTKPTDLSIQDVVQGVRGLQERLLVLRGKSQILQEAQENAIT 1016

Query: 1042 IDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPG 1101
            +             V   YR+++++    L     ++ ++ + PG  +G + AQSIGEP 
Sbjct: 1017 LFCCLLRSRLATRRVITEYRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPA 1076

Query: 1102 TQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKG 1159
            TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L      D+  A++++ 
Sbjct: 1077 TQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRS 1136

Query: 1160 RVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASK--LKI 1217
             +E T L  V    +  Y  + S   +  D   I +L   L  E+   ++   S   L++
Sbjct: 1137 AIEHTTLKSVPVASEIYYDPDPSSTVIEEDEEII-QLHFSLMDEETEASLKHQSPWLLRL 1195

Query: 1218 QASDVNIIGKDRIAINV---FPEGYK------------------------AKSISTSAKE 1250
            +   V +  KD     V     E +K                         K++   A E
Sbjct: 1196 ELDRVAMTDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEA-E 1254

Query: 1251 PSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGY 1298
              E+ +  +++     L  + ++G+ DI+R V+   D       G+        L  +G 
Sbjct: 1255 AEEDHMLKKIENT--MLESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGV 1312

Query: 1299 GLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLL 1358
             L +VM   GV  +R  TN  +++ +VLGIEA R ++ +E+   +++ G  V+ RH+ LL
Sbjct: 1313 NLSEVMSVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALL 1372

Query: 1359 GDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILG 1418
             DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILG
Sbjct: 1373 VDVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILG 1432

Query: 1419 QTMSIGTGSFKVV 1431
            Q   IGTGSF V+
Sbjct: 1433 QMAPIGTGSFDVM 1445

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
            Anc_7.314
          Length = 1729

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1518 (33%), Positives = 780/1518 (51%), Gaps = 155/1518 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
            +C TC   +  C GHFGH+ LA PV H+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            E  R  +   D+ +R      + + CK +   + C                        T
Sbjct: 120  EQMRQAIAIKDSKKR---FNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLAHNP--ELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
             R  G K        VG WK+    N   E E+ V      L+  + LN+FK I   D  
Sbjct: 174  VRKDGLK-------LVGSWKKEKNTNDGDEPEQRV------LSTEEILNIFKHISPEDST 220

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221  RLGFNEEF--ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359
                 G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKG
Sbjct: 278  TLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKG 331

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL 419
            K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L
Sbjct: 332  KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 391

Query: 420  IVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPS 479
            + NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPS
Sbjct: 392  VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPS 449

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450  LHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 509

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSD--GIEHFDIPPPAI 597
             +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D  G+    IP PAI
Sbjct: 510  QIVSAQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV----IPTPAI 565

Query: 598  MKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDGFVIIR 655
            +KP  LW+GKQV S+ I      P  I+L    +    + PK          ++G +++ 
Sbjct: 566  IKPKPLWSGKQVLSIAI------PRGIHLQRFDEGTTLLSPK----------DNGMLVVD 609

Query: 656  GSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIN 715
            G QI+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI 
Sbjct: 610  G-QIIFGVVDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIG 667

Query: 716  DVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVRE 775
            D        ++  E +  A  K +++        L  + G    ++ E  +   L++ R+
Sbjct: 668  DTIADGSTIKEITETIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARD 727

Query: 776  EVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 835
            + G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728  KAGRLAEMNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHF 787

Query: 836  PKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 895
             K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788  SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 896  LSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQDKG 953
            +   YD T R S   ++QF YG DG+D   +E  +       + +++  Y I   N    
Sbjct: 848  IMVHYDGTARNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLMNPKNA 907

Query: 954  LLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQ--------------YD 999
            L P +++E+ +EI G ++ + +  +    L+K     +  +VD                +
Sbjct: 908  LDP-SLLESGSEITGDVKLQSLLDEEYKQLIKDRKFLRKIFVDGESNWPLPVNIRRIIQN 966

Query: 1000 AERDFY--HS------LREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDET---- 1047
            A++ F   HS      +R+ I G       L+     L +L   ++ +Q    D      
Sbjct: 967  AQQTFRIDHSKPSDLTIRDIIFG-------LKDLEERLLVLRGKSEIIQKAQDDAITLFC 1019

Query: 1048 --VPDNVKT-SVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQM 1104
              V   + T  + Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQM
Sbjct: 1020 CLVRSRLSTRRILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQM 1079

Query: 1105 TLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVE 1162
            TL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L +D  +D+  A+ ++  +E
Sbjct: 1080 TLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIE 1139

Query: 1163 KTLLSDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL-- 1200
             T L  +      +Y  D    V  ++   IQ+   L       ++D+     L+LEL  
Sbjct: 1140 HTTLKSITVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELDR 1199

Query: 1201 ---TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVF 1257
                 +D+ +        +   +D+ +I  +  A  +       +  S  A+  +E D  
Sbjct: 1200 AAMNDKDLTMGQVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEAEED-- 1257

Query: 1258 YRMQQLRRA-LPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVM 1304
            + ++++    L ++ ++G+ +I R V+   D       G+ +      L  +G  L +VM
Sbjct: 1258 HMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVM 1317

Query: 1305 CTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTY 1364
               GV  +R  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT 
Sbjct: 1318 TVPGVDATRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTT 1377

Query: 1365 KGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIG 1424
            +G +  ITR G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   IG
Sbjct: 1378 QGALTSITRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIG 1437

Query: 1425 TGSFKVVKGTNISEKDLV 1442
            TG+F V+    I E+ LV
Sbjct: 1438 TGAFDVM----IDEESLV 1451

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
            YDL140C
          Length = 1726

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1517 (33%), Positives = 768/1517 (50%), Gaps = 153/1517 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R IK ++F   S  +I A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK--RQF 123
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + IC +C  +LL E ++  RQ 
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQMRQI 125

Query: 124  LHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            L +++    D+ +R      I   CK +   + C                        T 
Sbjct: 126  L-KIK----DSKKR---FNAIWSLCKTK---MICDTDVPSEHDPTQLVSRGGCGNAQPTV 174

Query: 184  RWVGKKSAPEKDIWVGEWKEV--LAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+    +   E E+ +      L+  + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKEKNTSDGDEPEQRI------LSTEEILNIFKHISPEDSIA 221

Query: 242  LGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            +G +      RPE      LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  MGFNEEF--SRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHLV 392

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSD--GIEHFDIPPPAIM 598
            +++ +S +P +   QD + G   ++ +D+F +   +  LL  + D  G+    IP PAI+
Sbjct: 511  IVSAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV----IPTPAIL 566

Query: 599  KPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDGFVIIRG 656
            KP  LW+GKQ+ S+ I      P  I+L    +   F+ PK          ++G +II G
Sbjct: 567  KPKPLWSGKQILSIAI------PKGIHLQRFDEGTTFLSPK----------DNGMLIIDG 610

Query: 657  SQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIND 716
             QI+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D
Sbjct: 611  -QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIGD 668

Query: 717  VTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREE 776
                 +  ++    +  A  K +E+        L  + G    ++ E  +   L++ R++
Sbjct: 669  TIADGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 777  VGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFS 788

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 897  SCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQDKGL 954
               YD+T R S   ++QF YG DG+D   +E  +       + +++  Y I   N +  L
Sbjct: 849  MVHYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRYRIDLLNTENSL 908

Query: 955  LPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYING 1014
             P +++E+  EI G L+ + +       LVK     +  +VD         +  R   N 
Sbjct: 909  NP-SLLESGAEISGNLKLQNLLDVEYKQLVKDRTFLRTVFVDGEPNWPLPVNIKRIVQNA 967

Query: 1015 KATALANLRKSRGM---------------LGLLEPPAKELQGIDPDET------VPDNVK 1053
            + T   +  K   +               L +L   ++ +Q    D T      +   + 
Sbjct: 968  QQTFKVDHSKPSDLTIPDIVHGVQDLQEKLLVLRDKSEIMQKAQSDATTLFCCLIRSRLA 1027

Query: 1054 T-SVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFA 1112
            T  V Q ++++++S +  L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFA
Sbjct: 1028 TRRVLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1113 GVASMNVTLGVPRIKEIINASKVISTPIINAVL--VNDNDERAARVVKGRVEKTLLSDVA 1170
            GVAS  VT GVPR+KEI+N +K + TP + A L      D+  A++++  +E T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVT 1147

Query: 1171 FYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQASDVNIIGKDRI 1230
                ++Y D      V  +   I +L   L  E+   ++ + S   ++      +  DR 
Sbjct: 1148 V-ASEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLR------LELDRA 1200

Query: 1231 AINVFPEGYKAKSISTSAKEPSENDVFY------------RMQQLR-------------- 1264
            A+N   +      +    +E   ND+F             R + +R              
Sbjct: 1201 AMN--DKDLTMGQVGEKIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDH 1258

Query: 1265 -------RALPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMC 1305
                     L ++ ++G+ +I R V+   D       G  E      L  +G  L +VM 
Sbjct: 1259 MLKKIENTMLENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMT 1318

Query: 1306 TDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYK 1365
              GV  SR  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT  
Sbjct: 1319 VPGVDASRIYTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTN 1378

Query: 1366 GEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGT 1425
            G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGT
Sbjct: 1379 GSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGT 1438

Query: 1426 GSFKVVKGTNISEKDLV 1442
            GSF V+    I E+ LV
Sbjct: 1439 GSFDVM----IDEESLV 1451

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1520 (33%), Positives = 777/1520 (51%), Gaps = 159/1520 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  +I A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK--RQF 123
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL E ++  RQ 
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHNEQMRQA 125

Query: 124  LHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            + +++ P     +R      +   CK +   + C                        T 
Sbjct: 126  I-QIKDPK----KR---FNAVWSLCKTK---MVCETDVPSEDDPTKLISRGGCGNTQPTI 174

Query: 184  RWVGKKSAPEKDIWVGEWKE--VLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+        E E+ V      L+  + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKDKSTGDADEPEQRV------LSTEEILNIFKHISPEDSYR 221

Query: 242  LGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  LGFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAVEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLV 392

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDIPPP 595
            +++P+S +P +   QD + G   ++ +D+F +     Q+L+M+      DG+    IP P
Sbjct: 511  IVSPQSNKPCMGIVQDTLCGIRKLTLRDTFLE---FDQVLNMLYWVPDWDGV----IPTP 563

Query: 596  AIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDGFVI 653
            AI+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G ++
Sbjct: 564  AIIKPKPLWSGKQILSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLV 607

Query: 654  IRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIG 713
            I G +I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS G
Sbjct: 608  IDG-EIIFGVVDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTG 665

Query: 714  INDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKV 773
            I D        ++  E +  A  K + +        L  + G    ++ E  +   L++ 
Sbjct: 666  IGDTVADGQTMREISETIAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEA 725

Query: 774  REEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 833
            R+  G +    L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726  RDRAGRLAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLP 785

Query: 834  HFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 893
            HF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786  HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 894  EDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQD 951
            ED+   YD T R S   ++QF YG DG+D   +E  +       +++++  Y I   N  
Sbjct: 846  EDIMVHYDGTTRNSLGNVIQFIYGEDGMDAGHIEKQSLDTMGGSDQAFERRYRIDLLNTS 905

Query: 952  KGLLPYAIMETANEILGPLEERLVRYDNSGCLVK----------------------REDL 989
              L P +++E+ +EI+G L+ ++   +    LVK                      R  +
Sbjct: 906  NSLEP-SLLESGSEIIGDLKVQMALDEEYKQLVKDRRFLRTIFSDGESSWPLPVNIRRII 964

Query: 990  NKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDET-- 1047
              A+   + D  +    ++ E IN       ++R  +  L +L   ++ ++    D    
Sbjct: 965  QNAQQTFRIDHTKPSDLTIPEIIN-------SVRDLQDRLLVLRSKSEIIKKAQDDAVTL 1017

Query: 1048 ----VPDNVKT-SVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGT 1102
                +   + T  V Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP T
Sbjct: 1018 FCCLLRSRLATRRVLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPAT 1077

Query: 1103 QMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGR 1160
            QMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  +   D+  A++V+  
Sbjct: 1078 QMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSA 1137

Query: 1161 VEKTLLSDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL 1200
            +E T L  V      +Y  D    V  ++   IQ+   L        +D+     L+LEL
Sbjct: 1138 IEHTTLKSVTVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLEL 1197

Query: 1201 -----TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSEND 1255
                   +D+ +            +D+ +I  +  A  +       +  +  A+  +E D
Sbjct: 1198 DRAAMNDKDLTMGQVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEED 1257

Query: 1256 VFYRMQQLRRA-LPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRD 1302
              + ++++    L ++ ++G+  I R V+   D       G+ +      L  +G  L +
Sbjct: 1258 --HMLKKIENTMLENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSE 1315

Query: 1303 VMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVM 1362
            VM   GV  +R  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVM
Sbjct: 1316 VMTVPGVDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVM 1375

Query: 1363 TYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS 1422
            T +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   
Sbjct: 1376 TTQGGLTSVTRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAP 1435

Query: 1423 IGTGSFKVVKGTNISEKDLV 1442
            IGTG+F V+    I E+ LV
Sbjct: 1436 IGTGAFDVM----IDEESLV 1451

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_7.314
          Length = 1716

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1514 (33%), Positives = 779/1514 (51%), Gaps = 147/1514 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++   S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNE----- 120

Query: 126  ELRRPGV--DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            ++R+     D+ +R   +  +   CK +   + C                        + 
Sbjct: 121  QMRQAMAIKDSKKRFNAVWTL---CKTK---MICETDVPSDDDPTTLISRGGCGNAQPSI 174

Query: 184  RWVGKKSAPEKDIWVGEWKEV--LAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+    +   E E+ V      L+  + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKEKNTSDGDEPEQRV------LSTEEILNIFKHISPEDSTR 221

Query: 242  LGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            +G        RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  MGFSEEF--ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 392

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDIPPP 595
            +++ +S +P +   QD + G   ++ +D+F +     Q+L+M+      DG+    IP P
Sbjct: 511  IVSAQSNKPCMGIVQDTLCGIRKLTLRDTFIE---FDQVLNMLYWVPDWDGV----IPTP 563

Query: 596  AIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDGFVI 653
            A++KP  LWTGKQV S  I      P  I+L    +    + PK          ++G ++
Sbjct: 564  AVLKPKPLWTGKQVLSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLV 607

Query: 654  IRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIG 713
            I G QI+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS G
Sbjct: 608  IDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTG 665

Query: 714  IND-VTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSK 772
            I D +     +K+  E + E A  K +++        L  + G    ++ E  +   L++
Sbjct: 666  IGDTIADGQTIKEITETIAE-AKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQ 950
            LED+   YD T R S   ++QF YG DG+D   +E          + +++  Y I   N 
Sbjct: 845  LEDIMVHYDGTTRNSLGNVIQFIYGEDGIDAAHIEKQTLDTIGGSDVAFERRYRIDLLNP 904

Query: 951  DKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQ------------- 997
            +  L P  ++E+ +EI G L+ + +  +    LV+     +  +VD              
Sbjct: 905  EHSLDP-TLLESGSEIAGDLKLQALLDEEYKQLVEDRRFLREIFVDGESNWPLPVNIRRI 963

Query: 998  -YDAERDFY--HS------LREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETV 1048
              +A++ F   HS      +R+ + G      +L   RG   ++E    +   +      
Sbjct: 964  IQNAQQTFRIDHSKPSDLTIRDIVFGIKELQEHLLVLRGKSEIIEKAQSDAITLFCCLVR 1023

Query: 1049 PDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKT 1108
                   + Q Y++++++ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL T
Sbjct: 1024 SRLATRRILQEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN--DNDERAARVVKGRVEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K + TP +   L +   +D+  A+ ++  +E T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHTTL 1143

Query: 1167 SDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL-----T 1201
              +      +Y  D    V  ++   IQ+   L       ++D+     L+LEL      
Sbjct: 1144 KSITVASEIYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELDRAAMN 1203

Query: 1202 IEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQ 1261
             +D+ +        +   +D+ +I  +  A  +       +  S  A+  +E D  + ++
Sbjct: 1204 DKDLTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEED--HMLK 1261

Query: 1262 QLRRA-LPDVVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDG 1308
            ++    L ++ ++G+ +I R V+   D       G+ E      L  +G  L +VM   G
Sbjct: 1262 KIENTMLENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEVMTVPG 1321

Query: 1309 VIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1368
            +  +R  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 IDATRIYTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGL 1381

Query: 1369 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSF 1428
              +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F
Sbjct: 1382 TSVTRHGFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAF 1441

Query: 1429 KVVKGTNISEKDLV 1442
             V+    I E+ LV
Sbjct: 1442 DVM----IDEESLV 1451

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1516 (33%), Positives = 766/1516 (50%), Gaps = 156/1516 (10%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C   LL +  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGK-LLLDEH 118

Query: 120  KRQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXII 179
              Q    ++    D  RR   +   L + K     + C                      
Sbjct: 119  NEQMKQAIKIK--DPKRRFNAVW-TLSKVK-----MICETEVPSEDDPTKYISRGGCGNT 170

Query: 180  HDTFRWVGKKSAPEKDIWVGEWKEVL----AHNPELERYVKRCMDDLNPLKTLNLFKQIK 235
              + R  G          VG WK+      A  PE     KR    ++  + LN+FK I 
Sbjct: 171  QPSIRKDGLS-------LVGTWKKDKNADDADQPE-----KRI---ISAEEVLNVFKHIC 215

Query: 236  SADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWT 295
              D   LG +      RPE  +   LP PP  +RPS+   ++    EDDLT KL +I+  
Sbjct: 216  PEDSWRLGFNEDF--ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKA 272

Query: 296  SSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFC 354
            +  ++     G   + + E    LQ  VA Y+++D +  P  L  S       +PI+   
Sbjct: 273  NINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG------RPIKSIR 326

Query: 355  QRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRH 414
             RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  
Sbjct: 327  ARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNID 386

Query: 415  KLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLF 474
            +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLF
Sbjct: 387  RLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLF 444

Query: 475  NRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 534
            NRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L
Sbjct: 445  NRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQL 504

Query: 535  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEH 589
              V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+  
Sbjct: 505  CAVPLQIVSPQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLYWVPDWDGV-- 559

Query: 590  FDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQ 647
              IP P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          
Sbjct: 560  --IPTPTILKPKPLWSGKQILSMAI------PKGIHLQRFDEGTTLLSPK---------- 601

Query: 648  NDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGN 707
            ++G +I+ G QI+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +L +
Sbjct: 602  DNGMLIVDG-QIIFGVVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLH 659

Query: 708  RGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIG 767
             GFSIGI D        ++  E + +A  K + +        L  + G    ++ E  + 
Sbjct: 660  NGFSIGIGDTIADQKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVV 719

Query: 768  GLLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGF 827
              L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF
Sbjct: 720  RYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGF 779

Query: 828  QDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSR 887
             DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ R
Sbjct: 780  ADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQR 839

Query: 888  RLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNA--QPVNFNRSWDHAYNI 945
            RL+K+LED+   YD T R S   I+QF YG DG+D   +E  +       +R+++  Y I
Sbjct: 840  RLVKALEDIMVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGSDRAFERRYRI 899

Query: 946  TFNNQDKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQ-------- 997
               N D  L P +++E+ +E++G L+ +    +    LV+     +  +VD         
Sbjct: 900  DLLNPDNALDP-SLLESGSEMMGDLKLQASLDEEYRQLVEDRRFLRKIFVDGEQNWPLPV 958

Query: 998  ------YDAERDFY--H------SLREYINGKATALANLRKSRGMLGLLEPPAKELQGID 1043
                   +A++ F   H      ++ + I G       L   RG   +L+        + 
Sbjct: 959  NIRRIIQNAQQTFRIDHTKPTDLTIHDVIYGVKDLQEKLLVLRGKSEMLQEAQTNAVTLF 1018

Query: 1044 PDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQ 1103
                        V + Y++++++ +  L     ++ ++ + PG  +G + AQSIGEP TQ
Sbjct: 1019 CCLLRSRLASRRVIEEYKLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQ 1078

Query: 1104 MTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRV 1161
            MTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L ++   D+  A++++  +
Sbjct: 1079 MTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAI 1138

Query: 1162 EKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQASD 1221
            E T L  V     ++Y D      V  D   I +L   L  E+   ++   S   ++   
Sbjct: 1139 EHTTLKSVTV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDHQSPWLLR--- 1194

Query: 1222 VNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFY------------RMQQLR----- 1264
               +  DR A+N   +      +    KE  +ND+F             R + +R     
Sbjct: 1195 ---LELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTL 1249

Query: 1265 -----------------RALPDVVVKGLPDISRAVINIRD------DGKRE------LLV 1295
                               L  + ++G+ DI+R V+   D       G+ +      L  
Sbjct: 1250 DAEAEAEEDHMLKKIENTMLESITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLET 1309

Query: 1296 EGYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHI 1355
            +G  L +VM   GV  +R  TN  +++ +VLGIEA R ++ +E+   +++ G  V+ RH+
Sbjct: 1310 DGVNLAEVMSVPGVDSTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHM 1369

Query: 1356 QLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECI 1415
             LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +
Sbjct: 1370 ALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENV 1429

Query: 1416 ILGQTMSIGTGSFKVV 1431
            ILGQ   IGTG+F V+
Sbjct: 1430 ILGQMAPIGTGAFDVM 1445

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1727

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1500 (33%), Positives = 768/1500 (51%), Gaps = 142/1500 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE----- 120

Query: 126  ELRRPGV--DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            ++R+     D+ +R      I   CK +   + C                        T 
Sbjct: 121  QMRQACKIKDSKKR---FNAIWTLCKTK---MICESDVPSEEDPTKLISRGGCGNAQPTV 174

Query: 184  RWVGKKSAPEKDIWVGEWK-EVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELL 242
            R  G K        VG WK E    +PE        M+++     LN+FK I   D   L
Sbjct: 175  RKDGLK-------LVGSWKKEKNTGDPEEPEQRILTMEEI-----LNIFKHISKEDSNRL 222

Query: 243  GIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQ 361
               G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIV 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L+ 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVR 393

Query: 422  NGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEHFDIPPPA 596
            ++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    IP PA
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDNFIE---LDQVLNMLYWVPDWDGV----IPTPA 564

Query: 597  IMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPNEMSQNDGFVII 654
            I+KP  LWTGKQ+ S+ I      P  I+L    +    + PK          ++G +II
Sbjct: 565  IIKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTLLSPK----------DNGMLII 608

Query: 655  RGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGI 714
             G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI
Sbjct: 609  DG-KIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGI 666

Query: 715  NDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVR 774
             D        ++  E +  A  K +++        L  + G    ++ E  +   L++ R
Sbjct: 667  GDTIADGQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 775  EEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 834
            ++ G +    L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRLAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 835  FPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 894
            F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 895  DLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNQDK 952
            D+   YD+T R S   ++QF YG DG+D   +E  A       + +++  Y I   N D 
Sbjct: 847  DIMVHYDSTTRNSLGNVIQFVYGEDGMDASHIEKQAIDTIGGSDSAFEKRYRIDLLNPDH 906

Query: 953  GLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVD-------QYDAERDFY 1005
             L P +++E+ +EI+G L+ +++  +    LV+     ++ +VD         +  R   
Sbjct: 907  LLDP-SLLESGSEIVGDLKLQVLLDEEYKQLVEDRFFLRSVFVDGEPNWPLPVNIRRIVQ 965

Query: 1006 HSLREY-INGKATALANLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVS------- 1057
            ++ + + I+    +  ++R     +  L+     L+G    E + +  + +VS       
Sbjct: 966  NAQQTFRIDHTKPSDLSIRDVYFAVKNLQDKLLVLRG--NSEIIKNAQQDAVSLFCCLMR 1023

Query: 1058 ---------QLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKT 1108
                     + YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL T
Sbjct: 1024 SRLATRRVIEEYRLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN---------DNDERAARVVKG 1159
            FHFAGVAS  VT GVPR+      +K I + I +  L +         D D R+  + + 
Sbjct: 1084 FHFAGVASKKVTSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAED 1143

Query: 1160 ----RVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKL 1215
                ++  +LL D      +   D  S   +R++L        +LT+  +   I    K 
Sbjct: 1144 EEIIQLHFSLLDDET----EKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFK- 1198

Query: 1216 KIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRA-LPDVVVKG 1274
                +D+ +I  +  A  +       +  S   +  +E D  + ++++    L ++ ++G
Sbjct: 1199 ----NDLFVIWSEDNAEKLIIRCRVVRPKSMDIETEAEED--HMLKKIENTMLENITLRG 1252

Query: 1275 LPDISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDGVIGSRTTTNHVLEV 1322
            + +I R V+   D       G+        L  +G  L +VM   GV   R  TN  +++
Sbjct: 1253 VENIERVVMMKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDI 1312

Query: 1323 FSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS 1382
              VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++    
Sbjct: 1313 MEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATG 1372

Query: 1383 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKDLV 1442
             L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V+    I E+ LV
Sbjct: 1373 ALMRCSFEETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM----IDEESLV 1428

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
            complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1167 (35%), Positives = 629/1167 (53%), Gaps = 107/1167 (9%)

Query: 348  KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEK 407
            +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE 
Sbjct: 2    RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 408  VTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLE 467
            VT YN  +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ 
Sbjct: 62   VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 468  DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 527
            D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120  DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 528  RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS--- 584
            RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +     Q+L+M+    
Sbjct: 180  RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIE---FDQVLNMLYWVP 236

Query: 585  --DGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKS 640
              DG+    IP PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PK   
Sbjct: 237  DWDGV----IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPK--- 283

Query: 641  LPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKL 700
                   ++G ++I G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+
Sbjct: 284  -------DNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKV 334

Query: 701  CARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQ 760
               +L + GFS GI D     +  ++  E +  A  K +E+        L  + G    +
Sbjct: 335  VNFWLLHNGFSTGIGDTIADGETMKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRE 394

Query: 761  TLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISG 820
            + E  +   L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G
Sbjct: 395  SFEDNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEG 454

Query: 821  NRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTA 880
             R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTA
Sbjct: 455  KRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTA 514

Query: 881  ETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRS 938
            ETGY+ RRL+K+LED+   YD+T R S   ++QF YG DG+D   +E  +       N++
Sbjct: 515  ETGYIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIEKQSIDTIGGSNQA 574

Query: 939  WDHAYNITFNNQDKGLLPYAIMETANEILGP------LEERLVRYDNSGCLVK------- 985
            ++  Y I   + +   L   ++E+ +EI+G       L+E   +  N    ++       
Sbjct: 575  FEKRYRIDLMSPEHS-LDTTLLESGSEIIGDVKIQSMLDEEYKQLVNDRRFLRNVFIDGE 633

Query: 986  ---------REDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPA 1036
                     R  +  A+   + D  +    ++R+ + G     + L   RG   ++E   
Sbjct: 634  QNWPLPVNIRRIVQNAQQTFRIDHTKPSDLTIRDVVYGVKELESKLLVLRGKSKIIEEAQ 693

Query: 1037 KELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQS 1096
             +   +             V + YR+++++    L     ++ ++ + PG  +G + AQS
Sbjct: 694  NDAITLFCCLLRSRLAARRVLEEYRLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQS 753

Query: 1097 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERAA 1154
            IGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP     L  +   D+  A
Sbjct: 754  IGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEKA 813

Query: 1155 RVVKGRVEKTLLSDVA-----FYVQD----VYKDNLSFIQVRIDL------GTIDK---- 1195
            + ++  +E T L  V      +Y  D    V  D+   IQ+   L        +D     
Sbjct: 814  KFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSPW 873

Query: 1196 -LQLEL---TIEDIAVAITRASKLKIQAS---DVNIIGKDRIAINVFPEGYKAKSISTSA 1248
             L+LEL    + D  + + +  + KI+ +   D+ +I  +  A  +       +  S  A
Sbjct: 874  LLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLDA 932

Query: 1249 KEPSENDVFYRMQQLRRA-LPDVVVKGLPDISRAVINIRD------DGKRE------LLV 1295
            +  +E D  + ++++    L  + ++G+ DI R V+   D      +G  E      L  
Sbjct: 933  ETEAEED--HMLKKIENTMLESITLRGVEDIERVVMMKYDRKMPSENGAYEKVPEWVLET 990

Query: 1296 EGYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHI 1355
            +G  L +VM   GV  +R  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+
Sbjct: 991  DGVNLLEVMTVTGVDPTRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHM 1050

Query: 1356 QLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECI 1415
             LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +
Sbjct: 1051 ALLVDVMTTQGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENV 1110

Query: 1416 ILGQTMSIGTGSFKVVKGTNISEKDLV 1442
            ILGQ   +GTG+F V+    I E+ L+
Sbjct: 1111 ILGQMAPVGTGAFDVM----IDEESLI 1133

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/317 (83%), Positives = 292/317 (92%), Gaps = 1/317 (0%)

Query: 1145 LVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIED 1204
            LVN NDERAARVVKGR+EKTLLSDVAFY+QDVYKDNLSF+QV+IDLGTI+KLQLELTIED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1205 IAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLR 1264
            IAVAITRASKLKI A DV+IIGKD++ INV+PEG K KSISTSAKEP EN++FYR+Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1265 RALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVLEVFS 1324
            R+LP +VVKGLPDI+RAVINI+ DG RELLVEGYGLRDVM TDGV+G +T TNH+LEV S
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
            VLGIEAAR SI+ EI+YTMSNHGMSVDPRH+QLLGDVMTYKGEVLGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKDLVPK 1444
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGTN+S ++L PK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1445 RCLFESL-SNEAALKAN 1460
              LFESL  N AALK N
Sbjct: 304  ATLFESLCGNTAALKIN 320

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  448 bits (1153), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 322/981 (32%), Positives = 491/981 (50%), Gaps = 128/981 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ I  + +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTK-------AQGNTGGKV-PIPGVKQA 445

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 446  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 505

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ I+NGP+  PGA+ +  +NED        +    R  LA  L           +   V
Sbjct: 506  RQAIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKV 563

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 564  YRHIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 623

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 624  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 683

Query: 582  MM---SDGIE---HFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG          PPAI KP  LWTGKQ+ + ++  N   P +  INL + NK+ 
Sbjct: 684  GCIRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSSNKI- 741

Query: 634  VPPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
               K++       +ND  VI +  Q+L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 742  ---KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKV 795

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKK----EELVEIAYHKCDELITL----- 744
            ++ + +L   ++ N  F+ G++D+    D  + +    +E V+I      E+  L     
Sbjct: 796  LSVLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDTP 855

Query: 745  FNKGEL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI--NELDNW--NAPLIMA 795
             N  EL     E     N+   L+A     ++ +  +V   C+    +  +  N+   MA
Sbjct: 856  SNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENSMQAMA 915

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 916  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSG 975

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 976  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1035

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEERLV 975
            YGGD +D ++            S    +N   +N D  L  Y                  
Sbjct: 1036 YGGDAVDVIK-----------ESHMTEFNFCLDNYDALLKKY------------------ 1066

Query: 976  RYDNSGCLVKREDLNKA-EYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEP 1034
               N   LV+  D+  A +Y  +    R  +   + Y   K T   +   S+        
Sbjct: 1067 ---NPSALVEHVDVETALKYSKKTLKNRKKHKDEKHY---KQTLKYDPVLSK------YN 1114

Query: 1035 PAKELQGI-----DPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAI 1089
            PAK L  +     D  E   D    +  +   I+EK  R  +++   KY ++ + PG A+
Sbjct: 1115 PAKYLGAVSENFQDKLELFLDKSSKTFKEYESINEKKFRALMQL---KYMRSLINPGEAV 1171

Query: 1090 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND 1148
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ND
Sbjct: 1172 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWND 1231

Query: 1149 NDERAARVVKGRVEKTLLSDV 1169
              +  A      + K +LS+V
Sbjct: 1232 VSDETADTFCKSISKVILSEV 1252

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 1270 VVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGI 1328
             +++ +P I R +    ++GKR L+ EG   + +   +  I     T+N +  V    G+
Sbjct: 1477 TIIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGV 1536

Query: 1329 EAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1388
            EAAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S
Sbjct: 1537 EAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-S 1595

Query: 1389 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            +E T   L  A    +++ +E  S  I+LG+  ++GTG+F ++
Sbjct: 1596 YETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 46.6 bits (109), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  L++ADI   S   ++   + D      P + G  D  +G    +L C TC  
Sbjct: 11  ISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   D  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  444 bits (1141), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 323/984 (32%), Positives = 502/984 (51%), Gaps = 136/984 (13%)

Query: 253  PETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----------- 300
            P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+           
Sbjct: 353  PDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMSNLQK 409

Query: 301  ---AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRL 357
               +  D+ +  + +M  +  +Q  V  +I+S         GS+  GGKV PI G  Q L
Sbjct: 410  DKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-----GST--GGKV-PIPGVKQAL 461

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            + K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 462  EKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 521

Query: 418  ELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVVE 463
            + ++NGP+  PGA  +  +NED        +    R  LA  L           +   V 
Sbjct: 522  QAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKKVF 579

Query: 464  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 522
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 580  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 639

Query: 523  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSM 582
            Q E AR+EA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q +  
Sbjct: 640  QNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYIYG 699

Query: 583  M---SDGIEHFDIP-----PPAIMKPYYLWTGKQVFSLLIKPNHNSPV---VINLDAKNK 631
                 DG  H   P     PPA+MKP  LWTGKQ+ + +I   + +P     INL +KNK
Sbjct: 700  CIRPEDG--HSTRPKIVTVPPAVMKPVPLWTGKQIITTVIM--NVTPADMPGINLLSKNK 755

Query: 632  VFVPPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAA 691
            +    K++      ++N+  VI +   +L G++DKS  G   K+ + +++   YGP+ AA
Sbjct: 756  I----KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAA 808

Query: 692  NAMNRMAKLCARFLGNRGFSIGINDVT-PADDLKQKKEEL---VEIAYHKCDELITL--- 744
              ++ + +L   F+ N  FS G++D+   A+  K +K+ L    ++      E+  L   
Sbjct: 809  KVLSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTD 868

Query: 745  --FNKGEL-----ETQPGCNEEQTLEA----KIGGLLSKVREEVGDVCINELDNWNAPLI 793
               N  EL     E     N+   L+A    K+  + SKV   V      +    N+   
Sbjct: 869  TPSNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQA 928

Query: 794  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 853
            MA  G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+
Sbjct: 929  MALSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFY 988

Query: 854  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQ 913
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQ
Sbjct: 989  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQ 1048

Query: 914  FTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPY---AIMETANEILGPL 970
            F YGGD +D  +     Q           ++    N D  L  Y   A++E  +      
Sbjct: 1049 FLYGGDAVDTTKESHMTQ-----------FDFCLENYDALLRKYNPSALVEHLD------ 1091

Query: 971  EERLVRYDNSGCLVKREDLNKAEYV---DQYDAERDFYHSLREYINGKATALANLRKSRG 1027
             E  ++Y     L  R+ ++K  +    D+YD        L +Y   K     + +    
Sbjct: 1092 VESALKYSKKA-LKSRKKIDKEPHYKNSDKYDP------VLSKYNPAKYLGSVSEKFQDK 1144

Query: 1028 MLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYR-ISEKSVRKFLEIALFKYRKARLEPG 1086
            + G L+  +K+L                  +L+  I+EK  R  +++   KY ++ + PG
Sbjct: 1145 LEGFLDSHSKQL------------------KLHSGINEKKFRALMQL---KYMRSLVNPG 1183

Query: 1087 TAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVL 1145
             A+G I AQS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  +
Sbjct: 1184 EAVGIIAAQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPV 1243

Query: 1146 VNDNDERAARVVKGRVEKTLLSDV 1169
             N   +  A +    + K +LS+V
Sbjct: 1244 WNHVSDDQASIFCKSITKVVLSEV 1267

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 85/164 (51%), Gaps = 6/164 (3%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVI---GSRTTTNHVLEVFSVLG 1327
            V++ +P ISR +       +R L  EG   + +   +  I   G R+  N V  V    G
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRS--NDVAAVLRTYG 1557

Query: 1328 IEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLA 1387
            +EAAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ 
Sbjct: 1558 VEAARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM- 1616

Query: 1388 SFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            S+E T   L  A     ++ ++  S  I+LG+  ++GTG+F V+
Sbjct: 1617 SYETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F+  SA +I   S  +++   + D      P + G  D  +G    +L CATC  
Sbjct: 11  ISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  443 bits (1139), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 331/1073 (30%), Positives = 527/1073 (49%), Gaps = 152/1073 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS +  +   ++++ L   L++I+ TS LI+              A  D+ I 
Sbjct: 357  PPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDEISKLQKDKVALDDRRII 413

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S            N  GK+ P+ G  Q L+ K+G FR ++
Sbjct: 414  FSRLMNAFVTIQNDVNSFIDSSK-------AQGNNSGKL-PVPGVKQALEKKEGLFRKHM 465

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNGPNVHP 428
             GKRV+++ R+VISPDPN+  DE+ VP   A  LTYPE VT YN  +L++ ++NGP+  P
Sbjct: 466  MGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 525

Query: 429  GANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVVERHLEDGDVVLF 474
            GA  +  +NED        +    R  LA  L           +   V RH+++ DVV+ 
Sbjct: 526  GATQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVVIM 583

Query: 475  NRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 533
            NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA N
Sbjct: 584  NRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFN 643

Query: 534  LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SDGIEHF 590
            L    +  LTP SG P+    QD I+    ++ KDS++ R    Q +       DG    
Sbjct: 644  LANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHSAN 703

Query: 591  D---IPPPAIMKPYYLWTGKQVFSLLIKPNHNSPV---VINLDAKNKVFVPPKSKSLPNE 644
            +     PPAI+KP  LWTGKQ+ + ++   + SPV    INL +KNK+    K +     
Sbjct: 704  NKLLTIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKSKNKI----KDEYWGQH 757

Query: 645  MSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARF 704
              +N+  V+ +   +L G++DKS  G   K+ + + +   YGP+ AA  ++ + +L   +
Sbjct: 758  SEENE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFTNY 814

Query: 705  LGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGC-------- 756
            + N  F+ G++D+   D+  + + ++++ +  +  +        E +T            
Sbjct: 815  ITNTAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVTNLEKDTSADDSELLKRLE 874

Query: 757  ------NEEQTLEAKIGGLLSKVREEVGDVCI--NELDNW--NAPLIMATCGSKGSTLNV 806
                  N+   L+A     ++ +  +V   C+    +  +  N+   MA  G+KGS +NV
Sbjct: 875  EILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQSMALSGAKGSNVNV 934

Query: 807  SQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAI 866
            SQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ FH +
Sbjct: 935  SQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQEYYFHCM 994

Query: 867  SGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEM 926
            +GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F YGGD +D  + 
Sbjct: 995  AGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEFLYGGDAVDVTK- 1053

Query: 927  EGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKR 986
                       S+ + ++   +N D  L  Y                     N   L+  
Sbjct: 1054 ----------ESYMNQFDFCLDNYDSLLKRY---------------------NPAALIDF 1082

Query: 987  EDLNKA-EYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPD 1045
             D++ A +Y  +    R    ++  Y       L N++    +      PAK L  +   
Sbjct: 1083 LDVDSALKYSKKTLKHRKKNKNVPHY-------LQNIKYDPVLAKY--NPAKYLGSVSEK 1133

Query: 1046 -ETVPDNVKTSVSQLYRISEKSV--RKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGT 1102
             +   +N   S SQL++ S KSV  +KF  +   KY ++ + PG A+G I +QS+GEP T
Sbjct: 1134 FQDKLENFLDSNSQLFK-SHKSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPST 1192

Query: 1103 QMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVKGRV 1161
            QMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A +    +
Sbjct: 1193 QMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDDQADIFAKSI 1252

Query: 1162 EKTLLSDV---------------------AFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
             K +LS+V                      FY QD Y +     +  +     +     L
Sbjct: 1253 SKVILSEVIDSVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEELQNVVANNF---L 1309

Query: 1201 TIEDIAVAITRASKLKIQASDVNI-IGKDRIAINVFPEGYKAKSISTSAKEPS 1252
            T  +IA+      + K  ASDV I I K ++A+    EG  +K +  + +E S
Sbjct: 1310 TSLEIAIHKEIKKQKKTTASDVGIAIPKAQLALAAV-EGLSSKVMEDNDEEQS 1361

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 91/167 (54%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLR------DVMCTDGVIGSRTTTNHVLEVFS 1324
            VV+ +P+I R V    ++GKR L+ EG   +      D +  DG+     T+N V  V  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGI-----TSNDVSSVLK 1535

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
              G+EAAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTG+F V+
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++FS LSA +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLK 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  441 bits (1133), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 315/986 (31%), Positives = 488/986 (49%), Gaps = 132/986 (13%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLK 358
              +  D+ +  N +M  +  +Q  V  +I+S           S+ G KV PI G  Q L+
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQSSSGNKV-PIPGLKQALE 461

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQE 418
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQ 521

Query: 419  LIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVVER 464
             ++NGP+  PGA  +  +NED        +    R  LA  L           I   V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYR 579

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 523
            H+++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 524  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM 583
             E A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +   
Sbjct: 640  NENAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 584  ---SDGI---EHFDIPPPAIMKPYYLWTGKQVFS--LLIKPNHNSPVVINLDAKNKVFVP 635
                DG          PPA+MKP  LWTGKQ+ +  LL     N P  INL++KNK+   
Sbjct: 700  IRPEDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPG-INLNSKNKI--- 755

Query: 636  PKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMN 695
             K++       +N+  V+ +  Q+L G++DKS  G   K  + +++   YGP  AA  ++
Sbjct: 756  -KNEYWGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLS 811

Query: 696  RMAKLCARFLGNRGFSIGINDVTPADDLKQKKEEL----VEIAYHKCDELITL-----FN 746
             + +L   ++    F+ G++D+    +  + + ++    V+I      E+  L      +
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSD 871

Query: 747  KGEL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDN----WNAPLIMATC 797
             GEL     E     N+   L+A     ++ +  +V   C+ +       +N+   MA  
Sbjct: 872  DGELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALS 931

Query: 798  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 857
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIR 991

Query: 858  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYG 917
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YG
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLYG 1051

Query: 918  GDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEERLVRY 977
            GD +D +  E +     F                                          
Sbjct: 1052 GDAVD-ITKESHMTEFKFC----------------------------------------V 1070

Query: 978  DNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATA----LANLRKSRGMLGLLE 1033
            DN   L+K+   N +  VD  D E    +S +   N K  +     A   K   +L    
Sbjct: 1071 DNYDALLKK--YNPSALVDHLDVESALKYSKKTLKNRKKNSKLPHYAQTSKYDPVLSKFN 1128

Query: 1034 PPAKELQGIDPDETVPDNVKTSVS---QLYRISEK-SVRKFLEIALFKYRKARLEPGTAI 1089
             P+K L  +   E   D ++  +S     ++  E  + +KF  +   KY ++ + PG A+
Sbjct: 1129 -PSKYLGAV--SENFQDKLEKFISTNDDFFKKDENVNEKKFRALMQLKYMRSLINPGEAV 1185

Query: 1090 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND 1148
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D
Sbjct: 1186 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDD 1245

Query: 1149 NDERAARVVKGRVEKTLLSDVAFYVQ 1174
              +  A      + K +LS+V   VQ
Sbjct: 1246 VSDELADTFCKNITKVMLSEVIDKVQ 1271

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 88/164 (53%), Gaps = 6/164 (3%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVI---GSRTTTNHVLEVFSVLG 1327
            +++ +P I R V    ++GKR L+ EG   + +   D  I   G R+  N V  V    G
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRS--NDVAAVLKTYG 1545

Query: 1328 IEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLA 1387
            +EAAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ 
Sbjct: 1546 VEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM- 1604

Query: 1388 SFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            S+E T   L  A    + + ++  S  I++G+   +GTGSF ++
Sbjct: 1605 SYETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++FS L++ +I   S  +V+   + D      P   G  D  +G    +L CATC  
Sbjct: 11  ITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR---- 128
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++   +  +LR    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQY 127

Query: 129 -----RPGVDNLR 136
                R  +DN+R
Sbjct: 128 ALIDERYQIDNIR 140

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  439 bits (1129), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 304/969 (31%), Positives = 487/969 (50%), Gaps = 104/969 (10%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISIN 310
            + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+   D+  +I 
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 311  NMMEHWDYLQLTVAMYINS-----DSVNPAMLPGSSNGGGKVK-PIRGFCQRLKGKQGRF 364
                  D  ++  +  +N+     + VN  +    + G    K P+ G  Q L+ K+G F
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGSASSKIPVPGVKQALEKKEGLF 466

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNGP 424
            R ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ ++NGP
Sbjct: 467  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQAVINGP 526

Query: 425  NVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVVERHLEDGD 470
            +  PGA+ +  +NED        +    R  LA  L           +   V RH+++ D
Sbjct: 527  DKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYRHIKNRD 584

Query: 471  VVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 529
            VVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARA
Sbjct: 585  VVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARA 644

Query: 530  EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--------S 581
            EA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +         
Sbjct: 645  EAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCIRPEHG 704

Query: 582  MMSDGIEHFDIPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFVPPKSKS 640
              S G       PPA++KP  LWTGKQ+ S +L+         INL++ NK+    K++ 
Sbjct: 705  HASRG--KIVTMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI----KNEY 758

Query: 641  LPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKL 700
                 ++ND  VI +  +++ G++DKS  G   K+ + +++   YGP+ AA  ++ + +L
Sbjct: 759  WGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSVLGRL 815

Query: 701  CARFLGNRGFSIGINDV---------------TPADDLKQKKEELVEIAYHKCDELITLF 745
               ++    F+ G++D+               T  D  +Q   E+  +      + + L 
Sbjct: 816  FTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSDDVELL 875

Query: 746  NKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDN----WNAPLIMATCGSKG 801
             + E E     N+   L+A     ++ V  +V   C+ +       +N+   MA  G+KG
Sbjct: 876  KRLE-EILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMALSGAKG 934

Query: 802  STLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEF 861
            S +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+
Sbjct: 935  SNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIKPQEY 994

Query: 862  LFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGL 921
             FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +
Sbjct: 995  YFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLYGGDAV 1054

Query: 922  DPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEERLVRYDNSG 981
            D +  E +    +F R    A    +N       P A+ E  +       E  ++Y    
Sbjct: 1055 D-VTKESHMTQFDFCRENYDALLKKYN-------PVALAEHLD------VETALQYSKKV 1100

Query: 982  CLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQG 1041
               ++++   A     Y+ +  +   L +Y   K     + +    +   LE  AKE + 
Sbjct: 1101 SKNRKKNSKTA----HYEQKVKYDPVLAKYNPAKYLGSVSEKFHDKLESYLEDKAKEFKS 1156

Query: 1042 IDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPG 1101
                       + SV         S ++F  +   KY ++ + PG A+G I +QS+GEP 
Sbjct: 1157 -----------RESV---------SAKRFRALMQLKYMRSLINPGEAVGIIASQSVGEPS 1196

Query: 1102 TQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVKGR 1160
            TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D  +  A +    
Sbjct: 1197 TQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDEQADLFCKS 1256

Query: 1161 VEKTLLSDV 1169
            + K +LS+V
Sbjct: 1257 ISKVVLSEV 1265

 Score = 90.1 bits (222), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            V++ +P I R V +   + KR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ +E  S  I+LG+  ++GTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  L+F+ L+  DI   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L + +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  438 bits (1126), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 314/985 (31%), Positives = 497/985 (50%), Gaps = 126/985 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  DK +  N +M  +  +Q  V  +I+S            + GGKV PI G  Q 
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTK-------AQGSAGGKV-PIPGVKQA 453

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 454  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 513

Query: 417  QELIVNGPNVHPGANYLLKRNEDARRNLRYG----DRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA+ +  +NED       G     R  LA  L           +   V
Sbjct: 514  RQAVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKV 571

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 572  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 631

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 632  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIY 691

Query: 582  MM---SDGI---EHFDIPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                  DG          PPA+MKP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 692  GCIRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI-- 749

Query: 635  PPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K+       ++ND  VI +  ++L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 750  --KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVL 804

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELV----EIAYHKCDELITL-----F 745
            + + +L   ++    F+ G++D+   DD  + + +++    ++      E+  L      
Sbjct: 805  SVLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSA 864

Query: 746  NKGEL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----NELDNWNAPLIMA 795
            N  EL     E     N+   L+A     ++ +  +V   C+      +  N N+   MA
Sbjct: 865  NDTELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMA 923

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 924  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSG 983

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 984  IRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1043

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEERLV 975
            YGGD +D +  E +     F      A    +N       P A++E  +       E  +
Sbjct: 1044 YGGDAVD-VTQESHMTEFKFCADNYDALLKKYN-------PSALIEHLD------VESAL 1089

Query: 976  RYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPP 1035
            +Y         ++  K E V  + A++  Y  +    N                     P
Sbjct: 1090 KYSKKAL----KNRKKNERVPHF-AQKVKYDPVVSKFN---------------------P 1123

Query: 1036 AKELQGIDPDETVPDNVKT---SVSQLYRISEKSV--RKFLEIALFKYRKARLEPGTAIG 1090
            +K L  +   E   D +++   S ++L++ S  SV  +KF  +   KY ++ + PG A+G
Sbjct: 1124 SKYLGSV--SENFQDKLESFIDSNNELFK-SRDSVNEKKFRALMQLKYMRSLINPGEAVG 1180

Query: 1091 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDN 1149
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D 
Sbjct: 1181 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADV 1240

Query: 1150 DERAARVVKGRVEKTLLSDVAFYVQ 1174
             +  A      + K +LS+V   V+
Sbjct: 1241 TDSQADTFCKSITKVMLSEVVDRVE 1265

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 92/168 (54%), Gaps = 2/168 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            V++ + +I R V    ++GKR L+ EG   +++   D  +  +  T+N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNIS 1437
            E T   L  A    + + ++  S  ++LG+  ++GTG+F V+   + S
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVLAKVSAS 1653

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  ++A DI   S ++++   + D      P + G  D  +G    +L CATC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  436 bits (1120), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 310/983 (31%), Positives = 492/983 (50%), Gaps = 132/983 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM---SDGI---EHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG          PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIK 756

Query: 634  VPPKSK-SLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                 K SL NE       V+ +   +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLENE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 693  AMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDEL---ITLFNKGE 749
             ++ + +L   ++    F+ G++D+    +  + + ++++ +     E    +T  +K  
Sbjct: 809  VLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDT 868

Query: 750  LETQPGC-----------NEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPL----IM 794
                P             N+   L+A     ++ +  +V   C+ +      P      M
Sbjct: 869  PADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAM 928

Query: 795  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFS 854
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+S
Sbjct: 929  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYS 988

Query: 855  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQF 914
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF
Sbjct: 989  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQF 1048

Query: 915  TYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEERL 974
             YGGD +D   +   +    F    D+ Y +        L+ +  +E+A           
Sbjct: 1049 MYGGDAID---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESA----------- 1094

Query: 975  VRYDNSGCLVKREDLNKAEYVD--QYDAERDFYHSLREYINGKATALANLRKSRGMLGLL 1032
            ++Y       +++   +  Y    +YD     Y+                          
Sbjct: 1095 LKYSKKTLKYRKKHSKEPHYKQSVKYDPVLAKYN-------------------------- 1128

Query: 1033 EPPAKELQGIDPDETVPDNVKTSV---SQLYRISEK-SVRKFLEIALFKYRKARLEPGTA 1088
              PAK L  +   E   D +++ +   S+L++ S+  + +KF  +   KY ++ + PG A
Sbjct: 1129 --PAKYLGSV--SENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEA 1184

Query: 1089 IGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVN 1147
            +G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + N
Sbjct: 1185 VGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWN 1244

Query: 1148 D-NDERAARVVKGRVEKTLLSDV 1169
            D +DE+A    K  + K LLS+V
Sbjct: 1245 DVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++GKR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  435 bits (1119), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 309/987 (31%), Positives = 494/987 (50%), Gaps = 140/987 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV P+ G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PVPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM---SDGI---EHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG          PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLLSKNKIK 756

Query: 634  VPPKSK-SLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                 K SL NE       V+ +   +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLENE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 693  AMNRMAKLCARFLGNRGFSIGINDV---------------TPADDLKQKKEELVEIAYHK 737
             ++ + +L   ++    F+ G++D+               T  D  +Q   E+  +    
Sbjct: 809  VLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDT 868

Query: 738  CDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDN----WNAPLI 793
              +   L  + + E     N+   L+A     ++ +  +V   C+ +       +N+   
Sbjct: 869  PADDPELLKRLQ-EILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQA 927

Query: 794  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 853
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+
Sbjct: 928  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFY 987

Query: 854  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQ 913
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQ
Sbjct: 988  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQ 1047

Query: 914  FTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEER 973
            F YGGD +D   +   +    F    D+ Y +        L+ +  +E+A          
Sbjct: 1048 FMYGGDAID---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESA---------- 1094

Query: 974  LVRYDNSGCLVKREDLNKAEYVD--QYDAERDFYHSLREYINGKATALANLRKSRGMLGL 1031
             ++Y       +++ + +  Y    +YD     Y+                         
Sbjct: 1095 -LKYSKKTLKYRKKHIKEPHYKQSIKYDPVLAKYN------------------------- 1128

Query: 1032 LEPPAKELQGIDPDETVPDNVKTSV---SQLYR----ISEKSVRKFLEIALFKYRKARLE 1084
               PAK L  +   E   D +++ +   S+L++    ++EK  R  +++   KY ++ + 
Sbjct: 1129 ---PAKYLGSV--SENFQDKLESFLDKGSKLFKSADGVNEKKFRALMQL---KYMRSLIN 1180

Query: 1085 PGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINA 1143
            PG A+G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +  
Sbjct: 1181 PGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTL 1240

Query: 1144 VLVND-NDERAARVVKGRVEKTLLSDV 1169
             + +D +DE+A    K  + K LLS+V
Sbjct: 1241 PIWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++GKR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  435 bits (1118), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 307/977 (31%), Positives = 490/977 (50%), Gaps = 143/977 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+              +  D+ I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S         GS+  GG V P+ G  Q L+ K+G FR ++
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ-----GST--GGNV-PVPGVKQALEKKEGLFRKHM 475

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNGPNVHP 428
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ ++NGP+  P
Sbjct: 476  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 535

Query: 429  GANYLLKRNEDARR----NLRYGDRMKLAKNLQ-----------IGDVVERHLEDGDVVL 473
            GA  L  +NED        +    R  LA  L            +   V RH+++ D+V+
Sbjct: 536  GA--LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVI 593

Query: 474  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 594  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 653

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SDGIEH 589
            NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +       DG  H
Sbjct: 654  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDG--H 711

Query: 590  FDIP-----PPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFVPPKSKSLPN 643
               P     PPA+ KP  LWTGKQ+ + +L+         INL + NK+    K++    
Sbjct: 712  ATRPKLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGK 767

Query: 644  EMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR 703
               +N+  V+ +  ++L G++DK+  G   K+ + +++   YGP  AA  ++ + +L   
Sbjct: 768  SSEENE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTN 824

Query: 704  FLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDEL---ITLFNKGELETQPGC---- 756
            ++    F+ G++D+    +  + ++++++ +     E    +T   K      P      
Sbjct: 825  YIMATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRL 884

Query: 757  -------NEEQTLEAKIGGLLSKVREEVGDVCINELDN----WNAPLIMATCGSKGSTLN 805
                   N+   L+A     ++ +  +V   C+ +       +N+   MA  G+KGS +N
Sbjct: 885  QEVLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVN 944

Query: 806  VSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHA 865
            VSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH 
Sbjct: 945  VSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHC 1004

Query: 866  ISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLE 925
            ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D  +
Sbjct: 1005 MAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVDVTK 1064

Query: 926  MEGNAQPVNFNRSWDHAYNITFNNQD---KGLLPYAIMETANEILGPLEERLVRYDNSGC 982
                        S    ++    N D   K   P A++E  +       E  ++Y     
Sbjct: 1065 -----------ESHMTKFDFCLENYDALLKKYNPSALIEHLD------VESALKYSKKSL 1107

Query: 983  LVKREDLNKAEYVD--QYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQ 1040
              +++   +A Y    +YD     Y+                            PAK L 
Sbjct: 1108 KYRKKHAKEAHYKQSPKYDPVLAKYN----------------------------PAKYLG 1139

Query: 1041 GIDPDETVPDNVKTSV---SQLYR----ISEKSVRKFLEIALFKYRKARLEPGTAIGAIG 1093
             +   E   D ++T +   S+L++    ISEK  R  +++   KY ++ + PG A+G I 
Sbjct: 1140 SV--SEKFQDKLETFIDKNSKLFKHNDDISEKKFRALMQL---KYMRSLINPGEAVGIIA 1194

Query: 1094 AQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDER 1152
            +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  ++
Sbjct: 1195 SQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQ 1254

Query: 1153 AARVVKGRVEKTLLSDV 1169
             A      + K LLS+V
Sbjct: 1255 QADTFSKSISKVLLSEV 1271

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 90/167 (53%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLR------DVMCTDGVIGSRTTTNHVLEVFS 1324
            ++  +P I R V    ++GKR L+ EG   +      D +  DG+     T+N V  V  
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGI-----TSNDVSAVLK 1555

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
            V G+EAAR +I+ EI+     + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1556 VYGVEAARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLM 1615

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            ++ S+E T   L  A    +++ ++  S  I++G+  ++GTGSF ++
Sbjct: 1616 KM-SYETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 12  RIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCH 71
           RI  ++F   SA ++ A S  +++   + D      P + G  D  +G    ++ CA+C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALGAFLRNM-CASCG 66

Query: 72  GNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
            +   C GH GH++L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  433 bits (1114), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 311/990 (31%), Positives = 497/990 (50%), Gaps = 136/990 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI+          
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  DK +  N +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIPGVKQA 454

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 417  QELIVNGPNVHPGANYLLKRNEDARRNLRYG----DRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED       G     R  LA  L           +   V
Sbjct: 515  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKV 572

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIY 692

Query: 582  MM---SDGIEHFD---IPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                  DG    +     PPA+ KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 693  GCIRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI-- 750

Query: 635  PPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++      ++ND  V+ +  ++L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 751  --KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVL 805

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELV----EIAYHKCDELITL-----F 745
            + + +L   ++    F+ G++D+   ++  + + +++    ++      E+  L      
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSA 865

Query: 746  NKGEL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----NELDNWNAPLIMA 795
            N  EL     E     N+   L+A     ++ +  +V   C+      +  N N+   MA
Sbjct: 866  NDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAMA 924

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1044

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQD---KGLLPYAIMETANEILGPLEE 972
            YGGD +D  +     Q           +    +N D   K   P A++E  +       E
Sbjct: 1045 YGGDAVDVTQESHMTQ-----------FKFCADNYDALLKKYNPAALIEHLD------VE 1087

Query: 973  RLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLL 1032
              ++Y       ++    K E V  Y +++  Y  +    N                   
Sbjct: 1088 SALKYSKKALKHRK----KTEKVPHY-SQKVKYDPVVSKFN------------------- 1123

Query: 1033 EPPAKELQGIDPDETVPDNVKT---SVSQLYR----ISEKSVRKFLEIALFKYRKARLEP 1085
              P+K L  +   E   D +++   S + L++    +SEK  R  +++   KY ++ + P
Sbjct: 1124 --PSKYLGSV--SENFQDKLESFIDSNNDLFKSRDTVSEKKFRALMQL---KYMRSLINP 1176

Query: 1086 GTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAV 1144
            G A+G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   
Sbjct: 1177 GEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLP 1236

Query: 1145 LVNDNDERAARVVKGRVEKTLLSDVAFYVQ 1174
            ++ D  +  A      V K +LS+V   V+
Sbjct: 1237 ILADVTDPQADTFCKSVTKVMLSEVVDRVE 1266

 Score = 89.4 bits (220), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            V++ + +I R V    ++GKR L+ EG   +++   D  I  +  T+N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 64/138 (46%), Gaps = 13/138 (9%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  ++A DI   S ++++   + D      P + G  D  +G    +L CATC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELRRPGV 132
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++  ++  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK---- 123

Query: 133 DNLRRMGILKKILDQCKK 150
             L + G    ++D+C K
Sbjct: 124 --LLQYG----LIDECYK 135

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  432 bits (1110), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 304/971 (31%), Positives = 484/971 (49%), Gaps = 131/971 (13%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS + ++   ++++ L   L++I+ TS LI+              +  D+ I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S            N  GKV P+ G  Q L+ K+G FR ++
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTK-------AQGNTSGKV-PVPGVKQALEKKEGLFRKHM 470

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNGPNVHP 428
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT +N  +L++ ++NGP+  P
Sbjct: 471  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWP 530

Query: 429  GANYLLKRNEDARR----NLRYGDRMKLAKNLQ-----------IGDVVERHLEDGDVVL 473
            GA  +  +NED        +    R  LA  L            +   V RH+++ D+V+
Sbjct: 531  GATQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVI 588

Query: 474  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 589  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 648

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SDGIE- 588
            NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q +       DG   
Sbjct: 649  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHAT 708

Query: 589  --HFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVFVPPKSKSLPNE 644
                   PPA+MKP  LWTGKQ+ + ++  N   P +  INL + NK+      K     
Sbjct: 709  RAKLATVPPAVMKPVPLWTGKQIITTVLL-NITPPDMPGINLKSSNKIKNDYWGKG---- 763

Query: 645  MSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARF 704
               N+  VI +  ++L G++DKS  G   K+ + + +   YGP  +A A++ + +L   +
Sbjct: 764  --SNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNY 820

Query: 705  LGNRGFSIGINDVTPADDLKQKKEEL----VEIAYHKCDELITL-----FNKGEL----- 750
            +    F+ G++D+   ++  + ++E+    V+       E+  L      N  EL     
Sbjct: 821  ITATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLE 880

Query: 751  ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI--NELDNW--NAPLIMATCGSKGSTLNV 806
            E     N+   L+A     ++ +  +V   C+    +  +  N+   MA  G+KGS +NV
Sbjct: 881  EIIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPENSMQSMALSGAKGSNVNV 940

Query: 807  SQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAI 866
            SQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P E+ FH +
Sbjct: 941  SQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGIRPQEYYFHCM 1000

Query: 867  SGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEM 926
            +GREGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q  YGGD +D  + 
Sbjct: 1001 AGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLYGGDAIDVTK- 1059

Query: 927  EGNAQPVNFNRSWDHAYNITFNNQD---KGLLPYAIMETANEILGPLEERLVRYDNSGCL 983
                       S    +N    N D   K   P A++E  +       E  ++Y      
Sbjct: 1060 ----------ESHLTKFNFCLENYDALLKKYNPSALIEHLD------VETALKYSKKSLK 1103

Query: 984  VKREDLNKAEYVD--QYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQG 1041
             +++   +A Y    +YD     Y+                            PAK L  
Sbjct: 1104 YRKKHAKEAHYQQTVKYDPILSKYN----------------------------PAKYLGS 1135

Query: 1042 IDPD-ETVPDNVKTSVSQLYRISEK-SVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGE 1099
            +  + +   +N     S+L +  E  + +KF  +   KY ++ + PG A+G I +QS+GE
Sbjct: 1136 VSENFQDQLENFLHDNSKLLKSHEDVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGE 1195

Query: 1100 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVK 1158
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A    
Sbjct: 1196 PSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLPILDDVTDEQADTFA 1255

Query: 1159 GRVEKTLLSDV 1169
              + K +LS+V
Sbjct: 1256 KSISKVVLSEV 1266

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 89/167 (53%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEG------YGLRDVMCTDGVIGSRTTTNHVLEVFS 1324
            V++ +P I R V    ++GKR L+ EG      +   D +  DG+      +N V  V  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGI-----RSNDVSAVLK 1549

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
              G+EAAR +++ EIN   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTGSF V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++FS L++ DI + S  ++    + D      P + G  D  +G    +L C TC  
Sbjct: 11  ITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +PV++  +F      L+  C  C    L   +  +F  +L+
Sbjct: 68  DEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  431 bits (1107), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 309/985 (31%), Positives = 492/985 (49%), Gaps = 136/985 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED        + +  R  LA  L           +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM---SDGI---EHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG          PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIK 756

Query: 634  VPPKSK-SLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                 K SL +E       V+ +   +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLESE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 693  AMNRMAKLCARFLGNRGFSIGINDV---------------TPADDLKQKKEELVEIAYHK 737
             ++ + +L   ++    F+ G++D+               T  D  +Q   E+  +    
Sbjct: 809  VLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKET 868

Query: 738  CDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPL----I 793
              +   L  + + E     N+   L+A     ++ +  +V   C+ +      P      
Sbjct: 869  PSDDPELLKRLQ-EILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQA 927

Query: 794  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 853
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+
Sbjct: 928  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFY 987

Query: 854  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQ 913
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++Q
Sbjct: 988  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQ 1047

Query: 914  FTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEER 973
            F YGGD +D   +   +    F    D+ Y +        L+ +  +E+A          
Sbjct: 1048 FMYGGDAVD---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESA---------- 1094

Query: 974  LVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLE 1033
             ++Y               +Y  ++  E  +  S++         LA             
Sbjct: 1095 -LKYSKKTL----------KYRKKHSKEPHYKQSMK-----YDPVLAKY----------- 1127

Query: 1034 PPAKELQGIDPDETVPDNVKTSV---SQLYR----ISEKSVRKFLEIALFKYRKARLEPG 1086
             PAK L  +   E   D +++ +   S+L++    ++EK  R  +++   KY ++ + PG
Sbjct: 1128 SPAKYLGSV--SENFQDKLESFLDENSKLFKSTDGVNEKKFRALMQL---KYMRSLINPG 1182

Query: 1087 TAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVL 1145
             A+G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   +
Sbjct: 1183 EAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPI 1242

Query: 1146 VND-NDERAARVVKGRVEKTLLSDV 1169
             +D +DE+A    K  + K LLS+V
Sbjct: 1243 WDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++GKR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  430 bits (1106), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 294/923 (31%), Positives = 470/923 (50%), Gaps = 128/923 (13%)

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGR 363
            D+ I  + +M  +  +Q  V  +I+S              GGK+ PI G  Q L+ K+G 
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTK-------AQGTAGGKL-PIPGVKQALEKKEGL 474

Query: 364  FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNG 423
            FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ ++NG
Sbjct: 475  FRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVING 534

Query: 424  PNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVVERHLEDG 469
            P+  PGA  +  +NED        +    R  LA  L           +   V RH+++ 
Sbjct: 535  PDKWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLMTPSSNITTHTLNKKVYRHIKNR 592

Query: 470  DVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 528
            D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E AR
Sbjct: 593  DIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENAR 652

Query: 529  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDR--------------- 573
            AEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R               
Sbjct: 653  AEASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPED 712

Query: 574  --ATLTQLLSMMSDGIEHFDIPPPAIMKPYYLWTGKQVFS---LLIKPNHNSPVVINLDA 628
              AT ++L++M           PP I KP  LWTGKQ+ S   L I P  N P  INL +
Sbjct: 713  GHATRSKLITM-----------PPTIHKPVPLWTGKQIISTVLLNITP-ANMPG-INLKS 759

Query: 629  KNKVFVPPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQ 688
             NK+    K++       +N+  V+ +  ++L G++DKS  G   K  + +++   YGP 
Sbjct: 760  SNKI----KNEYWGTGSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPS 812

Query: 689  EAANAMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDEL---ITLF 745
             AA  ++ + +L   ++ +  F+ G++D+   ++  + + ++++ +     E    +T  
Sbjct: 813  VAAKVLSVLGRLFTNYIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNL 872

Query: 746  NKGELETQPGC-----------NEEQTLEAKIGGLLSKVREEVGDVCINELDN----WNA 790
            +K      P             N+   L+A     ++ +  +V   C+ +       +N+
Sbjct: 873  DKDTPANDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNS 932

Query: 791  PLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRN 850
               MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+ 
Sbjct: 933  MQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKG 992

Query: 851  SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANG 910
             F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   
Sbjct: 993  RFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGT 1052

Query: 911  IVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPL 970
            ++QF YGGD +D   +   +    F+   D+ Y+   N  +    P A++E  +      
Sbjct: 1053 LIQFLYGGDAVD---VTKESHMTEFDFCLDN-YDALLNKYN----PSALIEHLD------ 1098

Query: 971  EERLVRYDNSGCLVKREDLNKAEYVD--QYDAERDFYHSLREYINGKATALANLRKSRGM 1028
             E  ++Y       +++ + +  Y    +YD        L ++   K     + +    +
Sbjct: 1099 VESALKYSKKSLKNRKKHIKEPHYKQNIKYDP------VLSKFNPAKYLGSVSEKFQDKL 1152

Query: 1029 LGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTA 1088
             G L+  +K  +  D                  ++EK  R  +++   KY ++ + PG A
Sbjct: 1153 EGYLDKNSKLFKSHDS-----------------VNEKKFRALMQL---KYMRSLINPGEA 1192

Query: 1089 IGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVN 1147
            +G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + N
Sbjct: 1193 VGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWN 1252

Query: 1148 D-NDERAARVVKGRVEKTLLSDV 1169
            D +DE+A    K  + K +LS+V
Sbjct: 1253 DVSDEQADTFCKS-ISKVVLSEV 1274

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            +++ +P I R +    ++GKR L+ EG     +   +  I     T+N V  V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  L++ +I   S  +++   + D      P   G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  429 bits (1104), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 309/987 (31%), Positives = 491/987 (49%), Gaps = 140/987 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM---SDGIEHFD---IPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG    +     PPAI KPY LWTGKQ+ + ++  N   P +  INL + NK+ 
Sbjct: 698  GCIRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISTNKIK 756

Query: 634  VPPKSK-SLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                 K SL NE       V+ +   +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLENE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 693  AMNRMAKLCARFLGNRGFSIGINDV---------------TPADDLKQKKEELVEIAYHK 737
             ++ + +L   ++    F+ G++D+               T  D  +Q   E+  +    
Sbjct: 809  VLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDT 868

Query: 738  CDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPL----I 793
              +   L  + + E     N+   L+A     ++ +  +V   C+ +      P      
Sbjct: 869  PADDAELLKRLQ-EILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQA 927

Query: 794  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 853
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+
Sbjct: 928  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFY 987

Query: 854  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQ 913
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQ
Sbjct: 988  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQ 1047

Query: 914  FTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEER 973
            F YGGD +D   +   +    F    D+ Y +        L+ +  +E+A          
Sbjct: 1048 FMYGGDAVD---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESA---------- 1094

Query: 974  LVRYDNSGCLVKREDLNKAEYVD--QYDAERDFYHSLREYINGKATALANLRKSRGMLGL 1031
             ++Y       +++   +  Y    +YD     Y+                         
Sbjct: 1095 -LKYSKKTLKYRKKHSKEPHYKQAVKYDPVLAKYN------------------------- 1128

Query: 1032 LEPPAKELQGIDPDETVPDNVKTSV---SQLYR----ISEKSVRKFLEIALFKYRKARLE 1084
               PAK L  +   E   D +++ +   S+L++    ++EK  R  +++   KY ++ + 
Sbjct: 1129 ---PAKYLGSV--SENFQDKLESFLDKNSKLFKSADGVNEKKFRALMQL---KYMRSLIN 1180

Query: 1085 PGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINA 1143
            PG A+G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +  
Sbjct: 1181 PGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTL 1240

Query: 1144 VLVND-NDERAARVVKGRVEKTLLSDV 1169
             + +D +DE+A    K  + K LLS+V
Sbjct: 1241 PIWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 89.0 bits (219), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++GKR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +++ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  429 bits (1103), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 302/983 (30%), Positives = 486/983 (49%), Gaps = 130/983 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S           + GG  V P  G  Q 
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGGNDVIP--GVKQA 461

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 462  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAEL 521

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 522  RQAVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKV 579

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 580  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 639

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAE++ L    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 640  PQNENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 699

Query: 582  MM---SDGIE---HFDIPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                  DG          PP I KP  LWTGKQ+ + +L+    +    INL +KNK+  
Sbjct: 700  GCIRPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKI-- 757

Query: 635  PPKSKSLPNEM---SQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAA 691
                    NE      N+  VI +   +L G++DK+  G  K + + +++   YGP  AA
Sbjct: 758  -------KNEYWGKGSNENEVIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDVAA 809

Query: 692  NAMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---HKCDELITLFNKG 748
              ++ + +L   ++    F+ G++D+   D+  + + ++++ +     +    +T  +K 
Sbjct: 810  KVLSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKD 869

Query: 749  ELETQPGC-----------NEEQTLEAKIGGLLSKVREEVGDVCI----NELDNWNAPLI 793
                 P             N+   L+A     ++ +  +V   C+     +   +N+   
Sbjct: 870  TPADDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQA 929

Query: 794  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 853
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+
Sbjct: 930  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFY 989

Query: 854  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQ 913
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++
Sbjct: 990  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIE 1049

Query: 914  FTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQD---KGLLPYAIMETANEILGPL 970
            F YGGD +D  +            S+   +     N D   K   P A++E  N      
Sbjct: 1050 FLYGGDAVDVTK-----------ESYMTQFKFCLENYDGLVKKYNPSALIEHLN------ 1092

Query: 971  EERLVRYDNSGCLVKREDLNKAEYV--DQYDAERDFYHSLREYINGKATALANLRKSRGM 1028
             E  ++Y       +++  +   Y+   +YD                   LA    S+ +
Sbjct: 1093 VESALKYSKKALKYRKKHSSVPHYLQNSKYDP-----------------VLAKYNPSKYL 1135

Query: 1029 LGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTA 1088
              + E    +L+     E + +N K  V     ++EK  R  +++   KY ++ ++PG +
Sbjct: 1136 GSVSEKFQDKLE-----EFLNENSKL-VKSTEGVNEKKFRALMQL---KYMRSLIDPGES 1186

Query: 1089 IGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVN 1147
            +G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N  ++N
Sbjct: 1187 VGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLPILN 1246

Query: 1148 DNDERAARVVKGRVEKTLLSDVA 1170
            D   + A      + K LLS V 
Sbjct: 1247 DVSNQQAETFCKSITKVLLSQVT 1269

 Score = 92.8 bits (229), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            V++ +P+I R V    ++G R L+ EG   + +   D  I   + T+N V  V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    + + +   S  I+LG+  ++GTGSF ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  LS+  I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGQ 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   D   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  429 bits (1103), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 298/924 (32%), Positives = 462/924 (50%), Gaps = 130/924 (14%)

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGR 363
            D+ +  + +M  +  +Q  V  +I+S              GGKV PI G  Q L+ K+G 
Sbjct: 418  DRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGTTGGKV-PIPGVKQALEKKEGL 469

Query: 364  FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNG 423
            FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ ++NG
Sbjct: 470  FRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVING 529

Query: 424  PNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVVERHLEDG 469
            P+  PGA  +  +NED        +    R  LA  L           +   V RH+++ 
Sbjct: 530  PDKWPGAAQI--QNEDGSLVSLVGMSAEQRKALANQLMTPSSNVGTHTLNKKVYRHIKNR 587

Query: 470  DVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 528
            D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E AR
Sbjct: 588  DIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENAR 647

Query: 529  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SD 585
            AEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +       D
Sbjct: 648  AEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPED 707

Query: 586  GIEHFDIP-----PPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFVPPKSK 639
            G  H   P     PP I KP  LWTGKQ+ S +L+         INL + NK+       
Sbjct: 708  G--HATRPKLITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI------- 758

Query: 640  SLPNEM---SQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNR 696
               NE    S N+  V+ +  ++L G++DKS  G   K  + +++   YGP  AA  ++ 
Sbjct: 759  --KNEYWGKSSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSV 815

Query: 697  MAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELI---------TLFNK 747
            + +L   ++ +  F+ G++D+  +++  + + ++++ +     E           T  + 
Sbjct: 816  LGRLFTNYIMSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADD 875

Query: 748  GEL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDN----WNAPLIMATCG 798
             EL     E     N+   L+A     ++ +  +V   C+ +       +N+   MA  G
Sbjct: 876  AELLKRLEEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSG 935

Query: 799  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 858
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P
Sbjct: 936  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKP 995

Query: 859  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGG 918
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGG
Sbjct: 996  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGG 1055

Query: 919  DGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEERLVRYD 978
            D +D  +            S    ++   +N D  L  Y                     
Sbjct: 1056 DAVDVTK-----------ESHMTEFDFCLDNYDALLNKY--------------------- 1083

Query: 979  NSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATAL----ANLRKSRGMLGLLEP 1034
                       N +  ++  D E    +S +   N K  A      N  K   +L     
Sbjct: 1084 -----------NPSALIEHLDVETALKYSKKTLKNRKKHAKEAHHKNATKYDPVLSKFN- 1131

Query: 1035 PAKELQGIDPDETVPDNVKTSV---SQLYR----ISEKSVRKFLEIALFKYRKARLEPGT 1087
            PAK L  +   E   D +++ +   S+L++    +SEK  R  +++   KY ++ + PG 
Sbjct: 1132 PAKYLGSV--SEKFQDKLESYLDKNSKLFKSHDNVSEKKFRALMQL---KYMRSLINPGE 1186

Query: 1088 AIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLV 1146
            A+G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + 
Sbjct: 1187 AVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIW 1246

Query: 1147 ND-NDERAARVVKGRVEKTLLSDV 1169
             D +DE+A    K  + K +LS+V
Sbjct: 1247 QDVSDEQADTFCKS-ISKVVLSEV 1269

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++GKR L+ EG     +   +  I     T+N V  V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++F  L++ +I   S  +++   + D      P + G  D  +G    +L C++C  
Sbjct: 11  ITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C  + L + +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  417 bits (1072), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 308/979 (31%), Positives = 492/979 (50%), Gaps = 124/979 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ I  N +M  +  +Q  V  +I+S         GS+  GGKV PI G  Q 
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GST--GGKV-PIPGVKQA 439

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  ++
Sbjct: 440  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEM 499

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 500  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKV 557

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 558  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 617

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E AR+EA  L    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 618  PQNENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 677

Query: 582  MM---SDGI---EHFDIPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                  DG          PPA++KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 678  GCIRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI-- 735

Query: 635  PPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++       +N+  VI +   +L G++DKS  G   K+ + +++   YGP  ++  +
Sbjct: 736  --KNEYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVL 790

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPAD-------DLKQKKEELVEIAYHKCDEL------ 741
            + + +L   ++ +  F+ G++D+   D       D+ +K  ++   A  +   L      
Sbjct: 791  SILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRP 850

Query: 742  --ITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDN----WNAPLIMA 795
                L  + E E     N+   L+A     ++ +  EV   C+ +       +N+   MA
Sbjct: 851  DDAELLKRLE-EILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMA 909

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG
Sbjct: 910  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSG 969

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF 
Sbjct: 970  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFL 1029

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLE-ERL 974
            YGGD +D  +            S    +    +N D  L  Y      + ++  L+ E  
Sbjct: 1030 YGGDAIDVTK-----------ESHMSEFKFCVDNYDALLKRY----NPSALIQHLDVESA 1074

Query: 975  VRYDNSGCLVKREDLNKAEYV--DQYDAERDFYHSLREYINGKATALANLRKSRGMLGLL 1032
            ++Y       ++++LN   Y   D+YD                   L+    S+ +  + 
Sbjct: 1075 LKYSKKAMKNRKKNLNLPHYARHDKYDP-----------------VLSKYNPSKFLGSVS 1117

Query: 1033 EPPAKELQG-IDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGA 1091
            E    +L+  ID + ++     T       ++EK  R  +++   KY ++ + PG A+G 
Sbjct: 1118 ENFQDKLESFIDSNASLFKGQAT-------VNEKKFRALMQL---KYMRSLINPGEAVGI 1167

Query: 1092 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDND 1150
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  
Sbjct: 1168 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVT 1227

Query: 1151 ERAARVVKGRVEKTLLSDV 1169
            +  A +      K +LS+V
Sbjct: 1228 DETADIFCKNTTKVILSEV 1246

 Score = 92.0 bits (227), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 91/162 (56%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            V+K +P+I R V    ++GKR L+ EG   + +   +  I  +  T+N V  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  ++LG+  S+GTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++FS +SAA+I A S  +++   + D      P   G  D  +G    +L CATC  
Sbjct: 11  ISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P +   +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  413 bits (1062), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 303/983 (30%), Positives = 484/983 (49%), Gaps = 132/983 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+          
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  D+ +  N +M  +  +Q  V  +I+       +     N GGKV PI G  Q 
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFID-------VTKAQGNTGGKV-PIPGVKQA 448

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 449  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEL 508

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 509  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKV 566

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 567  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 626

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 627  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 686

Query: 582  MM---SDGI---EHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG          PPA++KP  LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 687  GCIRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKI- 744

Query: 634  VPPKSKSLPNEM---SQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEA 690
                     NE      N+  VI +  ++L G++DKS  G   K  + +++   YGP  A
Sbjct: 745  --------KNEYWGEGSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIA 795

Query: 691  ANAMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEEL----VEIAYHKCDELITLFN 746
               ++ + +L   ++    F+ G++D+   ++  + + E+    V+I      E+  L  
Sbjct: 796  GKVLSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNL-- 853

Query: 747  KGEL------------ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDN----WNA 790
            +G++            E     N+   L+A     ++ +  +V   C+ +       +N+
Sbjct: 854  EGDVKADDPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNS 913

Query: 791  PLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRN 850
               MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++ 
Sbjct: 914  MQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKG 973

Query: 851  SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANG 910
             F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     
Sbjct: 974  RFYSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGT 1033

Query: 911  IVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQD---KGLLPYAIMETANEIL 967
            ++QF YGGD +D  +            S    +    +N D   K   P A++E  +   
Sbjct: 1034 LIQFLYGGDAVDVTK-----------ESHMTEFKFCVDNYDALLKKYNPSALIEHLD--- 1079

Query: 968  GPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRG 1027
                E  ++Y         ++  K E +  Y     +   L +Y   K     +      
Sbjct: 1080 ---VESALKYSKKAM----KNRKKNEKIPHYAHNIKYDPVLSKYNPSKYLGSVSENFQDK 1132

Query: 1028 MLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGT 1087
            +   ++  +K L+  D                  ++EK  R  +++   KY ++ + PG 
Sbjct: 1133 LEKFIDSNSKLLKSKD-----------------NVNEKKFRALMQL---KYMRSLINPGE 1172

Query: 1088 AIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLV 1146
            A+G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++
Sbjct: 1173 AVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIL 1232

Query: 1147 NDNDERAARVVKGRVEKTLLSDV 1169
             D  +  A      + K +LS+V
Sbjct: 1233 PDVTDDQADTFCKSITKVMLSEV 1255

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGIE 1329
            V+  +P+I R V    ++GKR L+ EG   + +   +  I  +  T+N V  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++FS L+A +I   S  +++   + D      P + G  D  +G    +L CATC  
Sbjct: 11  IISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  379 bits (974), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 294/994 (29%), Positives = 476/994 (47%), Gaps = 154/994 (15%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIPGVKQA 454

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ ++NGP+  PGA+ +  +NED        +    R  LA  L           +   V
Sbjct: 515  RQAVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKV 572

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 692

Query: 582  MMSDGIEHFDIP-------PPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVF 633
                  EH           PPA+ KP  LWTGKQ+ + +L+    +    INL++ NK+ 
Sbjct: 693  GCIRP-EHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI- 750

Query: 634  VPPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
               K++   N  ++ND  VI +  ++L G++DKS  G   K+ + +++   YGP  AA  
Sbjct: 751  ---KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKV 804

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQ 753
            ++ + +L   ++    F+ G++D+   D+  + ++++++ +     +        E ET 
Sbjct: 805  LSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVTNLEKETA 864

Query: 754  PGCNE-----EQTL-------------EAKIGGLLSKVREE-VGDVCINELDNWNAPLIM 794
               +E     E+ L              +K+  + SKV  + V D  + +   +N+   M
Sbjct: 865  SDDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAM 923

Query: 795  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFS 854
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+S
Sbjct: 924  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYS 983

Query: 855  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQF 914
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF
Sbjct: 984  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQF 1043

Query: 915  TYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILG------ 968
             YGGD +D   +   +    F    ++  ++        L+ +  +ETA +         
Sbjct: 1044 LYGGDSVD---VTKESHLTQFEFCLENYDSLLKKYNPSALIEHLDVETALKYSKKASKSR 1100

Query: 969  ------PLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATAL--- 1019
                  P  E+ ++YD +  L K    N A+Y+        F   L  +++  A+     
Sbjct: 1101 KKNRKVPHYEQNIKYDPA--LAK---FNPAKYLGA--VSEKFQDKLELFLDSNASLFESD 1153

Query: 1020 --ANLRKSRGMLGLLEPPAKELQG-IDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALF 1076
               N +K R ++ L     K ++  I+P E+V      SV                    
Sbjct: 1154 KSVNEKKFRALMQL-----KYMRSLINPGESVGIIASQSVG------------------- 1189

Query: 1077 KYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKV 1135
                   EP T +        G     +TL               G+PR++EII  AS  
Sbjct: 1190 -------EPSTQMTLNTFHFAGHGAANVTL---------------GIPRMREIIMTASAA 1227

Query: 1136 ISTPIINAVLVNDNDERAARVVKGRVEKTLLSDV 1169
            I TP +   +++D  +  A V    + K LLS+V
Sbjct: 1228 IKTPQMTLPILDDVSDDQADVFSKSISKVLLSEV 1261

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 1270 VVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SRTTTNHVLEVFSVLGI 1328
             V++ +P I R V    ++GKR L+ EG   + +   +  IG    T+N V  V    G+
Sbjct: 1488 TVIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGV 1547

Query: 1329 EAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1388
            EAAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S
Sbjct: 1548 EAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-S 1606

Query: 1389 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            +E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1607 YETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHG 72
           I  ++FS L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 129/290 (44%), Gaps = 29/290 (10%)

Query: 7   SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSL 65
           S  P R IK ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G    ++
Sbjct: 7   SSAPVRTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNV 65

Query: 66  ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLH 125
           +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL E ++ Q   
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNE-QMNQ 124

Query: 126 ELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFRW 185
            ++    D  +R   +  +   CK +   + C                        T R 
Sbjct: 125 AIKIK--DPKKRFNAVWTL---CKTK---MICETDVPSEDDPTKLVSRGGCGNAQPTIRK 176

Query: 186 VGKKSAPEKDIWVGEWKEVLAHN--PELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
            G K        VG WK+    N   E E+ V      L+  + LN+FK I S D   LG
Sbjct: 177 DGLK-------LVGSWKKDKNTNDGDEPEQRV------LSTEEILNIFKHISSEDYIRLG 223

Query: 244 IDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIV 293
            +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+
Sbjct: 224 FNEEF--ARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>Suva_13.410 Chr13 complement(702373..703176) [804 bp, 267 aa] {ON}
            YMR226C (REAL)
          Length = 267

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 60/129 (46%), Gaps = 7/129 (5%)

Query: 1014 GKATALANLRKSRGMLGLLEPPAKELQGIDP-----DETVPDNVKTSVSQLYRISEKSVR 1068
            GKATAL  L  S G + L+   A+ L+ ++      DE  P N K  V QL     + ++
Sbjct: 26   GKATALEYLEASNGNMKLI-LAARRLEKLEELKKTIDEEFP-NAKVHVGQLDITQAEKIK 83

Query: 1069 KFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1128
             F+E     ++   +    A  A+G++ +GE  TQ     F     A +NVT  V  I +
Sbjct: 84   PFIENLPEAFKDIDILINNAGKALGSERVGEIATQDIQDVFDTNVTALINVTQAVLPIFQ 143

Query: 1129 IINASKVIS 1137
              N+  +++
Sbjct: 144  AKNSGDIVN 152

>KLTH0B07436g Chr2 (600260..603043) [2784 bp, 927 aa] {ON} some
            similarities with uniprot|P32797 Saccharomyces cerevisiae
            YDL220C CDC13 Single stranded DNA- binding protein found
            at TG1-3 telomere G-tails regulates telomere replication
            through recruitment of specific sub- complexes but the
            essential function is telomere capping
          Length = 927

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 53/96 (55%), Gaps = 8/96 (8%)

Query: 975  VRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEP 1034
            V +DN   LVK  D +KA++  ++   +++  ++R+YI  +  ++ +L++   + GLL+P
Sbjct: 165  VIFDN---LVKLNDNSKAQF--KFVKLQNYDTAMRKYIQSRQESMLSLKEKNPLFGLLKP 219

Query: 1035 PAKELQGIDPDETVPD---NVKTSVSQLYRISEKSV 1067
             A      D D  +PD   N+  ++   +RI  +S+
Sbjct: 220  RADHDSQNDFDSQLPDPDSNLDNAIFYGHRIPSESL 255

>Smik_13.434 Chr13 complement(705526..706329) [804 bp, 267 aa] {ON}
            YMR226C (REAL)
          Length = 267

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 7/129 (5%)

Query: 1014 GKATALANLRKSRGMLGLLEPPAKELQGIDP-----DETVPDNVKTSVSQLYRISEKSVR 1068
            GKATAL  L  S G + L+   A+ L+ ++      DE  P N K  V++L     + ++
Sbjct: 26   GKATALEYLEASNGDMKLI-LAARRLEKLEELKKTIDEEFP-NAKVHVTKLDITQTEKIK 83

Query: 1069 KFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1128
             F+E    +++   +    A  A+G   +GE  TQ     F     A +NVT  V  I +
Sbjct: 84   PFIENLPEEFKDIDILVNNAGKALGTDRVGEIDTQDVQDVFDTNVSALINVTQAVLPIFQ 143

Query: 1129 IINASKVIS 1137
              N+  +++
Sbjct: 144  AKNSGDIVN 152

>YMR226C Chr13 complement(721593..722396) [804 bp, 267 aa] {ON}
            NADP(+)-dependent dehydrogenase; acts on serine,
            L-allo-threonine, and other 3-hydroxy acids; green
            fluorescent protein fusion protein localizes to the
            cytoplasm and nucleus; may interact with ribosomes, based
            on co-purification experiments
          Length = 267

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 61/129 (47%), Gaps = 7/129 (5%)

Query: 1014 GKATALANLRKSRGMLGLLEPPAKELQGIDP-----DETVPDNVKTSVSQLYRISEKSVR 1068
            GKATAL  L  S G + L+   A+ L+ ++      D+  P N K  V+QL     + ++
Sbjct: 26   GKATALEYLEASNGDMKLI-LAARRLEKLEELKKTIDQEFP-NAKVHVAQLDITQAEKIK 83

Query: 1069 KFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKE 1128
             F+E    +++   +    A  A+G+  +G+  T+     F     A +N+T  V  I +
Sbjct: 84   PFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAVLPIFQ 143

Query: 1129 IINASKVIS 1137
              N+  +++
Sbjct: 144  AKNSGDIVN 152

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 267 CIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMY 326
           C +   ++ + P  + + +    T   +TS L+   L     +   + H+DY++ +    
Sbjct: 160 CDKSLTVLSNMPEESVETIKNLSTTTFYTSPLMSTYL-----VAWAIGHYDYIEDSTEKK 214

Query: 327 INSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPN 386
           I        +  GSS   G + PIR F  + K  QGRF  N++ + VD        P P 
Sbjct: 215 IYPTLDGYDIRDGSSGTKGSL-PIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPL 273

Query: 387 LSIDEVAV 394
             +D V V
Sbjct: 274 PKLDIVCV 281

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 150,395,043
Number of extensions: 6596977
Number of successful extensions: 16984
Number of sequences better than 10.0: 70
Number of HSP's gapped: 17054
Number of HSP's successfully gapped: 178
Length of query: 1460
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1338
Effective length of database: 39,492,147
Effective search space: 52840492686
Effective search space used: 52840492686
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)