Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR007C (SGT2)6.21ON34634616840.0
Smik_15.1766.21ON34534515400.0
Skud_15.1686.21ON34834815050.0
Suva_15.1826.21ON34634614190.0
SAKL0E01210g6.21ON32332910151e-138
TDEL0G044806.21ON3433429761e-131
Kpol_1037.266.21ON3423399711e-131
Kwal_56.224336.21ON3223309631e-130
ZYRO0C07788g6.21ON3343239541e-128
CAGL0E02739g6.21ON3433229521e-128
KNAG0M011706.21ON3393329461e-127
TPHA0J003406.21ON3383439451e-127
NCAS0H008306.21ON3383419271e-124
NDAI0D008106.21ON3493429181e-122
KLTH0C11220g6.21ON3273318961e-119
KAFR0L004106.21ON3313388951e-119
Ecym_30256.21ON3183308411e-111
TBLA0G010506.21ON3503328421e-111
KLLA0D01155g6.21ON3353447981e-104
ACR005W6.21ON3273417329e-95
Kpol_1032.86.21ON3433555965e-74
TPHA0M002706.21ON3773634158e-47
NDAI0I022406.21ON3503423867e-43
TBLA0A072706.21ON3733363608e-39
NCAS0D026706.21ON3512343581e-38
CAGL0H08195g5.617ON5831032279e-20
TPHA0D028805.617ON5852302208e-19
NDAI0F009105.617ON5831032199e-19
Kwal_55.199355.617ON5931952172e-18
NCAS0G008105.617ON5842292163e-18
KNAG0B032005.617ON5792312145e-18
KAFR0C058905.617ON5751042127e-18
Smik_15.2055.617ON5891032127e-18
Kpol_1018.695.617ON5901032128e-18
ZYRO0A05676g5.617ON5721032128e-18
SAKL0G07084g5.617ON5852302101e-17
YOR027W (STI1)5.617ON5891032082e-17
KLTH0E02178g5.617ON5931032082e-17
TBLA0E033005.617ON5821032057e-17
KLLA0A07062g5.617ON5811032012e-16
AEL224W5.617ON5801032003e-16
Skud_15.1925.617ON5892371976e-16
Suva_8.805.617ON5861031951e-15
TDEL0A048405.617ON5761031889e-15
Ecym_55825.617ON5841031871e-14
NCAS0A00490singletonON620931853e-14
TBLA0C039503.481ON5121531673e-12
TDEL0D055003.481ON5121581532e-10
Ecym_44133.481ON510791514e-10
TPHA0D032203.481ON5131481504e-10
YGR123C (PPT1)3.481ON513801505e-10
AAR083C3.481ON538881496e-10
NDAI0B057903.481ON523851488e-10
KNAG0A079003.481ON512851471e-09
Smik_6.2153.481ON513761471e-09
Skud_7.4323.481ON513771471e-09
NCAS0F034903.481ON5121591461e-09
CAGL0D05060g3.481ON510791452e-09
KNAG0A039508.506ON3861601415e-09
Kpol_505.413.481ON513841417e-09
Suva_7.4083.481ON513771391e-08
SAKL0F03102g3.481ON513791381e-08
Smik_2.2958.506ON3851451362e-08
KAFR0B066103.481ON511781354e-08
KAFR0E029808.506ON3801881327e-08
Kwal_27.118908.506ON3341601291e-07
YBR155W (CNS1)8.506ON3851451291e-07
NCAS0B024008.506ON3801481282e-07
Suva_4.4058.506ON3851451282e-07
KLTH0F14542g3.481ON5131491273e-07
CAGL0H07425g8.506ON3801841264e-07
AGL268C8.506ON3791591264e-07
KLLA0F24046g2.152ON604711274e-07
Kwal_55.211753.481ON511941231e-06
ZYRO0B04224g3.481ON5131161193e-06
KLLA0B10912g3.481ON512751193e-06
TPHA0L014208.506ON3741851151e-05
KLTH0B05170g2.152ON593871151e-05
Kwal_33.147672.152ON5941011151e-05
Ecym_20906.328ON172621091e-05
SAKL0H10934g8.506ON3801141132e-05
CAGL0L04048g2.152ON587881132e-05
NCAS0G024802.152ON596801132e-05
NCAS0B070102.152ON6251441123e-05
Skud_2.2828.506ON3851451103e-05
TBLA0H033808.506ON3751901104e-05
KLLA0B09966g8.506ON3701821104e-05
TDEL0B013108.506ON3801591086e-05
TBLA0I023106.328ON11663991e-04
TDEL0B051402.152ON5991241061e-04
NDAI0F028102.152ON609801062e-04
KAFR0F007202.152ON608741062e-04
ABR131W2.152ON594711052e-04
Kpol_513.28.506ON3741611042e-04
CAGL0C01903g7.412ON7691051043e-04
Ecym_82042.152ON597711043e-04
KLTH0E11748g8.506ON3781741023e-04
Kpol_1018.1067.412ON753961033e-04
Kpol_1043.605.689ON706571033e-04
ZYRO0F08624g8.506ON3791611014e-04
NDAI0B043402.152ON6641011025e-04
Ecym_25598.506ON370251998e-04
CAGL0L12936g2.152ON6001461008e-04
Skud_8.1782.152ON638101990.001
Smik_2.367.412ON751105980.001
Suva_2.347.412ON763105980.001
ZYRO0G06512g2.152ON604104970.002
YBL084C (CDC27)7.412ON758105980.002
Suva_15.3142.152ON644106950.003
NCAS0E024907.412ON809108950.003
NCAS0I008703.395ON58558950.003
ADR230W5.689ON68570950.003
ZYRO0B03828g7.412ON72796940.004
TPHA0E007407.412ON746103940.004
YHR117W (TOM71)2.152ON639107930.005
KNAG0I025206.328ON11761870.006
KLLA0E20857g7.412ON71087920.007
YNL121C (TOM70)2.152ON61798920.007
YCR060W (TAH1)6.328ON11164850.008
CAGL0K09240g6.328ON14256860.009
KNAG0B012903.395ON53763900.012
Smik_8.1952.152ON635107900.013
SAKL0A01672g6.328ON12852840.014
TBLA0C055302.152ON61065890.016
Skud_14.2112.152ON61765890.019
Ecym_40315.689ON688125880.021
KLLA0C08910g6.328ON11550820.023
TPHA0D038606.328ON12066820.026
Kpol_1048.212.152ON59786870.026
Smik_14.2072.152ON61798870.029
Skud_2.247.412ON769105870.029
SAKL0E10956g2.152ON60071870.031
TBLA0F032203.395ON53663860.033
TDEL0A074306.328ON12463810.034
Suva_14.2192.152ON61798860.035
NDAI0I004406.328ON12840810.036
TDEL0C027207.412ON700104860.046
NCAS0D045006.328ON12169800.050
KNAG0H035302.152ON61473850.053
TBLA0H019705.352ON84083850.061
NDAI0C043205.352ON70668830.095
Suva_16.4173.395ON53964830.10
Kpol_1067.251.456ON391134820.10
TPHA0L012108.470ON58864820.12
CAGL0J09570g8.470ON549145810.15
NCAS0F028705.352ON70081810.17
SAKL0D11110g1.456ON432137800.19
AGL294W7.412ON65696800.19
CAGL0K11209g8.470ON59092800.20
SAKL0E14542g5.689ON69053800.22
NDAI0A081703.395ON53967790.26
Skud_3.1356.328ON11858740.29
CAGL0H07095g5.352ON661114790.30
NDAI0C051308.470ON59087780.34
Kpol_1028.516.328ON11761730.35
Ecym_71427.412ON67596780.37
Smik_3.1596.328ON11555730.38
TPHA0I015102.152ON60371770.49
CAGL0K07986g3.395ON53266770.51
TPHA0G004305.689ON72856770.52
SAKL0H11946g8.470ON573119760.60
Kpol_1006.43.367ON73297760.72
KAFR0J025706.328ON12161710.81
AFR453W8.470ON569132750.89
KAFR0C018505.352ON64664750.90
TBLA0E019907.313ON374156740.91
AAR054C6.328ON13364710.91
ACR173W7.458ON285142740.98
YDR320C (SWA2)5.352ON66887741.0
TDEL0B016608.470ON549134741.1
KLLA0C15455g8.470ON56689741.1
KLTH0F19140g3.32ON924117741.1
KNAG0B022407.412ON739102741.2
Smik_4.4918.470ON61250741.2
NCAS0B025608.470ON57859741.2
Skud_4.5068.470ON61150731.3
YDR244W (PEX5)8.470ON61250731.4
Suva_2.4108.470ON61150731.5
KLTH0F18150g5.689ON68990721.8
Ecym_13968.470ON57387722.0
Smik_4.5795.352ON66790722.2
Kwal_27.117378.470ON575119712.2
CAGL0M08030g1.456ON387139712.2
Kwal_27.107407.412ON62893712.3
Kwal_55.220393.32ON90492712.9
KLTH0E10934g8.470ON56863702.9
NDAI0F004005.689ON76469712.9
KAFR0L018707.412ON71294713.0
SAKL0F12936g7.412ON63296703.0
TDEL0E027505.352ON56466703.0
Skud_4.5865.352ON64281703.5
Suva_3.956.328ON11163663.6
Kpol_1031.648.470ON60799694.0
TBLA0A016908.470ON66250694.4
CAGL0E01573g3.32ON904105694.4
NCAS0A147707.458ON30093684.7
NDAI0J001307.546ON140374694.8
KLTH0A00638g7.546ON141166695.2
Kpol_463.111.267ON784151685.6
CAGL0C03289g4.6ON164871695.7
KAFR0B026408.246ON408129677.5
ZYRO0C02970g3.32ON896106678.1
ZYRO0C17138g3.395ON53626678.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR007C
         (346 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   653   0.0  
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   597   0.0  
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   584   0.0  
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   551   0.0  
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   395   e-138
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   380   e-131
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   378   e-131
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   375   e-130
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   372   e-128
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   371   e-128
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   369   e-127
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   368   e-127
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   361   e-124
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   358   e-122
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   349   e-119
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   349   e-119
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   328   e-111
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   328   e-111
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   311   e-104
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   286   9e-95
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   234   5e-74
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   164   8e-47
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   153   7e-43
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   143   8e-39
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   142   1e-38
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    92   9e-20
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    89   8e-19
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     89   9e-19
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    88   2e-18
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    88   3e-18
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    87   5e-18
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    86   7e-18
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    86   7e-18
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    86   8e-18
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    86   8e-18
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    86   1e-17
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    85   2e-17
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    85   2e-17
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    84   7e-17
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    82   2e-16
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    82   3e-16
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    80   6e-16
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    80   1e-15
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    77   9e-15
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    77   1e-14
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       76   3e-14
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    69   3e-12
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    64   2e-10
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    63   4e-10
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    62   4e-10
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    62   5e-10
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    62   6e-10
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    62   8e-10
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    61   1e-09
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    61   1e-09
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    61   1e-09
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    61   1e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    60   2e-09
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    59   5e-09
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    59   7e-09
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    58   1e-08
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    58   1e-08
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    57   2e-08
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    57   4e-08
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    55   7e-08
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    54   1e-07
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    54   1e-07
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    54   2e-07
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    54   2e-07
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    54   3e-07
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    53   4e-07
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    53   4e-07
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    54   4e-07
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    52   1e-06
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    50   3e-06
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    50   3e-06
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    49   1e-05
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    49   1e-05
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    49   1e-05
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    47   1e-05
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    48   2e-05
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    48   2e-05
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    48   2e-05
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    48   3e-05
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    47   3e-05
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    47   4e-05
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    47   4e-05
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    46   6e-05
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    43   1e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    45   1e-04
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    45   2e-04
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    45   2e-04
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    45   2e-04
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    45   2e-04
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    45   3e-04
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    45   3e-04
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    44   3e-04
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    44   3e-04
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    44   3e-04
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    44   4e-04
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    44   5e-04
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    43   8e-04
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    43   8e-04
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    43   0.001
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    42   0.001
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    42   0.001
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.002
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    42   0.002
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    41   0.003
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    41   0.003
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    41   0.003
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    41   0.003
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    41   0.004
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    41   0.004
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    40   0.005
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    38   0.006
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    40   0.007
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    40   0.007
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    37   0.008
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    38   0.009
KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.3...    39   0.012
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    39   0.013
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    37   0.014
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    39   0.016
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    39   0.019
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    39   0.021
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    36   0.023
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    36   0.026
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    38   0.026
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    38   0.029
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    38   0.029
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    38   0.031
TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {O...    38   0.033
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    36   0.034
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    38   0.035
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    36   0.036
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    38   0.046
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    35   0.050
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    37   0.053
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    37   0.061
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    37   0.095
Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {...    37   0.10 
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    36   0.10 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    36   0.12 
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    36   0.15 
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    36   0.17 
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    35   0.19 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    35   0.19 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    35   0.20 
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    35   0.22 
NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa] ...    35   0.26 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    33   0.29 
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    35   0.30 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    35   0.34 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    33   0.35 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    35   0.37 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.38 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    34   0.49 
CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa] ...    34   0.51 
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    34   0.52 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    34   0.60 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    34   0.72 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    32   0.81 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    33   0.89 
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    33   0.90 
TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.3...    33   0.91 
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    32   0.91 
ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic hom...    33   0.98 
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    33   1.0  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    33   1.1  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    33   1.1  
KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} simi...    33   1.1  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    33   1.2  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    33   1.2  
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    33   1.2  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.3  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    33   1.4  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.5  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    32   1.8  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    32   2.0  
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    32   2.2  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    32   2.2  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    32   2.2  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    32   2.3  
Kwal_55.22039 s55 (1084478..1087192) [2715 bp, 904 aa] {ON} YNL3...    32   2.9  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    32   2.9  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    32   2.9  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    32   3.0  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   3.0  
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    32   3.0  
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...    32   3.5  
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    30   3.6  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    31   4.0  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    31   4.4  
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    31   4.4  
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    31   4.7  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    31   4.8  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    31   5.2  
Kpol_463.11 s463 complement(29915..32269) [2355 bp, 784 aa] {ON}...    31   5.6  
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...    31   5.7  
KAFR0B02640 Chr2 (532692..533918) [1227 bp, 408 aa] {ON} Anc_8.2...    30   7.5  
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    30   8.1  
ZYRO0C17138g Chr3 complement(1330370..1331980) [1611 bp, 536 aa]...    30   8.3  

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/346 (93%), Positives = 325/346 (93%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
           KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
           SQ                     MNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ 346
           GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ 346

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/345 (85%), Positives = 312/345 (90%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M ASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFER+A SGILGKSEF
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
           KG+ LAD+LNSAS+  ESN+KDDA+NVE+NIPE+DAETKAKAEDLKMQGNKAMANKDYEL
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AINKYTEAI+VLPTNAIYYANRAAAHSSL+EYD+AVKDAES+ISIDPSYFRGYSRLGFAK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK VPEQSRDAD +A
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
           SQ                     MNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENK 345
           GF SGGG PNLSDLMNNPALRNMAGNLFGGA A S++ TPD+ENK
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/348 (84%), Positives = 308/348 (88%), Gaps = 2/348 (0%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MSASK EIA+LIVNYFSSIVEKKEISED ADSLNVAMDCISEAFGFEREAV  IL  SEF
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
           KGQ+L D+LNS SRV ES KKDDA+NVE+NIPE+DAE KAKAEDLKMQGNKAMANKDYEL
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AINKYTEAIKVLPTNAIYYANRAAAHSSLK YD+AV+DAESAISIDP+YFRGYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDAD--V 238
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDAD   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 239 DASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQM 298
           DASQ                     MNNPQLMQAAQKMMSNPGAMQNIQKMMQDP+I+QM
Sbjct: 241 DASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300

Query: 299 AEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ 346
           AEGF SGGG PNLSDLMNNPALR+MAGNLFGGAGA ST++T D+ENKQ
Sbjct: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ 348

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/346 (80%), Positives = 305/346 (88%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MSASKEEIA+LIVNYFSSIVEKKE+SED ADSLNVAMDCISEAFGFER+AVS IL KS F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
           KGQ L ++L+S+S++PES KKDDA+NVE+NIPE+DAETKAKAE+LK+QGNKAMANK+YEL
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI KYTEAI VLPTNAIYYANRAAAHSSLKEYD+A+KDAESAIS+DPSYFRGYSRLGFAK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           YAQGKPEEALEAYKKVLDIEGDNAT+AMKRDYESAKK+VEQSLNLEKT PEQ RDA  +A
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGANA 240

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
            Q                     MNNPQLMQAAQKMMSNPGAMQNIQ MMQDPSIRQMAE
Sbjct: 241 GQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300

Query: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ 346
           GF SGGGTPNLSDLM NPALRNMAG+LFGGA A ST++TPD+E KQ
Sbjct: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ 346

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 255/329 (77%), Gaps = 8/329 (2%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M+ S +EIAALIV++ SS VEK  +SED ADSLNVA+DCISEAF FER+AVS I+ K+ F
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIV-KNSF 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
             + L ++L SA+    +     +E V++NIP +DA TKAKAEDLK+QGNKAMA+KD+E 
Sbjct: 60  DNRKLDELLKSAATALPTQ----SEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFET 115

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI KYTEAI+VLP+NA+YYANRAAA+SSLK+Y+++V+DAESAI ++PSY +GYSRLGFAK
Sbjct: 116 AIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           YA GKPEEALEAYK VLDIEGD AT+ MKRDYE+AK+KVEQSLNLEK+VP Q+ + +   
Sbjct: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
                                  +NNPQ+M AAQK+M NPGAM    +MM++P++RQMAE
Sbjct: 236 DAGAGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQMAE 292

Query: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFG 329
            F+SGGGTPNL DLM+NPA+++MA NLFG
Sbjct: 293 NFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  380 bits (976), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 248/342 (72%), Gaps = 5/342 (1%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS S +E+A+LIV+Y S +VEKK +SE+  DSLNVA+DCI E+F  ++     + G    
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFG---- 56

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
            G+ L ++L + S          AE++++NIP +DAETKAKAE LK++GNKAMA KD++L
Sbjct: 57  -GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDL 115

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI KY++AI+VLPTNA+YYANRAAAHSS+K Y++A+KDAESAI  DP+Y +GYSRLG+AK
Sbjct: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           +A G+ E+ALEAYKKVLDIEGD A++ MKRDYE+AKKKVEQSL+LEK    Q+R AD  A
Sbjct: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGA 235

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
                                  +NNPQLMQAAQ+MM NP AM  ++ MMQ+P +RQMAE
Sbjct: 236 GGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAE 295

Query: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDN 342
            FA G G PN+ DLMNNPALR+MAG+LFGGA   + ++ P N
Sbjct: 296 NFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDVPKN 337

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  378 bits (971), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 253/339 (74%), Gaps = 7/339 (2%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS S ++IAALI+++ S++V+K E+SED ADSLNVAMDCI+EAF FER++V+G++ KS F
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVV-KSSF 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
           +G  L+  LN ++    +    D E V++N+ EDD E    AE LK++GNKAMA KDYEL
Sbjct: 60  QGNSLSSYLNGSTSASAATTTAD-ETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYEL 118

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI KYTEAI  LPTNA+Y+ANRAAA+SSLK+YD+AV+DA SAI I+P+Y +GYSRLGFAK
Sbjct: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           +AQGK E+ALEAYKKVLDIEGD ATE MKRDYE+AKKKVEQSLNLEK+    +  A+ D+
Sbjct: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDS 238

Query: 241 SQXXXXXXXXX-----XXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSI 295
           +                           +NNPQLMQAAQ+MM +P AM+ ++ MMQ+PS+
Sbjct: 239 ASAADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSV 298

Query: 296 RQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQ 334
           +QMA+ F+SG GTP+ S LMN+P++R+MA N+FG  G Q
Sbjct: 299 KQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQ 337

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  375 bits (963), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/330 (58%), Positives = 249/330 (75%), Gaps = 11/330 (3%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS S +++A LIV++ S  VE KE+SED  DSLNVA+DCI+EAF F+RE+V+  L K+ F
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKT-F 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
            G+ L  ++ +AS    S +    E+V++NIP +DAETKAKAE LK++GNKAMA KD+E 
Sbjct: 60  AGRSLKQVVEAASVGSSSPQ----ESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           A+ KY+EAI+VLPTNA+YYANRAAAHSSLK+Y++AVKDAE AI ++PSY +GYSRLGFA+
Sbjct: 116 AVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           YA GKPEEAL+AYKKVLDIEG+ AT+AMKRDY++A KKV QSLN+EK+ P  +RD    A
Sbjct: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDG---A 232

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
                                  +NNPQLMQAAQ+MM NP AMQ +   M +P+++QMAE
Sbjct: 233 GSATGSGGLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEV---MNNPAVKQMAE 289

Query: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGG 330
            F SGGGTP+++DLMNNPAL +MA N+FGG
Sbjct: 290 KFQSGGGTPSMADLMNNPALMDMAKNMFGG 319

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  372 bits (954), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 241/323 (74%), Gaps = 9/323 (2%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M+ S ++I++LIV+Y + +V+KK +SED  DSLNVA++CI+EAFG E+ + S   G    
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFG---- 56

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
            G++LA++L++ +  P S      ENV++NIP +DAE K+KAE LK++GNKAMA KDYEL
Sbjct: 57  -GKNLAELLSAGAGAPSSQ----GENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL 111

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI KY+EAI V+PTNA+YYANRAAAHSSLK YD+A+KDAESA+ +D SY +GYSRLG+AK
Sbjct: 112 AIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           +AQGK EEALEAYKKVLDIEGD+AT+ MKRDYE+AK+KVEQ+L L KT   ++ D     
Sbjct: 172 FAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGE 231

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
                                  +NNPQ+MQAAQ+MM NP AM  ++ MMQ+P++RQMAE
Sbjct: 232 PAGANPGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAE 291

Query: 301 GFASGGGTPNLSDLMNNPALRNM 323
            FA G GTPNL+D+MNNPALR+M
Sbjct: 292 KFAGGNGTPNLNDIMNNPALRDM 314

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  371 bits (952), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 193/322 (59%), Positives = 235/322 (72%), Gaps = 6/322 (1%)

Query: 7   EIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEFKGQHLA 66
           E+AA+I+ Y   +V +K + ED  DS+NVA+DCI+E+F  ER  V  +L +S    + L 
Sbjct: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGI-SKGLE 62

Query: 67  DILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYT 126
           + L              +E+V++NIP +DAETKAKAE LK++GNKAMA KD+ELAI KY+
Sbjct: 63  ECLECMK-----GGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYS 117

Query: 127 EAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKP 186
           EAI+VLPTNAIYYANRAAAHSSLK+YD+AV DAE AI IDP+Y +GYSRLGFAKYAQ KP
Sbjct: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177

Query: 187 EEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDASQXXXX 246
           EEALEAYKKV+D+EGD AT+ MKRDYE+AKKKVEQSLNLEKT   +  D+   A      
Sbjct: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGG 237

Query: 247 XXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAEGFASGG 306
                            MNNPQ+MQAAQ+MMSNP A+Q +Q MMQDPSIRQMAE F SG 
Sbjct: 238 AGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGN 297

Query: 307 GTPNLSDLMNNPALRNMAGNLF 328
           GTPN+ DLM+NPALRNMA ++F
Sbjct: 298 GTPNMDDLMSNPALRNMASSMF 319

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  369 bits (946), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 251/332 (75%), Gaps = 5/332 (1%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M+ S +E+++LI++Y + +V K E+S D  DSLNVA+DC++E FG E++ +S  + +S+F
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATI-ESKF 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
            G+ L ++L++AS+   +  +   E V+INIP++DAETKAKAE LK++GNKA+A+KDY+L
Sbjct: 60  NGKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDL 119

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           A+ KYTEAIK+LPTNA+Y+ANRAAA+++ + YD+AVKDAE AI +DP+Y +GYSRL +AK
Sbjct: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           Y Q   EE+LEAYKKVL+IEGD+ATE  KR YE+AKK+VE+SLNLEK+VP +S     + 
Sbjct: 180 YVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNP 239

Query: 241 SQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300
           +                      MNNPQ+MQAAQ MMSNPGAM+ IQ MMQ+P+I+QMAE
Sbjct: 240 A---AGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAE 296

Query: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAG 332
            F  GG TP+ S++MNNPA+RNMA +LF GAG
Sbjct: 297 QF-KGGNTPDFSEMMNNPAVRNMASSLFSGAG 327

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  368 bits (945), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/343 (56%), Positives = 245/343 (71%), Gaps = 22/343 (6%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M+AS +EIAALIV+Y +++V+KKE+S D ADSLNVAMDCI+EAF FER++V   + KS F
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTV-KSAF 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPED--DAETKAKAEDLKMQGNKAMANKDY 118
            G  L   L+ ++            ++++NI +D  D E KA AE LK++GNKAMA KDY
Sbjct: 60  NGNGLTSFLSGSA----------TNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDY 109

Query: 119 ELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGF 178
           E AI KY+EAI+VLPTNA+YYANRAAA+SSLK+YD AV DAESAI ++P+Y +GYSRLGF
Sbjct: 110 ESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169

Query: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVP---EQSRD 235
           AK+AQGK E+AL+AYKKVLDIEGD AT+ MKRDYE+AKKKVEQSLNLEK  P   E   +
Sbjct: 170 AKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESN 229

Query: 236 ADVDASQXXXXXX------XXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKM 289
           AD                                + NPQ+MQAAQ+MM NP AMQ ++ M
Sbjct: 230 ADAGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESM 289

Query: 290 MQDPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAG 332
           MQ+P++RQMAE FASG GTP+LS +MNNP L++MA N+FG  G
Sbjct: 290 MQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGG 332

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  361 bits (927), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 193/341 (56%), Positives = 248/341 (72%), Gaps = 13/341 (3%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS S +E+ +LIV++ S++++ KEISED ADSLNVA+DCI+E+F FER+ V+  L + +F
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTL-QDKF 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
            G+ L +IL+SAS     ++K+  E+V++NIP +DAE KA AE  K++GNKAMA KDY L
Sbjct: 60  SGKTLKEILSSASATSTGSEKE--ESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI KY+EAIK LPTN IYYANRAAA+SS+KEYD A+KDAE AI IDP+Y +GYSRL FAK
Sbjct: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK---TVPEQSRD-- 235
           YA  KPEEALE YKKVLD+EGD AT AMKRD+E AK +VE S+NLEK   T PE SR   
Sbjct: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237

Query: 236 ---ADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 292
              A+  A                       +NNPQ+MQAAQ+MMS+P +MQ +Q+MMQ+
Sbjct: 238 QQPANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQN 297

Query: 293 PSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGA 333
           P++R+MA+  ASG    NL DLMNNP++++MA NLFG  GA
Sbjct: 298 PNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGA 336

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  358 bits (918), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/342 (55%), Positives = 242/342 (70%), Gaps = 15/342 (4%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS + ++I ALIV++ S+I+EK E+SED ADSLNVAMDCISEA  F+RE V   + K++F
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETI-KNKF 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
            G+ L DILN+ S    +   +  E+VE+NIP +DAE KA AE  K++GNKAMA KD+ L
Sbjct: 60  NGKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHL 119

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           A+ KYTEAIK+LPTNAIYYANRAAAHSSLKE+++A+KDAESAI IDPSY +GYSRL FAK
Sbjct: 120 AVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK 179

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKT-VPEQSR----- 234
           Y  GK EEALE+YKKVLDIEGDNAT  MKRDYE+AKK+VE+S+N+EK+  PEQ +     
Sbjct: 180 YGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQT 239

Query: 235 ------DADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQK 288
                 +A    +                      ++NP  M  AQK+MS+P AMQ +Q 
Sbjct: 240 NESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQS 299

Query: 289 MMQDPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGG 330
           MM DPS+R +A  F +G    +++D+MNNPA+RNMA NLF G
Sbjct: 300 MMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLFKG 339

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  349 bits (896), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 185/331 (55%), Positives = 249/331 (75%), Gaps = 8/331 (2%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M+ +K+E+A+LI++Y     E KEI ED  DSLNVA+DC++EAF  E+E+ S ++ KS F
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKS-F 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
            GQ L  I+ ++S+ P + ++   E V++NIP +DAE KAKAE LK++GNKAMA KD+E 
Sbjct: 60  GGQSLEQIVGASSKGPTATQQ---EPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEH 116

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI+KY+EAI+ LP+NA+Y+ANRAAA+SSLK+Y +AV+DAE+AI ++PSY +GYSRLGFA+
Sbjct: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           YA G+PEEAL+AYKKVLDIEG NAT+AMKRDY++A KKVEQSLN+E++ P  S     DA
Sbjct: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA 236

Query: 241 SQXXXXX-XXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMA 299
           +                       + NPQ+MQAAQ+MM NP AM   Q+MM +P+I+QMA
Sbjct: 237 AGGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAM---QEMMSNPAIKQMA 293

Query: 300 EGFASGGGTPNLSDLMNNPALRNMAGNLFGG 330
           + F SGGGTP+++DLMNNPAL +MA N+FGG
Sbjct: 294 DKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  349 bits (895), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 241/338 (71%), Gaps = 12/338 (3%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M  S +EI+ LIV+Y   + EK ++SED  DSLNVA+DCI+++F FER++ SG++ KS+F
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLI-KSKF 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPED----DAETKAKAEDLKMQGNKAMANK 116
               L ++L  A    E++ K   ENV +N+P+D    D ETK KAE LK++GNKAMA K
Sbjct: 60  YNLSLPELLEVAM---ENSAK---ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMK 113

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176
           D++LAI KY+EAI + P NAIYYANRAAA+SSLK++++A +DAESAI +DP+Y +GYSRL
Sbjct: 114 DFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRL 173

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDA 236
           GFAKYA  KPEEALEAYKKVLD+EGD ATE MKRDYE+AKK+VEQSLNLEK       ++
Sbjct: 174 GFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEES 233

Query: 237 DVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIR 296
             +++                      +NNPQLMQAAQ+MMS+P AM  IQ MMQ+PSIR
Sbjct: 234 VTESAANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIR 293

Query: 297 QMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQ 334
           QMAE F   G TP+ S LMN+P +++MA N FGG   Q
Sbjct: 294 QMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGGNNQQ 330

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 233/330 (70%), Gaps = 15/330 (4%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M  S +EIAALIV + S+    K++ E+  DSLNVA+DCI+EAF  ERE  + I+ K+ +
Sbjct: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKA-Y 57

Query: 61  KGQHLADILNSASRVPE-SNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYE 119
            G+ L D++ S +  P  S+ +    N + + PE       +AE+LK++GNKA A KD+E
Sbjct: 58  NGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPE----VAERAENLKLEGNKAFAAKDFE 113

Query: 120 LAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFA 179
            A+ KYTEAI+++P NA++Y NRAAA+SS K++++AV+DAESA+ I+PSY RGYSRLG A
Sbjct: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173

Query: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVD 239
           KYA GKPEEA+EAYKKVLDIEGDNATEAMKRDYESAKKKVE+SLNLE  +P   +  +  
Sbjct: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALP---KGEEQQ 229

Query: 240 ASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMA 299
            S+                     +NNPQ+MQAAQKMM NP AM   Q+MM +P+I+QMA
Sbjct: 230 TSEGSSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMA 286

Query: 300 EGFASGGGTPNLSDLMNNPALRNMAGNLFG 329
           + FASGGGTPNL D+M +P +++MAG  FG
Sbjct: 287 QNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  328 bits (842), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 237/332 (71%), Gaps = 13/332 (3%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS S ++IA L+V++ S+ +EKK +S D ADSLNVA+DCI+EAF FE++ V   L  S+F
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLA-SKF 59

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIP----EDDAETKAKAEDLKMQGNKAMANK 116
            G+ L ++L++A+      +    E+++++I     E+D E  AKAE LK++GNKAMA K
Sbjct: 60  GGKSLTELLDAATNAK--GRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAK 117

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176
           DY LA+ KY  AIK++PT A+YYANRAAA+SS ++YD+A+KDAESAI ++P++ +GYSRL
Sbjct: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDA 236
           GFAK+AQGK +EALEAYKK L+++GD AT+ MKRDYE+AKKKVEQSLN+EK+    +   
Sbjct: 178 GFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSAS-- 235

Query: 237 DVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIR 296
              AS                      +NNPQ+MQAAQ+MMSNP AM+ ++ MMQ+PSIR
Sbjct: 236 ---ASASASAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIR 292

Query: 297 QMAEGFASGGGTPNLSDLMNNPALRNMAGNLF 328
           QMAE  +S G +  + D MNNPA+R MA NLF
Sbjct: 293 QMAENLSS-GSSEGMGDFMNNPAIREMASNLF 323

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  311 bits (798), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/344 (52%), Positives = 239/344 (69%), Gaps = 20/344 (5%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS S +EIAALIV++ SS      ++ED  DSLNVA+DCI+EAF FER+    ++    F
Sbjct: 1   MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLIS-GPF 57

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
            G+ L ++L SA     S+     E V+++IP +DA  KAKAE+LK+QGNKAMA K ++ 
Sbjct: 58  NGKKLPELLASAP----SSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDE 113

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI KYT AI+V P+NA+YY+NRAAA+SSLK+Y+QAVKDAE AI +DP+Y +G+SRLGFAK
Sbjct: 114 AIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK 173

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240
           YA  KPEEAL+AYKKVLDIEG+ AT+ MKRDYE+AKKKVE S+NLEK+    S +   D 
Sbjct: 174 YALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDK 233

Query: 241 SQXXXX---------XXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQ 291
           S                               +NNPQ+MQAA+KMM NPG MQ+   MM 
Sbjct: 234 SATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQD---MMS 290

Query: 292 DPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGA-GAQ 334
           +P+++QMA  F+SGGG P+LS +MN+P++R+MA N+FGG  G+Q
Sbjct: 291 NPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGSQ 334

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  286 bits (732), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 168/341 (49%), Positives = 222/341 (65%), Gaps = 28/341 (8%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS S ++IAALIV++ ++    K + ED  DSL VA+DCI+EAF       +  L   + 
Sbjct: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFEL-GPGEADTLVSEKC 57

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAE-TKAKAEDLKMQGNKAMANKDYE 119
            G+ L+ +L +      ++  D  E      P+  AE  K +AE LK++GN+AMA KDYE
Sbjct: 58  GGRSLSQLLTTGM----AHTSDAGE------PKVAAEELKKEAEALKLEGNRAMAAKDYE 107

Query: 120 LAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFA 179
            AI KYT AI+VLPT+A+YYANRAAA+SSL++Y++AV+DAE A  +D SY +G+SRLG+A
Sbjct: 108 TAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYA 167

Query: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKT--VPEQSRDAD 237
           KYA G+ EEALEAYK+VLDIEGDNATEAM+RDYESAK+KVE+S+N+++   V E    A 
Sbjct: 168 KYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAA 227

Query: 238 VD---------ASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQK 288
                      AS                      +NNPQ+MQAAQKMM NP A   IQ+
Sbjct: 228 GSAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSA---IQE 284

Query: 289 MMQDPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFG 329
           MM +P+I++MAE FASG G+  L DLM +PA+RNMA   FG
Sbjct: 285 MMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  234 bits (596), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 208/355 (58%), Gaps = 23/355 (6%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGF----EREAVSGILG 56
           MS + ++  ALIVNY   I++ KE+SED A+SLNVA+DCIS+ F      E + ++ +  
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 57  KSEFKGQHLADI-LNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMAN 115
           KS+ K   L  + L + S V E         +E+   E   + K +AE LK++GNK M+ 
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVE---------LEVKNEEISEDKKKEAEALKLEGNKQMSL 111

Query: 116 KDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSR 175
           K+Y+ AI+KY++AI++ P+N  YY+NRAAA+  ++++  AV DA +AI +DP+Y + YSR
Sbjct: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRD 235
           LG AK A+G  E+A+ A+KKVL++EGD +TE MK DYE+AKK V+  + L K VP+ S  
Sbjct: 172 LGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP 231

Query: 236 ADVDASQXXXXXXXXXXXXXXXXXXXXXMNNP--QLMQAAQKMMSNPGAMQNIQKMMQDP 293
             ++ +                      MNN              NP  MQ ++ +MQ+P
Sbjct: 232 PPLNTTD-----VLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNP 286

Query: 294 SIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQS--TDETPDNENKQ 346
            +RQ AE  A+G G   LSD++NNP+++ +A  L  G    S  T E P+++N +
Sbjct: 287 VVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESKNPE 341

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  164 bits (415), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 120/363 (33%), Positives = 183/363 (50%), Gaps = 51/363 (14%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           M+ + +EIA++IV+YF+  +   ++++D  DSLNVA+DCI++ F  +++ +S IL K+ +
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNIL-KTAY 59

Query: 61  KGQHLADILNSASRVPES-NKKDDAENV-------------------EINIP----EDDA 96
           +   L   L +  R   + +KK+   NV                   +IN+P    ED  
Sbjct: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119

Query: 97  ETK---------AKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHS 147
           ETK          KAE LK +GN+ M  K Y  AI  Y++AIK+ PTN  YY NRA A+ 
Sbjct: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179

Query: 148 SLKEYDQAVKDAESAISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI---- 199
               +D A+ DA  +I ID    P+ F+ Y RLG AKY  G  E +L A+K++++I    
Sbjct: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239

Query: 200 -EGDNATEAMKRDYESAKKKVEQSLNLE---KTVPEQSRDADVDASQXXXXXXXXXXXXX 255
            +GD  T+ M  DYE AK+KV++   ++    T  E S ++  D  +             
Sbjct: 240 NKGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPK--RKVTLNDILNM 297

Query: 256 XXXXXXXXMNNPQLMQAAQKMM-SNPGAMQNIQKMMQDPSIRQMAEGFASG--GGTPNLS 312
                   M+NP   +  ++++ SNP A Q    +M DP +RQM E   S      P L 
Sbjct: 298 AGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILK 357

Query: 313 DLM 315
           DL 
Sbjct: 358 DLF 360

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  153 bits (386), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 168/342 (49%), Gaps = 40/342 (11%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS +KE+ A+LI++Y S +     + ED  +SL VA+ CI E+F  +     G +  +  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLD-----GDILPTSL 55

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
           K + L  IL       E+ +K   E               +AE LK +GN+AM    YE 
Sbjct: 56  KERTLKTILQENLNTLEATQKIHNE---------------EAEALKKEGNEAMIEGQYEE 100

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180
           AI KYTEAI+    N  YY+NR+ A+S L  Y+ AV DA  AI+IDPS+ + YSRLG+AK
Sbjct: 101 AIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAK 159

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDA--DV 238
             Q K E+ + AYK+ +D+EG NA++ +  DYE A+ K EQ   L+K    + R +  +V
Sbjct: 160 CCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEV 216

Query: 239 DASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQK--------MM 290
            + +                      +N    +  ++  S    + NI +        +M
Sbjct: 217 TSEECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLM 276

Query: 291 QDPSIRQMAEGFASGGGTPNLS----DLMNNPALRNMAGNLF 328
            +P ++QM   F +    P+ S    D++NNP LR     L 
Sbjct: 277 NNPQLKQMV--FQAINDNPDASRQVKDVLNNPLLRTTLSELM 316

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  143 bits (360), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 96/336 (28%), Positives = 166/336 (49%), Gaps = 36/336 (10%)

Query: 6   EEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEFKGQHL 65
           +++A LIVN+  +++ KKEIS+D  DSLNVA+DCI + +      +S  L   +F    L
Sbjct: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLIL-KFSKSDL 67

Query: 66  ADILNSA---------------------SRVPESNKK-------DDAENVEINIPEDDAE 97
             ILN+                      S + ES KK       D+ E + IN+ +    
Sbjct: 68  TSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKN 127

Query: 98  T-----KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEY 152
                 K  A+  K +GN+ M ++DY+ AI  YT AI   P + IYY+NR+ A+  + +Y
Sbjct: 128 NFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDY 187

Query: 153 DQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY 212
           + A+ DA   ISID ++ + Y RL   K  Q +  +AL+ YKK +++  D+  E + R++
Sbjct: 188 ESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREF 247

Query: 213 ESAKKKVEQSLNLEKTVPEQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQA 272
           E  K KV+  ++L + +     + + + +                      ++NP L Q 
Sbjct: 248 EDLKLKVQTDISL-REISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQQM 306

Query: 273 AQKMM-SNPGAMQNIQKMMQDPSIRQMAEGFASGGG 307
             K++ +NP A +NI  ++ +P+++ + + F +G  
Sbjct: 307 IFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  142 bits (358), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 138/234 (58%), Gaps = 24/234 (10%)

Query: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60
           MS S +EIA+ IV+Y SS++   +++ED A+S++VA++CI ++F  + E  +        
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD------- 53

Query: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120
               LA +L +   +    K  + E   +N          +A  LK++GNKA+  ++Y+ 
Sbjct: 54  --SDLATVLLANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKD 102

Query: 121 AINKYTEAIKVLPTNAI-----YYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSR 175
           AI+KYT AI +L  N +     Y +N++ A +    Y++A  DA + I IDP++ +GYSR
Sbjct: 103 AIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSR 162

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTV 229
           L  AK  Q K E+A+ AYK+VLD+EG+ AT+ MKRD+E  K+K E +LN    +
Sbjct: 163 LAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI 215

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 92.0 bits (227), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   KDYE AI+ +++AI+V  T N ++Y+NR+A ++SLK++ +A+ DAE
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAE 63

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+P++ +GY+RLG A    G  +EA  +YKK L+++G N
Sbjct: 64  ECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSN 106

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KAE+ +++G       D+  A+  YTE IK  P +A  Y+NRAAA S L  + +A++D  
Sbjct: 389 KAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCN 448

Query: 161 SAISIDPSYFRGYSRLGFAKYA 182
            AI  DP++ R Y R   A+ A
Sbjct: 449 KAIEKDPNFIRAYIRKATAQIA 470

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 89.4 bits (220), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 120/230 (52%), Gaps = 43/230 (18%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLP-TNAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A + K+YE A++ +++AI+V P  N + Y+NR+A ++SLK++  A+ DA 
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
               I+P++ +GY+R+G A Y  G  +EA ++YKK L+++  N           A++ +E
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKV---------AQEGLE 115

Query: 221 QSLNLEKTVPEQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 280
           Q   +++T  +++R A  D                         N+P L+   +K+ SNP
Sbjct: 116 Q---VKRT--QEARKAQPDMG------------------LTSMFNDPNLI---EKLKSNP 149

Query: 281 GAMQNIQKMMQDPSIRQMAEGFASGGGTPNLS-DLMNNPALRNMAGNLFG 329
              +    MM DP +  +A+  +    +  LS +L ++P L  +   L G
Sbjct: 150 KTAE----MMNDPQL--VAKLLSYRSNSQALSTELFSDPRLMTIMATLLG 193

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 134/311 (43%), Gaps = 55/311 (17%)

Query: 14  NYFSSIVEKKEISEDGADSLNVAMDCISEAF---GFEREAVSGILGKSEFKGQHLADILN 70
           +Y ++I   ++  E G + L      I++AF   G   E ++ +   +EF  + L +   
Sbjct: 306 DYETTIKTLEDAIEKGRE-LRADYKIIAKAFTRMGNAYEKLNDLKKAAEFFNKSLTEF-- 362

Query: 71  SASRVPESNKKDDAENVEINIPEDDAETKA-KAEDLKMQGNKAMANKDYELAINKYTEAI 129
              R P +  K  +   +I + E +A     KAE+ ++QG        +  A+  YTE I
Sbjct: 363 ---RTPATLTKLRSLEKKIKVQEAEAYINPEKAEEARIQGKDFFNKGQWPDAVKAYTEMI 419

Query: 130 KVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEA 189
              P +A  Y+NRAAA S L  + +A+ D E A+  DP++ + Y R   A+ A  +   A
Sbjct: 420 ARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQIAIKEYSSA 479

Query: 190 LEAYKKVLDI---------EGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQS-----RD 235
           LE     LDI          G N  E  +   ++ +++ E + + E   PEQ+     +D
Sbjct: 480 LE----TLDIARSKDTELNNGSNIREINQLYAKATQQRFEPASSNE--TPEQTYQRAMKD 533

Query: 236 ADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSI 295
            +V A                       M +P +    Q+  +NP A+   Q+ M++P I
Sbjct: 534 PEVAA----------------------IMQDPVMQSILQQAQTNPAAL---QEHMKNPEI 568

Query: 296 RQMAEGFASGG 306
            +  +   S G
Sbjct: 569 FKKIQTLISAG 579

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 10/94 (10%)

Query: 75  VPESNKKD----DAENVEINIPEDDAETKAKAEDL-KMQGNKAMANKDYELAINKYTEAI 129
           VPES +K+    + EN+E+    DDA+ + K  D  K +GNK      ++ AI  Y +A 
Sbjct: 230 VPESKEKEPVAANPENMEV----DDADVQKKLADAEKDEGNKLYKAHKFDEAIEHYDKAW 285

Query: 130 KVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAI 163
           + L  +  Y  N+AAA     +Y+  +K  E AI
Sbjct: 286 E-LHNDITYLNNKAAAQYEKGDYETTIKTLEDAI 318

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 89.0 bits (219), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A  +KD+  AI  +T+AI+V PT N + Y+NR+AA++S K++ +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+P++ +GY+RLG A++  G  EEA + YK+ L ++ +N
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 115/254 (45%), Gaps = 46/254 (18%)

Query: 63  QHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAI 122
              ADIL       +  KK +AE   I+ PE       KAE+ +++G +     D+  A+
Sbjct: 359 HRTADILTKLRNCEKELKKQEAEQY-ID-PE-------KAEEARLEGKEYFTKGDWPNAV 409

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
             Y+E IK  P +A  Y+NRAAA S L  + +A+KD ++AI  DP++ R Y R   A+ A
Sbjct: 410 KAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRKATAQIA 469

Query: 183 QGKPEEALEAYKKVLDIE-----GDNATEAMKRDYESAKKKVEQSLNLEKTVPEQS---- 233
             +   AL+  ++    +     G N+ E M+   ++ +++ +     E   PE++    
Sbjct: 470 IKEYANALDTLEEAKSKDSSVNNGANSNEIMRLQMKATQERFQAPTGNE--TPEETYKRA 527

Query: 234 -RDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 292
            +D +V A                       M +P +    Q+  +NP A+   Q+ M++
Sbjct: 528 MQDPEVAA----------------------IMQDPVMQSILQQAQTNPAAL---QEHMKN 562

Query: 293 PSIRQMAEGFASGG 306
           P I +  +   + G
Sbjct: 563 PEISKKIQILIAAG 576

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 70/139 (50%), Gaps = 10/139 (7%)

Query: 98  TKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVK 157
           +K +A++ K++GNK      ++ AI +Y +A   L  +  Y  NR+AA     +++ A+ 
Sbjct: 251 SKLEADEAKVEGNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIA 309

Query: 158 DAESAI----SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATEAM 208
               A+     +   Y    + ++R+G A + +G  +++++ Y+K L      D  T+  
Sbjct: 310 TLNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLR 369

Query: 209 KRDYESAKKKVEQSLNLEK 227
             + E  K++ EQ ++ EK
Sbjct: 370 NCEKELKKQEAEQYIDPEK 388

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 107/195 (54%), Gaps = 16/195 (8%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           AE+ K QGN A   KD+E A   +++AI+   T N + Y+NR+A ++SLK++ +A++DAE
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
             + I+P++ +GY+R+G A+Y  G  ++A + YKK L+I+  N         ++A++ +E
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSN---------KAAQEGLE 113

Query: 221 QSLNLEKTVPEQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 280
           Q   ++KT   + +  D+   Q                     M +PQL+    +  SNP
Sbjct: 114 Q---VQKTQNARQQQPDLGFGQ-LFNDPNMIEKLKSNPKTAELMKDPQLVSKVLQFQSNP 169

Query: 281 GAMQNIQKMMQDPSI 295
             M   Q++M+DP +
Sbjct: 170 QMMG--QEVMKDPRM 182

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 63/111 (56%), Gaps = 5/111 (4%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KAE+ ++QG +     D+  A++ YTE IK  P +A  Y+NRAA  + L  +  A+KD +
Sbjct: 400 KAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCD 459

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALE----AYKKVLDI-EGDNATE 206
            AIS DP++ R Y R   A+ A  +   A+E    A  K L+I +G NA E
Sbjct: 460 VAISKDPNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANARE 510

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 68/128 (53%), Gaps = 8/128 (6%)

Query: 77  ESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNA 136
           ES+   DA+ +E++ PE + ++KAKA+  K +GNK    + ++ AI  Y +A   L  + 
Sbjct: 242 ESDLSADADKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWD-LHRDV 300

Query: 137 IYYANRAAAHSSLKEYDQAVKDAESAI----SIDPSY---FRGYSRLGFAKYAQGKPEEA 189
            Y  NR+AA     +Y+QA+K    A+     +   Y    + ++R+G A       ++A
Sbjct: 301 TYLNNRSAAEYEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKA 360

Query: 190 LEAYKKVL 197
           +E Y++ L
Sbjct: 361 IEFYQRSL 368

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 114/229 (49%), Gaps = 41/229 (17%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++LK +GN A A+KD+  AI  +TEAI    T N + Y+NR+A ++SLK++ +A+ DA+
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQ 63

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
             + I+P + +GY+R+G A    G  ++A   YKK L+++ +N         ++A + +E
Sbjct: 64  QCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN---------KAASEGLE 114

Query: 221 QSLNLEKTVPEQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 280
           Q   +     ++SR +  D                         ++P L+   +K+  NP
Sbjct: 115 QVHRV-----QESRKSRPDFGM------------------TEMFSDPNLI---EKLRQNP 148

Query: 281 GAMQNIQKMMQDPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFG 329
                 + MM DPS+    + + S     + SDLM +P L  +   L G
Sbjct: 149 ----KTKDMMNDPSLVAKLQSYKSNPQGLS-SDLMGDPRLMTIMATLLG 192

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 113/254 (44%), Gaps = 46/254 (18%)

Query: 63  QHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAI 122
              ADIL       +  KK + E   IN PE       KAE+ +++G +     D+  A+
Sbjct: 360 HRTADILTKLRTCEKELKKQEIEEY-IN-PE-------KAEEARLEGKEYFTKSDWPNAV 410

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
             YTE IK  P +A  Y+NRAAA + L  + +A+KD E AI  DP++ R Y R   A+ A
Sbjct: 411 KAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPNFVRAYLRKATAQIA 470

Query: 183 QG---KPEEALEAYKKVLDI--EGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQS---- 233
                K  E LE  KK  D    G ++ E MK   ++ +++ +     E   PE++    
Sbjct: 471 IKDFVKALETLEEAKKKDDEVNNGASSNEIMKLQMKATQERFQAPTGNE--TPEETYKRA 528

Query: 234 -RDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 292
            +D +V A                       M +P +    Q+  ++P A   +Q+ M++
Sbjct: 529 MQDPEVAA----------------------IMQDPVMQSILQQAQNDPAA---LQEHMKN 563

Query: 293 PSIRQMAEGFASGG 306
           P I +  +   S G
Sbjct: 564 PEISKKIQVLVSAG 577

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 118/231 (51%), Gaps = 45/231 (19%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A A K Y+ A++ +T+AI+V  T N + Y+NR+A+++S +++++A+KDA 
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDAL 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
               I+PS+ +GY+R G A +  G  ++A  +YKK L+++ +N           AK+ +E
Sbjct: 65  ECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANNKI---------AKEGIE 115

Query: 221 QSLNLEKTVPEQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 280
           Q   +++   ++    D+  ++                      N+P L+   +K+ +NP
Sbjct: 116 Q---IQRVQSQRQAQPDLGLTE--------------------MFNDPNLI---EKLKNNP 149

Query: 281 GAMQNIQKMMQDPSIRQMAEGFASGGGTPN--LSDLMNNPALRNMAGNLFG 329
              +    +M DP   Q+     S    PN    DL ++P L  + G L G
Sbjct: 150 KTAE----LMNDP---QLVAKLLSFRSNPNGLAQDLFSDPRLMTIMGTLMG 193

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 96/216 (44%), Gaps = 37/216 (17%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KAE+ +++G +     D+  A+  YTE IK  P +A  Y+NRAAA S L  +  A+ D  
Sbjct: 384 KAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCN 443

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAY--KKVLDIE---GDNATEAMKRDYESA 215
            AI  DP++ R Y R   A+ A      A+E     +  D E   G NA E  +   ++A
Sbjct: 444 KAIEKDPNFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQLYMKAA 503

Query: 216 KKKVEQSLNLEKTVPEQS-----RDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLM 270
           +++ + +   E   PEQ+     RD +V                         M +P L 
Sbjct: 504 QQRFQPATGDE--TPEQTYERAMRDPEV----------------------AKIMQDPVLQ 539

Query: 271 QAAQKMMSNPGAMQNIQKMMQDPSIRQMAEGFASGG 306
              Q+  ++P A+   Q+ M++P I +  +   + G
Sbjct: 540 SILQQAQNDPAAL---QEHMKNPEIFKKIQTLIAAG 572

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 57/111 (51%), Gaps = 8/111 (7%)

Query: 94  DDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYD 153
           D  E+K  AE+ K++GNKA   ++++ AI  Y +A + L  N  Y  NR+AA     EYD
Sbjct: 243 DQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYD 301

Query: 154 QAVKDAESAI----SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            A+     AI     +   Y    + ++R+G A    G  +EA+  Y+K L
Sbjct: 302 TAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 86.3 bits (212), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K +GN A   KDY+ AI+ +T+AI+V  T N + Y+NR+AA++S K+Y+QA+ DA+
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDAD 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
             I I+PS+ +GY+R G A     K EEA + Y + L I+ +NA
Sbjct: 65  ECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KAE+ +++G +     D+  A+  YTE IK  P +A  Y+NRAAA + L  +  A+ D  
Sbjct: 384 KAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCN 443

Query: 161 SAISIDPSYFRGYSR 175
            AI  DPS+ R Y R
Sbjct: 444 KAIEKDPSFIRAYLR 458

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 86.3 bits (212), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   KDY+ AI  +T+AI+V  T N + Y+NR+A ++SLK++  A+ DA+
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             I+I+PS+ +GY+RLG A    G  +EA   YKK L+++  N
Sbjct: 65  ECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASN 107

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 64/129 (49%), Gaps = 9/129 (6%)

Query: 63  QHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAI 122
              ADIL       +  KK +AE   IN PE       KAE+ +++G       D+  A+
Sbjct: 366 HRTADILTKLRNAEKELKKAEAE-AYIN-PE-------KAEEARLEGKDYFTKSDWPNAV 416

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
             YTE IK  P +A  Y+NRAAA + L  + +A+ D   AI  DP++ R Y R   A+ A
Sbjct: 417 KAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIA 476

Query: 183 QGKPEEALE 191
             +   ALE
Sbjct: 477 VQEYAAALE 485

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 68/133 (51%), Gaps = 12/133 (9%)

Query: 72  ASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKV 131
           +S  P+  +  +++ +E++  EDD  +KA+A+  K +GNK    + ++ AI  Y +A + 
Sbjct: 236 SSNTPQREENKESDPMEVD--EDD--SKAEADKEKAEGNKFYKARQFDEAIEHYNKAWE- 290

Query: 132 LPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS----IDPSY---FRGYSRLGFAKYAQG 184
           L  +  Y  NRAAA     EY  A+     A+     +   Y    R ++R+G A +  G
Sbjct: 291 LHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGREMRADYKVISRSFARIGNAYHKLG 350

Query: 185 KPEEALEAYKKVL 197
             ++ +E Y+K L
Sbjct: 351 DLKKTIEYYQKSL 363

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   KDY+ AI+ +++AI V    N + Y+NR+A ++SLK++  A+KDAE
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAE 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+PS+ +GY+R+G A +  G  +EA   YKK L+++  N
Sbjct: 65  ECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASN 107

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 1/119 (0%)

Query: 74  RVPESNKKDDAENVEINIPE-DDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVL 132
           R PE   K  A   ++ I E +D     KAE+ +++G       D+  A+  YTE IK  
Sbjct: 368 RTPEILSKLRAAEKQVKIQEAEDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRA 427

Query: 133 PTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALE 191
           P +A  Y+NRAA  S L  + +A+ D   AI  DP++ R Y R   A+ A  +   ALE
Sbjct: 428 PEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSALE 486

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   KDY  AI+ +T+AI+V  T N + Y+NR+A ++S K++++A+KDAE
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I PS+ +GY+R+G A++   + +EA ++YK+ L+++  N
Sbjct: 63  ECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN 105

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 50/82 (60%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KAE+ ++QG +     D+  A+  YTE +K  P +A  ++NRAAA + L  + +A++D  
Sbjct: 379 KAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCN 438

Query: 161 SAISIDPSYFRGYSRLGFAKYA 182
            A+SIDP++ R Y R   A+ A
Sbjct: 439 KAVSIDPNFVRAYIRKATAQIA 460

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 11/129 (8%)

Query: 76  PESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN 135
           P+   K + E +E++   ++  ++  AE  K +GNK    + +E AI  Y +A + L  +
Sbjct: 223 PKQEPKQEPEAMEVD---EEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWE-LHKD 278

Query: 136 AIYYANRAAAHSSLKEYDQAVKDAESAI----SIDPSY---FRGYSRLGFAKYAQGKPEE 188
             Y  NR+AA     +YD A+K    A+     +   Y    + ++R+G A Y      +
Sbjct: 279 ITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRELRADYKTIAKSFARIGNAYYKLKDLRK 338

Query: 189 ALEAYKKVL 197
           A+E Y + L
Sbjct: 339 AIEHYNRSL 347

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 119/230 (51%), Gaps = 44/230 (19%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVL-PTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A A KD+E AI  +T+AI+V    N + Y+NR+A ++S K++++A++DA+
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
             ++I+P++ +GY+R+G A +  G  +EA + YKK L+++  N         ++A+  +E
Sbjct: 63  QCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSAN---------KAAQDGLE 113

Query: 221 QSLNLEKTVPEQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 280
           Q   + KT   + +  D+   Q                      N+P L+   +K+ +NP
Sbjct: 114 Q---VHKTQQSRQQQPDLGLGQ--------------------IFNDPNLI---EKLKNNP 147

Query: 281 GAMQNIQKMMQDPSIRQMAEGFASGGGTPNLS-DLMNNPALRNMAGNLFG 329
              +    +M+DP +      F S    P +  +++ +P L  +   L G
Sbjct: 148 KTAE----LMKDPQLVAKILQFKSN---PQMGMEVLQDPRLMTIMAALMG 190

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 49/82 (59%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KAE+ ++QG +     D+  A+  YTE IK  P +A  Y+NRAAA S L  + +A+KD  
Sbjct: 392 KAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCN 451

Query: 161 SAISIDPSYFRGYSRLGFAKYA 182
            AIS DP++ R Y R   A+ A
Sbjct: 452 VAISKDPNFIRAYIRKATAQIA 473

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 8/107 (7%)

Query: 98  TKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVK 157
           +KAKA+  K +GNK    + ++ AI  Y++A + L  +  Y  NRAAA     EY+ A+K
Sbjct: 255 SKAKADAEKAEGNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIK 313

Query: 158 DAESAI----SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
               A+     +   Y    + ++R+G + +   + ++A+E Y+K L
Sbjct: 314 TLTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   KDY+ AI  +T+AI+V  T N + Y+NR+A ++SLK++  A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+PS+ +GY+RLG A    G  +EA   YKK L+++  N
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASN 107

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 114/254 (44%), Gaps = 46/254 (18%)

Query: 63  QHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAI 122
              ADIL       +  KK +AE   +N PE       KAE+ +++G +     D+  A+
Sbjct: 366 HRTADILTKLRNAEKELKKAEAE-AYVN-PE-------KAEEARLEGKEYFTKSDWPNAV 416

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
             YTE IK  P +A  Y+NRAAA + L  + +A+ D   AI  DP++ R Y R   A+ A
Sbjct: 417 KAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIA 476

Query: 183 QGKPEEALEAY--KKVLDIEGDNATEAMKRD---YESAKKKVEQSLNLEKTVPEQS---- 233
             +   ALE     +  D E +N + A + D   Y++++++ +   + E   PE++    
Sbjct: 477 VKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQPGTSNE--TPEETYQRA 534

Query: 234 -RDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 292
            +D +V A                       M +P +    Q+   NP A+   Q+ M++
Sbjct: 535 MKDPEVAA----------------------IMQDPVMQSILQQAQQNPAAL---QEHMKN 569

Query: 293 PSIRQMAEGFASGG 306
           P + +  +   + G
Sbjct: 570 PEVFKKIQTLIAAG 583

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 69/133 (51%), Gaps = 12/133 (9%)

Query: 72  ASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKV 131
           +S+ P+  +  ++E +E++  EDD++ +A  E  K +GNK    + ++ AI  Y +A + 
Sbjct: 236 SSKAPQKEESKESEPMEVD--EDDSKIEADKE--KAEGNKFYKARQFDEAIEHYNKAWE- 290

Query: 132 LPTNAIYYANRAAAHSSLKEYDQAVKDAESAI----SIDPSY---FRGYSRLGFAKYAQG 184
           L  +  Y  NRAAA     EY+ A+     A+     +   Y    + ++R+G A +  G
Sbjct: 291 LHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLG 350

Query: 185 KPEEALEAYKKVL 197
             ++ +E Y+K L
Sbjct: 351 DLKKTIEYYQKSL 363

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 68/103 (66%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           AE+ K QGN A   KDYE A   +T+AI+     N + Y+NR+A  +SLK++++A+ DA 
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+P++ +GY+R+G A +  GK +EA + YKK L+I+  N
Sbjct: 63  ECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN 105

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (59%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KAE+ ++QG +     D+  A+  YTE  K  P +A  Y+NRAAA + L  + +A+KD +
Sbjct: 400 KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCD 459

Query: 161 SAISIDPSYFRGYSRLGFAKYA 182
            AIS DP++ R Y R   A+ A
Sbjct: 460 MAISKDPNFIRAYIRKATAQIA 481

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 8/118 (6%)

Query: 87  VEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH 146
           +E++ P+ + ++K  A+  K +GNK    + ++ AI  Y +A   L  +  Y  NR+AA 
Sbjct: 252 MEVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWD-LHKDVTYLNNRSAAE 310

Query: 147 SSLKEYDQAVKDAESAI----SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
               +Y+QA+K    A+     +   Y    + ++R+G A       ++A+E Y+K L
Sbjct: 311 YEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   K+Y+ AI K+T+AI+V  T N + Y+NR+A ++S K++ + ++DA 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+P++ +GY+R+G A +  G  +EA +AYKK L+++  N
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSN 107

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 98/215 (45%), Gaps = 35/215 (16%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KAE+ +++G +     D+  A+  YTE I   P++A  Y+NRAAA S L  + +A+ D  
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCN 447

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAY--KKVLDIEGDNATEAMKRD--YESAK 216
           +AI  DP++ R Y R   A+ A      A+E     +  D E +N   + + D  Y  A 
Sbjct: 448 TAIEKDPNFIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREIDQLYLKAN 507

Query: 217 KKVEQSLNLEKTVPEQS-----RDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQ 271
           ++  Q  N  +T PEQ+     +D +V A                       M +P +  
Sbjct: 508 QQRFQPSNANET-PEQTYERAMKDPEVAA----------------------IMQDPVMQS 544

Query: 272 AAQKMMSNPGAMQNIQKMMQDPSIRQMAEGFASGG 306
             Q+  +NP A+   Q+ M++P I +  +   + G
Sbjct: 545 ILQQAQTNPAAL---QEHMKNPEIFKKIQTLIAAG 576

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 70/103 (67%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLP-TNAIYYANRAAAHSSLKEYDQAVKDAE 160
           A+  K +GN+A A+KDY  AI  +T+AI+V    N + ++NR+A ++S K++ +A+ DA 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+PS+ +GY+RLG A Y  G  +EA ++YKK L+++  N
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSAN 105

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 53/93 (56%), Gaps = 3/93 (3%)

Query: 86  NVEINIPEDDAET---KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANR 142
           N E  + + +AE+     KAE+ ++QG +     D+  A+  YTE IK  P +A  Y+NR
Sbjct: 370 NTEKELKQKEAESYMDPEKAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNR 429

Query: 143 AAAHSSLKEYDQAVKDAESAISIDPSYFRGYSR 175
           AAA S L  +  A++D + AI  DP++ R Y R
Sbjct: 430 AAALSKLMSFADAIRDCDKAIEKDPNFVRAYIR 462

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 14/126 (11%)

Query: 79  NKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIY 138
            KK + E +E++   DD   K+KAE  K +GNK    + ++ AI KY EA +    +  Y
Sbjct: 238 TKKPEPEPMEVD---DD---KSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITY 290

Query: 139 YANRAAAHSSLKEYDQAVKDAESAI----SIDPSY---FRGYSRLGFAKYAQGKPEEALE 191
             NRAAA     +Y+ A++    A+     +   Y    + ++R+G + +  G  ++A++
Sbjct: 291 LNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAID 350

Query: 192 AYKKVL 197
            Y+K L
Sbjct: 351 YYEKSL 356

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           AE+ K +GN A A KD+E AI  + +AI+V    N + Y+NR+A ++S++++ +A+ DA+
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQ 63

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I P + +G++RLG A Y  G  +EA E+YKK L+++  N
Sbjct: 64  ECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSN 106

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 9/116 (7%)

Query: 67  DILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYT 126
           ++LN    + +  KK +AE   I+ PE       KAE+ ++QG +   N D+  A+  YT
Sbjct: 362 EVLNKLRSLEKEQKKREAEAY-ID-PE-------KAEEARLQGKEYFTNADWPNAVKAYT 412

Query: 127 EAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
           E IK  P +A  Y+NRAAA + L  +  A+KD + AI  DP++ R Y R   A+ A
Sbjct: 413 EMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATAQIA 468

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 8/106 (7%)

Query: 99  KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKD 158
           ++KAE+ K +GN+    + ++ AI  Y +A   L  +  Y  NRAAA     +Y+ A+K 
Sbjct: 251 RSKAEEAKAKGNELYKKRQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKT 309

Query: 159 AESAIS----IDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
            E A+     +   Y    + ++RLG A Y     ++A+E Y+K L
Sbjct: 310 LEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 114/237 (48%), Gaps = 57/237 (24%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   K+Y+ AI  +T+AI+V  T + + ++NR+A ++SLK++  A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
             + I+PS+ +GY+RLG A    G  +EA   YKK L+++ +N         ++AK  +E
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANN---------KAAKDGLE 115

Query: 221 QSLNLEKTVPEQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 280
           Q   + +T  +Q+R A  D                             L Q    + ++P
Sbjct: 116 Q---VHRT--QQARQAQPDLG---------------------------LTQ----LFADP 139

Query: 281 GAMQNIQK------MMQDPSIRQMAEGFASGGGTPNL--SDLMNNPALRNMAGNLFG 329
             ++N++K      MM+DP   Q+     S    P     DL ++P L  +   L G
Sbjct: 140 NLIENLKKNPKTSEMMKDP---QLVAKLISYKMNPQAIGQDLFSDPRLMTIMATLMG 193

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 115/256 (44%), Gaps = 50/256 (19%)

Query: 63  QHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAI 122
              ADIL     V +  KK +AE   IN P+       KAE+ +++G +     D+  A+
Sbjct: 366 HRTADILAKLRNVEKEQKKAEAE-AYIN-PD-------KAEEARLEGKEYFTKSDWPNAV 416

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
             YTE IK  P +A  Y+NRAAA + L  + +A+ D   AI  DP++ R Y R+  A+ A
Sbjct: 417 KAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRMAAAQIA 476

Query: 183 QGKPEEALEAYKKVLDI---------EGDNATEAMKRDYESAKKKVEQ---SLNLEKTVP 230
             +   ALE     LD+         +G +A E  +  Y++++++ +    S   E+T  
Sbjct: 477 VKEFAAALE----TLDVARTKDAEVNKGASAKEIDQLYYKASQQRFQPDTGSETPEETYQ 532

Query: 231 EQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMM 290
              +D +V A                       M +P +    Q+   NP A+   Q+ M
Sbjct: 533 RAMKDPEVAA----------------------IMQDPVMQSILQQAQQNPAAL---QEHM 567

Query: 291 QDPSIRQMAEGFASGG 306
           ++P++ +  +   + G
Sbjct: 568 KNPAVFKKIQTLIAAG 583

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 73/157 (46%), Gaps = 12/157 (7%)

Query: 71  SASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIK 130
           S+S  P+    ++ E +E+    D+  +KA+A++ K +GNK      ++ AI  Y  A +
Sbjct: 235 SSSTAPQQKDAEEPEPMEV----DEDNSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWE 290

Query: 131 VLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS----IDPSY---FRGYSRLGFAKYAQ 183
            L  +  Y  NRAAA     +Y+  +     A+     +   Y    + ++R+G A +  
Sbjct: 291 -LHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRDMRADYKVISKSFARIGNAYHKL 349

Query: 184 GKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
           G  ++ +E Y+K L         A  R+ E  +KK E
Sbjct: 350 GDLKKTIEYYQKSLTEHRTADILAKLRNVEKEQKKAE 386

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   KDY  AI+ +T+AI+V    N + Y+NR+A ++SLK++  A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDAT 64

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+PS+ +GY+RLG A    G  ++A   YKK L+++  N
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAAN 107

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 111/252 (44%), Gaps = 42/252 (16%)

Query: 63  QHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAI 122
              ADIL       +  KK +AE   IN PE       KAE+ +++G +     D+  A+
Sbjct: 363 HRTADILTKLRNAEKELKKAEAE-AYIN-PE-------KAEEARLEGKEYFTKSDWPNAV 413

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
             YTE IK  P +A  Y+NRAAA + L  + +A+ D   AI  DP++ R Y R   A+ A
Sbjct: 414 KAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIA 473

Query: 183 QGKPEEALEAY--KKVLDIEGDNATEAMKRD---YESAKKKVEQSL---NLEKTVPEQSR 234
             +   ALE     +  D E +N   A + D   Y++++++ +      + E+T     +
Sbjct: 474 VQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKASQQRFQSGTGNDSPEETYQRAMK 533

Query: 235 DADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPS 294
           D +V A                       M +P +    Q+   NP A+   Q+ M++P 
Sbjct: 534 DPEVAA----------------------IMQDPVMQSILQQAQQNPAAL---QEHMKNPE 568

Query: 295 IRQMAEGFASGG 306
           + +  +   + G
Sbjct: 569 VYKKIQTLIASG 580

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKEYDQAVKDAE 160
           A++ K QGN A   KDYE A   + +AI V    N + Y+NR+A ++SLK++ + +KDAE
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAE 63

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I+P + +GY+R+G A++     E+A ++Y+K L+++  N
Sbjct: 64  ECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN 106

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 110/249 (44%), Gaps = 42/249 (16%)

Query: 66  ADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKY 125
           AD+LN      +  KK +AE  E   PE       KAE+ +++G +  +  D+  A+  Y
Sbjct: 355 ADVLNKLRNAEKELKKQEAE--EYVDPE-------KAEEARLEGKEYFSKADWPNAVKAY 405

Query: 126 TEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGK 185
           TE IK  P +A  Y+NRAAA + L  + +A+ D + AI  DP++ R Y R   A+ A  +
Sbjct: 406 TEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPNFIRAYIRKASAQIAVKE 465

Query: 186 PEEALEAYKKVL--DIEGDNATEAMKRD--YESAKKKVEQ----SLNLEKTVPEQSRDAD 237
              A+E    V   D E +N   A + D  Y  A  +  Q    + N E+T     +D +
Sbjct: 466 FAAAVETLDTVRTKDSELNNGANAREIDQLYIKANNQRFQPEDVNENPEQTYQRAMKDPE 525

Query: 238 VDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQ 297
           V A                       M +P +    Q+   NP A+   Q+ MQ+P + +
Sbjct: 526 VAA----------------------IMQDPVMQSILQQAQQNPAAL---QEHMQNPDVFR 560

Query: 298 MAEGFASGG 306
             +   + G
Sbjct: 561 KIQTLIAAG 569

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 8/103 (7%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           AE+ K +GNK    + ++ AI  Y +A + L  +  Y  NRAAA     +Y+ A+    +
Sbjct: 248 AEEEKAEGNKFYKARKFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGDYETAIATLTN 306

Query: 162 AI----SIDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
           A+     +   Y    + ++R+G A +  G  ++++  Y+K L
Sbjct: 307 AVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSL 349

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIK-VLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           AE+ K +GN A   KD++ A+  +T AI+     N + Y+NR+ A++SLK++D+A+ DA 
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDAT 63

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
             + I   + +G++RLG A +  G  +EA E+YKK L+++  N
Sbjct: 64  ECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATN 106

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 3/100 (3%)

Query: 86  NVEINIPEDDAET---KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANR 142
           N+E  I + +AE      KAE  ++ G +     D+  A+  Y+E I   P +A  Y+NR
Sbjct: 373 NLEREIKKREAEAYIDPEKAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNR 432

Query: 143 AAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
           AAA S L  +  A+KD + AI IDPS+ R Y R   A+ A
Sbjct: 433 AAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKATAQIA 472

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 63/120 (52%), Gaps = 14/120 (11%)

Query: 85  ENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAA 144
           E +E+++  ++AE KAKAE     GN+    + ++ AI KY EA   L  +  Y  NRAA
Sbjct: 247 EPMEVDLDRENAE-KAKAE-----GNQLYKQRKFDEAIAKYEEAWN-LQKDITYLNNRAA 299

Query: 145 AHSSLKEYDQAVKDAESAIS----IDPSY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
           A     +Y+ A+K    A+     +   Y    + ++RLG A Y   + ++A+E Y+K L
Sbjct: 300 AEYEKGDYNSAIKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 55/93 (59%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           K E+ +++G +   N++Y  A+  YTE IK  PT+ + + NRAA    L    Q + D +
Sbjct: 428 KFEEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCD 487

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAY 193
            AIS+DPSY + Y R GFA+  +   +EALE +
Sbjct: 488 KAISVDPSYIKAYVRKGFAQITERDLDEALETW 520

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 1/104 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN-AIYYANRAAAHSSLKEYDQAVKDAE 160
           +++LK  GNK    K YE A++ +T A+    TN  I Y+NRAAAH  LK Y +A++D +
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           + + + P++ +GYSR+G A     K +EA E +KK L +   N 
Sbjct: 68  NCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNV 111

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 12/135 (8%)

Query: 94  DDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYD 153
           ++ E K +A++ K  GN     ++++ AI  YT+A      +  Y  N  AA     +Y 
Sbjct: 287 EETEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTF-QDITYLNNIGAAQFERGDYG 345

Query: 154 QAVKDAESAISI------DPSYF-RGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATE 206
             +K    A+        +P    + Y R+G A +     E A+ AY+  L + G+   +
Sbjct: 346 NVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGNEEHK 405

Query: 207 ----AMKRDYESAKK 217
               +++ ++E  KK
Sbjct: 406 KKLASLRVEFEKVKK 420

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 78/153 (50%), Gaps = 11/153 (7%)

Query: 100 AKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDA 159
           AKA + K +GN A+  +DY  AI  YTEAIK+  T +IY++NRA  H  +  +   + D 
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 160 ESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY------- 212
           + A+ IDP   + Y R G +     + + A +  K VL  + ++AT     D        
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDATAKRGLDVCEKFIRE 129

Query: 213 ESAKKKV----EQSLNLEKTVPEQSRDADVDAS 241
           E  KK +    +Q +NL  T+  ++ D++ D +
Sbjct: 130 ERFKKAIGGEEQQKVNLYLTLNLETFDSNADLT 162

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 81/158 (51%), Gaps = 11/158 (6%)

Query: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155
           +E  A+A  LK +GN  +  +D+  AI+ YT+AI +  T +IY++NRA AH  L  +  +
Sbjct: 6   SEQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSS 65

Query: 156 VKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY--- 212
           + D + A+ +DP   + Y R G +     + ++A    + VL  +  +AT +   D    
Sbjct: 66  LNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALDVCEK 125

Query: 213 ----ESAKKKV----EQSLNLEKTVPEQSRDADVDASQ 242
               E  +K +    E  +NL +T+  +S DA+ D  +
Sbjct: 126 FIREERFRKAIGGGDEIKVNLCETLRLESYDANADLGK 163

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 51/79 (64%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           +A + K QGNK +A+KDY  AI  YT+AI++    +I+++NRA A+  L  +  A++D+ 
Sbjct: 8   EALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSS 67

Query: 161 SAISIDPSYFRGYSRLGFA 179
            AI +D S  +GY R G A
Sbjct: 68  KAIELDSSNVKGYHRRGMA 86

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 74/148 (50%), Gaps = 18/148 (12%)

Query: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156
           E  A A D K +GN+ +   DY+ AI  Y++AI +  T +IY++NRA AH     +  AV
Sbjct: 7   EDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAV 66

Query: 157 KDAESAISIDPS-----YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATE----- 206
            D ++A+ +DP      + RG S +G  ++ + K +  +    K  DI   NA +     
Sbjct: 67  VDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENF 126

Query: 207 --------AMKRDYESAKKKVEQSLNLE 226
                   A+    ++AK  + Q+LNLE
Sbjct: 127 IREERFKNAIGGSGDNAKSNICQTLNLE 154

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%)

Query: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155
           A  +AKA + K +GN  +  K +  AI KYTEAI +  T +IY++NRA AH  +  +  A
Sbjct: 6   AADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSA 65

Query: 156 VKDAESAISIDPSYFRGYSR 175
           + D + AI +DP   + Y R
Sbjct: 66  LNDCDEAIKLDPKNIKAYHR 85

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 110 NKAMAN---KDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISID 166
           N+A A+    +++ A+N   EAIK+ P N   Y  RA +  +L E+ +A KD    +   
Sbjct: 51  NRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVLLKAK 110

Query: 167 PS 168
           P+
Sbjct: 111 PN 112

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 50/88 (56%)

Query: 92  PEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKE 151
           P  D+ T A A D K +GN+ +  KDY  A+  YT AI+   T +I+++NRA A+  L  
Sbjct: 28  PRRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDR 87

Query: 152 YDQAVKDAESAISIDPSYFRGYSRLGFA 179
           +  A++D+  AI +D    + Y R G A
Sbjct: 88  FQSALEDSARAIELDAGNVKAYHRRGLA 115

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%)

Query: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155
            E   +A DLK +GNK +  K Y  A+  YT+AI++  T +I+++NRA A   L  +   
Sbjct: 7   TEAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSC 66

Query: 156 VKDAESAISIDPSYFRGYSRLGFAK 180
           + D  SA+ +DP   + Y R G ++
Sbjct: 67  LDDCNSALELDPKNIKAYHRRGLSQ 91

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 3/85 (3%)

Query: 95  DAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQ 154
           DAE   K +D   +GN  + ++DY+ AI  YT+AI++  T++I+Y+NRA AH  L  +  
Sbjct: 8   DAEAALKFKD---EGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQS 64

Query: 155 AVKDAESAISIDPSYFRGYSRLGFA 179
           A+ D   AI +D +  + Y R G A
Sbjct: 65  ALHDCNDAIKLDNNNIKAYHRRGLA 89

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%)

Query: 100 AKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDA 159
           AKA + K +GN  +  K +  AI KYTEAI +  T +IY++NRA AH  +  +  A+ D 
Sbjct: 10  AKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 160 ESAISIDPSYFRGYSR 175
           + AI +DP   + Y R
Sbjct: 70  DEAIKLDPKNIKAYHR 85

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 110 NKAMAN---KDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISID 166
           N+A A+    +++ A+N   EAIK+ P N   Y  RA +  +L E+ +A KD    +   
Sbjct: 51  NRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVLLKAK 110

Query: 167 P 167
           P
Sbjct: 111 P 111

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 44/77 (57%)

Query: 99  KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKD 158
           + KA + K +GN  +  K +  AI KYTEAI +  T  IY++NRA +H  +  +  A+ D
Sbjct: 9   RVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALND 68

Query: 159 AESAISIDPSYFRGYSR 175
            + AI +DP   + Y R
Sbjct: 69  CDEAIKLDPKNIKAYHR 85

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 110 NKAMAN---KDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISID 166
           N+A+++    +++ A+N   EAIK+ P N   Y  RA +  +L E+ +A +D    + + 
Sbjct: 51  NRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVLLKVK 110

Query: 167 PS 168
           P+
Sbjct: 111 PN 112

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 81/159 (50%), Gaps = 13/159 (8%)

Query: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155
           A+ K +A   K +GN  +  ++Y  AI  Y++AI++ PT +I+++NRA A   L  +   
Sbjct: 6   ADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSC 65

Query: 156 VKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT--------EA 207
           + D + A+ +DP   + Y R G +     + ++A    + VL  +  +AT        E 
Sbjct: 66  MNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDATAKRALAMCEK 125

Query: 208 MKRDYESAKKKV----EQSLNLEKTVPEQSRDADVDASQ 242
           + R+ E  KK +    +  LN  +T+  +S DA+ D ++
Sbjct: 126 VIRE-ERFKKAIGGDDQDKLNFCQTMSLKSFDANSDLAK 163

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KA + K +GN  +  +DY  AI KY +AI++  T ++Y++NRA  H  L  +  A +D +
Sbjct: 8   KALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCD 67

Query: 161 SAISIDPSYFRGYSRLGFA 179
            A+++DP   + Y R G A
Sbjct: 68  KALALDPKNVKAYHRRGLA 86

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 76/160 (47%), Gaps = 13/160 (8%)

Query: 58  SEFKGQHLADILNSASRVP------ESNKKDDAENVEINIPED---DAETKAKAEDLKMQ 108
           S+FK +   +++   +R+P      +++  D  ENVE+   +    + E    AE+ K Q
Sbjct: 32  SDFKDKSTDEVMQELNRMPFFMTQLDNSDGDGGENVELEALKALAYEGEPHEIAENFKNQ 91

Query: 109 GNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
            N     K +  A   YT+ IKV       N   +ANRAA    LK Y   V D + A+ 
Sbjct: 92  ANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAME 151

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           I+P   + + R+G A  A GK +EA +A    L I+ +N 
Sbjct: 152 INPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENV 191

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 47/84 (55%)

Query: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155
           AE  AKA + K +GN  +  ++Y  AI  YT+AI++ P  +I+Y+NRA A   L  +  A
Sbjct: 6   AEDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSA 65

Query: 156 VKDAESAISIDPSYFRGYSRLGFA 179
             D   A+++D    + Y R G A
Sbjct: 66  YNDCNEALTLDSKNVKAYHRRGLA 89

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%)

Query: 99  KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKD 158
           +A A + K +GN  +  K +  AI KYT+AI +  T +IY++NRA AH  +  +  A+ D
Sbjct: 9   RANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 159 AESAISIDPSYFRGYSR 175
            + A+ +DP   + Y R
Sbjct: 69  CDEALKLDPKNIKAYHR 85

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 45/79 (56%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KA + K QGN  +  K++  A   Y++AI++  T +IY++NRA AH  L  +  A+ D  
Sbjct: 11  KALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCN 70

Query: 161 SAISIDPSYFRGYSRLGFA 179
            AI +DP   + Y R G +
Sbjct: 71  KAIELDPKNVKAYHRRGLS 89

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 58  SEFKGQHLADILNSASRVPESNKKDD------AENVEINIPED---DAETKAKAEDLKMQ 108
           SEFK +   +IL   +R+P    K D       ENVE+   +    + E    AE+ K Q
Sbjct: 30  SEFKDKTSDEILKEMNRMPFFMTKLDETDGVGGENVELEALKALAYEGEPHEIAENFKKQ 89

Query: 109 GNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN+    K ++ A   YT+ I V       N   +ANRAA    LK Y + ++D   A++
Sbjct: 90  GNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKALT 149

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEA 189
           I+P   + Y R   A ++  K EEA
Sbjct: 150 INPKNIKCYYRTSKAFFSLSKLEEA 174

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           A   K +GNK +  +D++ A   YT+AI+  PT +I+Y+NRA A+  L  +  A+ D  +
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTN 68

Query: 162 AISIDPSYFRGYSRLGFA 179
           AI ++ S  + Y R G A
Sbjct: 69  AIELNSSNLKAYHRRGLA 86

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 82/188 (43%), Gaps = 24/188 (12%)

Query: 58  SEFKGQHLADILNSASRVPESNKK------DDAENVEINIPED---DAETKAKAEDLKMQ 108
           SEFK +   ++L   +R+P    K      D   N+E+   +    + E    AE+ K Q
Sbjct: 25  SEFKDKSTDEVLEELNRMPFFMTKLDDTDGDGGSNMELEALKALAYEGEPHEIAENFKNQ 84

Query: 109 GNKAMANKDYELAINKYTEAIK----VLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN     K +  A   YT+ I+    V   N   YANRAA    LK +   + D ++A++
Sbjct: 85  GNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTALT 144

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----------EAMKRDYE 213
            +P   + Y R+G A  A  K E A E+ +    I+ DN +           E   R YE
Sbjct: 145 YNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKEEEIRKYE 204

Query: 214 SAKKKVEQ 221
             K K +Q
Sbjct: 205 EKKLKAQQ 212

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 78/160 (48%), Gaps = 13/160 (8%)

Query: 58  SEFKGQHLADILNSASRVPESNKK------DDAENVEINIPED---DAETKAKAEDLKMQ 108
           SEF+ ++   +L   +R+P   +K      D  ENV +   +    D E    AE+ K Q
Sbjct: 25  SEFQNKNTDQVLEELNRMPFFMRKLDDTDGDGGENVGLEALKALAYDGEPHEVAENFKNQ 84

Query: 109 GNKAMANKDYELAINKYTEAIKV-LPTNAI---YYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN+    K Y+ A   Y + I++   +N I    ++NRAA    LK Y + V D   A+ 
Sbjct: 85  GNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQALQ 144

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            +P+  + + R+  A +   K E+A EA +  L ++ ++A
Sbjct: 145 FNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA 184

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 68/145 (46%), Gaps = 13/145 (8%)

Query: 58  SEFKGQHLADILNSASRVPESNKKDD------AENVEINIPED---DAETKAKAEDLKMQ 108
           SEFK +   +IL   +R+P    K D       ENVE+   +    + E    AE+ K Q
Sbjct: 30  SEFKDKTSDEILKEMNRMPFFMTKLDETDGAGGENVELEALKALAYEGEPHEIAENFKKQ 89

Query: 109 GNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN+    K ++ A   Y++ + V       N   YANRAA    LK Y + ++D   A++
Sbjct: 90  GNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALT 149

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEA 189
           I+P   + Y R   A +   K EEA
Sbjct: 150 INPKNVKCYYRTSKAFFQLNKLEEA 174

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 66/148 (44%), Gaps = 13/148 (8%)

Query: 58  SEFKGQHLADILNSASRVPESNKKDDAENVE---------INIPEDDAETKAKAEDLKMQ 108
           SEFK +   ++L   +R+P    K D  N E         +     + E    AE+ K Q
Sbjct: 27  SEFKDKTPDEVLEELNRMPFFMTKLDESNGEGGDNLELEALKALAYEGEPHEVAENFKNQ 86

Query: 109 GNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN     K +  A + Y + I++       N   +ANRAA    LK Y   + D + A++
Sbjct: 87  GNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHALT 146

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEA 192
           ++P   + Y R+G A Y     EEA E+
Sbjct: 147 LNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 58  SEFKGQHLADILNSASRVPESNKKDD------AENVEINIPED---DAETKAKAEDLKMQ 108
           SEFK +   +IL   +R+P    + D       ENVE+   +    + E    AE+ K Q
Sbjct: 30  SEFKDKTSDEILTEMNRMPFFMTRLDDTDGAGGENVELEALKALAYEGEPHEIAENFKKQ 89

Query: 109 GNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN+    K ++ A   YT+ + V       N   +ANRAA    LK Y + V+D   A++
Sbjct: 90  GNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKALT 149

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEA 189
           I+P   + Y R+  + +   K EEA
Sbjct: 150 INPKNIKCYYRISKSFFQLRKLEEA 174

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 72/149 (48%), Gaps = 22/149 (14%)

Query: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156
           E   KA + K QGN  +  K Y  A+  Y++AI++  T +I+++NRA +   L  +  A+
Sbjct: 7   EAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTAL 66

Query: 157 KDAESAISIDPS-----YFRGYSRLGFAKYA----------QGKPEE-----ALEAYKKV 196
           +D   +I +DP      + RG S +G  +++          Q KP E     ALE  ++ 
Sbjct: 67  EDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCERF 126

Query: 197 LDIEGDNATEAMKRDYESAKKKVEQSLNL 225
             I  +   +A+  D E +K  V  SL L
Sbjct: 127 --IREERFKKAISGDGEESKVNVCASLQL 153

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 90/184 (48%), Gaps = 15/184 (8%)

Query: 58  SEFKGQHLADILNSASRVP------ESNKKDDAENVEINIPED---DAETKAKAEDLKMQ 108
           +EF+ +   ++L   +R+P      +++  D  ENVE+   +    + E    AE+ K Q
Sbjct: 28  AEFQDKSTDEVLTELNRMPFFMTKLDNSDGDGGENVELEALKALAYEGEPHEIAENFKKQ 87

Query: 109 GNKAMANKDYELAINKYTEAIKV-LPTNAI---YYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN     K +  A   Y++ I V    N I    YANRAA    +K Y + + D + A+ 
Sbjct: 88  GNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQ 147

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN-ATEAMKRDYESAKKKVE-QS 222
           ++P   + Y R+  A  A  + +EALE+ +    I+  N + + +K   E+ + ++E + 
Sbjct: 148 LNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQLEIEARR 207

Query: 223 LNLE 226
           L LE
Sbjct: 208 LKLE 211

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 72/159 (45%), Gaps = 13/159 (8%)

Query: 58  SEFKGQHLADILNSASRVP------ESNKKDDAENVEINIPED---DAETKAKAEDLKMQ 108
           SEF+G+   ++L   +R+P      E       ENVE+   +    D E    AE+ K Q
Sbjct: 24  SEFQGKTTDEVLGELNRMPFFMTKLEPGDAASGENVELEALKALAYDGEPHEVAENFKNQ 83

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNA----IYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN     K +  A   Y + I+V   +A    +   NRAA    LK Y + + D   A+ 
Sbjct: 84  GNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALK 143

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           ++P   + + R+G A     K EEA EA    L ++ +N
Sbjct: 144 LNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTEN 182

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+    KD+E AI  YT AI  L  + ++Y+NR+AA+ S+  +++ V+D  +A+ 
Sbjct: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165

Query: 165 IDPSYFRGYSR 175
           + P Y + + R
Sbjct: 166 LKPDYSKCWLR 176

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 53/94 (56%), Gaps = 5/94 (5%)

Query: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156
           E   +A + K QGN  +  K Y+ A+  Y++AI++  T +IY++NRA +   L  +  A 
Sbjct: 5   EAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQ 64

Query: 157 KDAESAISIDPS-----YFRGYSRLGFAKYAQGK 185
           +D + AI++DP      + RG S +G  ++ + +
Sbjct: 65  EDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKAR 98

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 100 AKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDA 159
           AKA + K QGN  +  +D+  A   YT+AI++  T +I+++NRA AH     +  ++ D 
Sbjct: 10  AKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 160 ESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVL-----DIEGDNATEAMKR 210
           + A+ +D    + Y R G +     + ++A    K VL     D+  D A +  ++
Sbjct: 70  DKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           KA +LK +GNK +  K Y  A   YT+AI+  P N I Y+NRA  +  L  +  ++ DA+
Sbjct: 12  KALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAK 71

Query: 161 SAISIDPSYFRGYSR 175
            AI +D +  + Y R
Sbjct: 72  RAIELDNNNLKAYHR 86

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 86/185 (46%), Gaps = 15/185 (8%)

Query: 58  SEFKGQHLADILNSASRVPE-SNKKDDAE-NVEINIPED-------DAETKAKAEDLKMQ 108
           SEFK +   ++L   +R+P    K DD++ N   N+  D       + E    AE+ K Q
Sbjct: 21  SEFKDKTTDEVLEELNRMPFFMTKLDDSDGNGGSNVTLDALKALAYEGEPHEIAENFKKQ 80

Query: 109 GNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN+A   K Y  A   Y   I+V       N + + N+AA    +K Y   + D + A+S
Sbjct: 81  GNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCKKALS 140

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT--EAMKRDYESAKKKVEQS 222
            +P   + Y R+  A  A  K +E+ E+ +  L ++  N++    +K   +  ++K    
Sbjct: 141 FNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSSLLNLLKTIIKKQEEKTAYR 200

Query: 223 LNLEK 227
           L LE+
Sbjct: 201 LKLER 205

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 51/87 (58%), Gaps = 2/87 (2%)

Query: 90  NIPEDDAETKAK-AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSS 148
           N+ E   E K K A  LK +GN+   NK Y+ AI  Y+ AI+V   + ++Y+NR+A + S
Sbjct: 82  NLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVS 140

Query: 149 LKEYDQAVKDAESAISIDPSYFRGYSR 175
           L + ++ V+D  +A+ + P Y +   R
Sbjct: 141 LGQQEKVVEDTTAALKLKPDYSKCLLR 167

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%)

Query: 122 INKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKY 181
            + + +A+K+ P+ A  Y +R   +   ++++QA KD E A  +  S    Y +L    Y
Sbjct: 359 FDNFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTY 418

Query: 182 AQGK 185
            +GK
Sbjct: 419 REGK 422

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 91  IPEDDAETKAK-AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSL 149
           + E  AE K K A  LK +GN+   NK +E A+  Y+ AI+V   + ++Y+NR+A + SL
Sbjct: 84  VDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSL 142

Query: 150 KEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEAL 190
            + ++ V+D  +A+ + P Y +   R   A  + GK  +A+
Sbjct: 143 GQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAM 183

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%)

Query: 122 INKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKY 181
            + + +A+++ P  A  Y +R   H   ++++QA KD E A  ++ S    Y +L    Y
Sbjct: 360 FDNFEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTY 419

Query: 182 AQGK 185
            +GK
Sbjct: 420 REGK 423

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           AEDLK++GN    N DYE AI  Y +A  +  +N IY++N A A   L+ + +AV   + 
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDK 100

Query: 162 AI 163
            +
Sbjct: 101 GL 102

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 95  DAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLK 150
           + E    AE+ K QGN     + Y+ A   Y + ++V       N   + NRAA    LK
Sbjct: 73  EGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELK 132

Query: 151 EYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            + + + D + A+  +P   + + R+G A ++  K EEA EA +  L  + +NA
Sbjct: 133 NHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNA 186

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 82  DDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYAN 141
           +D  ++E+    + AE    A +LK +GN     KDYE AIN Y  A++ L  + ++Y+N
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSN 124

Query: 142 RAAAHSSLKEYDQAVKDAESAISIDPSY 169
            AA + SL+   +A++    A+ ++P Y
Sbjct: 125 MAACYISLEHNKEAIEACSKALELNPDY 152

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 8/80 (10%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN     KD+E AI  YT A+  L  + +YY+N +A +SSL  Y++ ++ A  A++
Sbjct: 98  LKEKGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATKALA 156

Query: 165 IDPSYFR-------GYSRLG 177
           + P Y +        Y +LG
Sbjct: 157 LRPDYSKVLVRRANAYEKLG 176

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 18/116 (15%)

Query: 125 YTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQG 184
           Y +A+K+   NA  Y +R   +   ++Y++A +D + A  +DP     Y +L    Y + 
Sbjct: 363 YEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYREN 422

Query: 185 KPE--EAL--EAYKKVLDIEGDNATE---------AMKRDYESAKKKVEQSLNLEK 227
           K +  E L  EA +K       N++E         A K D+++A K+ E+++ LEK
Sbjct: 423 KFDDCETLFSEARRKF-----PNSSEVPNFYAEILADKGDFDAALKEYERAIELEK 473

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 72/144 (50%), Gaps = 21/144 (14%)

Query: 66  ADILNSASRVPESNKKDDAENVEI-NIPEDDAETKAKAEDLKMQGNKAMANKDYELAINK 124
           AD+L S      +N  +D + ++I ++P +  E K  +  LK +GNK    KDY  AI  
Sbjct: 91  ADVLTSYP----TNDSNDPDMIQITSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKY 144

Query: 125 YTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQG 184
           Y  A+  L  + I+Y+N +A + SL + D+ ++ +  A+ ++P+Y +   R       + 
Sbjct: 145 YNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLR-------RA 196

Query: 185 KPEEALEAYK------KVLDIEGD 202
              E+LE Y        VL + GD
Sbjct: 197 SANESLENYSDALFDLSVLSLNGD 220

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 65/145 (44%), Gaps = 13/145 (8%)

Query: 58  SEFKGQHLADILNSASRVPESNKKDD------AENVEINIPED---DAETKAKAEDLKMQ 108
           SEFK +   +IL   +R+P    K D       ENVE+   +    + E    A   K Q
Sbjct: 30  SEFKDKTSDEILREMNRMPFFMTKLDETDGAGGENVELEALKALAYEGEPHEIAGGFKKQ 89

Query: 109 GNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN+    K ++ A   Y + + V       N   +AN+AA    LK Y + ++D   A+S
Sbjct: 90  GNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCSKALS 149

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEA 189
           I+P   + Y R   A +   K EEA
Sbjct: 150 INPKNTKCYYRTSKAFFQLNKLEEA 174

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 89/190 (46%), Gaps = 20/190 (10%)

Query: 58  SEFKGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAED---------LKMQ 108
           SEFK +   +I    +R+P    + D  + E  + ++    KA A +          K +
Sbjct: 21  SEFKDKSADEIFEELNRMPFFMTQLDETDGEGGVNDNLEALKALAYEGEPHEIAGNFKNR 80

Query: 109 GNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN+    K Y  A   YT+ I V       N   YANRAA    LK + + ++D + A+S
Sbjct: 81  GNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKALS 140

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----EAM-KRDYESAKKK 218
            +    + Y R+G A  +  + +E+ E+ +  L I+ +N +     +A+ KR  E  ++K
Sbjct: 141 FNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEIQRRK 200

Query: 219 -VEQSLNLEK 227
            +E  + LEK
Sbjct: 201 DMEMKIKLEK 210

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 82/182 (45%), Gaps = 18/182 (9%)

Query: 58  SEFKGQHLADILNSASRVPE-SNKKD-DAENVEINIPED---DAETKAKAEDLKMQGNKA 112
           SEF+ +   ++L   +++P   NK D D  NVE+   +    + E    A + K QGN  
Sbjct: 21  SEFQNKTTDEVLEELNKMPFFMNKLDPDESNVELEALKAMAYEGEPHEIATNFKNQGNDL 80

Query: 113 MANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
              K ++ A   Y +A+ V    L  N   Y N AA    +K Y   +     A+ ++  
Sbjct: 81  YKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALKLNAK 140

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN---------ATEAMKRDYESAKKKV 219
             + + R+G A    G+ E++LEA +  L ++ +N         ATE +KR  E   + +
Sbjct: 141 NVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRKKELENRTL 200

Query: 220 EQ 221
            Q
Sbjct: 201 AQ 202

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 13/159 (8%)

Query: 58  SEFKGQHLADILNSASRVPESNKK------DDAENVEINIPED---DAETKAKAEDLKMQ 108
           SEF+ +   ++L   +R+P    K      D  EN E+   +    + E    A + K Q
Sbjct: 25  SEFQNKTTDEVLEELNRMPFFMTKLDDTDGDGGENQELEALKALAYEGEPHEIAGNFKNQ 84

Query: 109 GNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN     K ++ A   Y + I++       N   YANRAA    +K Y + + D ++A+ 
Sbjct: 85  GNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTALQ 144

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            +P   + Y R+G A  A    EEA ++ +  L ++  N
Sbjct: 145 YNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVDSSN 183

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E+LK +GN +  N  Y  AI+ Y   I + P+N I Y+N+A A      +D+A+   E  
Sbjct: 4   EELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKG 63

Query: 163 ISI 165
           + +
Sbjct: 64  LQL 66

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 64/124 (51%), Gaps = 17/124 (13%)

Query: 85  ENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAA 144
           EN+E  + ++  ET A A  LK +GN+    KDY+ A+  Y  A+ V+  + ++Y+N +A
Sbjct: 87  ENIE-ELSQELRETYATA--LKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISA 142

Query: 145 AHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYK------KVLD 198
            + SL + D+ V+++  A+ + P Y +   R       +    E+LE Y        VL 
Sbjct: 143 CYVSLGQLDKVVENSTKALELKPDYSKALLR-------RASANESLENYADAMFDLSVLS 195

Query: 199 IEGD 202
           + GD
Sbjct: 196 LNGD 199

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+      +E AI  Y  A+K L  + IYY+N +A ++SL +Y++ ++ A  A+ 
Sbjct: 113 LKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALK 171

Query: 165 IDPSYFRGYSRLGFAKYAQG 184
           + P++ +   R   A  A G
Sbjct: 172 LRPTFSKVLMRRALAYEAMG 191

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           A +LK +GN+    KDYE A+  Y  A+ +L  + ++Y+N +A + SL E D+ ++ +  
Sbjct: 108 AIELKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTK 166

Query: 162 AISIDPSYFRGYSR 175
           A+ + P Y +   R
Sbjct: 167 ALELKPDYSKALLR 180

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+   ++ YE AI  Y  A+K L  + ++Y+NR+A +  L + ++ V+D  +A+ 
Sbjct: 98  LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156

Query: 165 IDPSYFRGYSR 175
           + P Y +   R
Sbjct: 157 LKPDYSKCLLR 167

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%)

Query: 125 YTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQG 184
           + +A+++ P ++  Y +RA  +  ++++DQA KD + A   DPS    Y +L    Y + 
Sbjct: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421

Query: 185 K 185
           K
Sbjct: 422 K 422

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 73/161 (45%), Gaps = 13/161 (8%)

Query: 58  SEFKGQHLADILNSASRVPE-SNKKDDAE-----NVEINIPED---DAETKAKAEDLKMQ 108
           S+FK +   ++    +R+P    K DD +     NV ++  +    + E    A + K Q
Sbjct: 21  SDFKDKTTDEVFEELNRMPFFMTKLDDTDGDGGSNVTLDALKALAYEGEPHEIAGNFKNQ 80

Query: 109 GNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN     K +  A   Y +AI V       N   YANRAA    LK Y + + D + A+S
Sbjct: 81  GNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALS 140

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++P   + Y R+  A  A  K ++  EA +  L  + +N +
Sbjct: 141 LNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 46/105 (43%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           K E     GN     KD+E AI  + +A K+ P  A  Y  +    SS   +D A K   
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFR 609

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
            AI+ DP ++  Y  +G      G  +EAL  ++K   I   NA 
Sbjct: 610 KAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAV 654

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           +K +GN+    K YE AI  Y+ A++ L  + ++Y+NR+A    L + ++ V+D  +A+ 
Sbjct: 101 MKDKGNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALE 159

Query: 165 IDPSYFRGYSR 175
           + P Y +   R
Sbjct: 160 LKPDYSKCLLR 170

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 79/174 (45%), Gaps = 14/174 (8%)

Query: 58  SEFKGQHLADILNSASRVPESNKKDDA------ENVEINIPED---DAETKAKAEDLKMQ 108
           SEF+ +   D++   +R+P    K D       +NVE+   +    + E    AE+ K Q
Sbjct: 25  SEFQNKSTDDVMEELNRMPFFMSKLDGTDGEGGQNVELEALKALAYEGEPHEVAENFKNQ 84

Query: 109 GNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN     K Y+ A   Y   I +       N   ++NRAA    LK Y + V D + A+ 
Sbjct: 85  GNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRALQ 144

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN-ATEAMKRDYESAKK 217
            +    + Y R+  A     K E+A +A +  L ++ +N A  A++++ +  K+
Sbjct: 145 YNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPENQALNALRQNVDKKKQ 198

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
           GN     KD+E AI  + +A +V P  A  Y  +   HSS   +D A      A++ DP 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG +    G+ +EAL  ++K   I   N 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV 637

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISID 166
           +QG++  +N  ++ A N Y +A+   P +   Y     +   L +YD+A+   E A SI+
Sbjct: 574 LQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSIN 633

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           P         G A       E+AL  Y+   +++  ++    KR
Sbjct: 634 PINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKR 677

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%)

Query: 139 YANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKK 195
           Y N +A +  L+E D+A + +   I I+P   +GY R+G     QGK  EA + YKK
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKK 130

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 71/161 (44%), Gaps = 13/161 (8%)

Query: 58  SEFKGQHLADILNSASRVP------ESNKKDDAENVEINIPED---DAETKAKAEDLKMQ 108
           SEF+ ++  +IL   +R P      +    D   N+E+   +    D E    AE+ K Q
Sbjct: 25  SEFQDKNADEILEELNRQPFFMTQLDETDGDKGANLELEALKALAYDGEPHEVAENFKNQ 84

Query: 109 GNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
            N     K ++ A   Y + I++       N   +AN AA    +K + + +   + A+ 
Sbjct: 85  ANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQKALQ 144

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
            +P   + Y R+  A Y   K +EA E+ K  L I+ +N +
Sbjct: 145 FNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKS 185

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 57/101 (56%), Gaps = 2/101 (1%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           A++LK +GN+   +KD E AI  Y  A++ L  + ++Y+N +A + ++ + D+ ++ +  
Sbjct: 158 AKELKNKGNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNK 216

Query: 162 AISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           A+ + P Y +   R   A  A G  +EAL  +  +L + G+
Sbjct: 217 ALELKPDYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 106/251 (42%), Gaps = 24/251 (9%)

Query: 58  SEFKGQHLADILNSASRVPESNKKDDAENVE---------INIPEDDAETKAKAEDLKMQ 108
           +EF  +   ++L   +++P    K D  +VE         +     + E    A + K Q
Sbjct: 26  TEFHDKTTDEVLKELNKMPFFMTKLDNADVENGGNVELEALKALAYEGEPHEVAANFKNQ 85

Query: 109 GNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN     K Y+ A   Y++ I+V       N   Y NRAA    L+ +   + D + A++
Sbjct: 86  GNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKALN 145

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
            +    + + R+G A +   K EEA  +   +  ++ D+   A+    ++  K+ E++  
Sbjct: 146 FNAKCVKAFYRMGQAYFKLKKLEEAKGSV--LFGLKLDSQNNALVSLLDTIVKQEEKANV 203

Query: 225 LEKTVPEQSRDADVDASQXXXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQ 284
           LE++     ++ D+ AS+                      N P ++Q +  M+S P   +
Sbjct: 204 LEESRFRDQQEKDLHASKLKEALSWRKITEFKTA------NPPAVLQNSTLMLSEP---E 254

Query: 285 NIQKMMQDPSI 295
           +I+  +  P++
Sbjct: 255 DIESQLSFPAM 265

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 77/146 (52%), Gaps = 9/146 (6%)

Query: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156
           + K  A  LK +GN     K +E AI  Y  AIK L  + ++++N +A + SL + D+ V
Sbjct: 88  QKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVV 146

Query: 157 KDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD---NATEAM-KRDY 212
           + +  A+ + P Y +   R   A    G+ ++A+     VL + GD   ++ E M +R+ 
Sbjct: 147 ESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLERNL 205

Query: 213 -ESAKKKVEQSLNLEKTVP--EQSRD 235
            + A + +++ + ++ +VP  EQ R+
Sbjct: 206 NKQALRVLKEDMGIDASVPQAEQPRE 231

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           A  LK +GN    +K+++ AI  Y  AI++ P + ++Y+N +A + S  + ++ V+    
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 162 AISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 46/105 (43%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           K E     GN     KD++ AI  + +A ++ P  A  Y  +   HSS    D A     
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 591

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
            A++ DP ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 592 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 636

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 46/105 (43%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           K E     GN     KD++ AI  + +A ++ P  A  Y  +   HSS    D A     
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 603

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
            A++ DP ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 604 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 648

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 14/104 (13%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+    KDY+ A+  Y  A+  L  + ++Y+N +A + S+ + D+ V+++  A+ 
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALE 167

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
           + P Y +   R       +    E+LE Y        VL + GD
Sbjct: 168 LKPDYSKALLR-------RASANESLENYPDAMFDLSVLSLNGD 204

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 46/105 (43%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           K E     GN     KD++ AI  + +A ++ P  A  Y  +   HSS    D A     
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 598

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
            A++ DP ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 599 KALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVV 643

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156
           + +A A  LK +GN     K +  AI  Y  AI++ P + ++Y+N +A + S  + D+ V
Sbjct: 126 QRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVV 185

Query: 157 KDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           +    A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 47/108 (43%)

Query: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156
           E + K E     GN     KD++ AI  + +A K+ P     Y  +   + S+  YD A 
Sbjct: 585 EFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAK 644

Query: 157 KDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
                AIS D  ++  Y  +G      G+ E+AL  ++K   I   NA
Sbjct: 645 TFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNA 692

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 119 ELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGF 178
           E A+N Y  A ++ PT+++    RA    S+ +Y QA+   E  I I P        LG 
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQ 768

Query: 179 AKYAQGKPEEALEAYKKV--LDIEGDN-ATEAMKRDYE 213
                G+ ++A++ Y     LD +G N  ++A+K+ +E
Sbjct: 769 LYQIMGRKKDAIKRYTIAMNLDPKGSNLISDALKKCHE 806

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
           G  +M   +YE A+  + +A  + P+NAI           L   ++A+   E A  I P+
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
                 +     Y+  K  +AL+A+++++ I  + AT
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEAT 761

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 18/58 (31%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQ-----------------KMMQDPSIRQMAEGFASG 305
           +PQ+MQ AQ ++  NPG MQN+Q                 KMMQDP++++MA+ F  G
Sbjct: 527 SPQMMQQAQQRLRQNPGMMQNMQNMFGGAGGGMPDMNEMMKMMQDPNMQKMAQQFGMG 584

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%)

Query: 133 PTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEA 192
           P   +   NRAA    L + D+A+ DA   I++D    +GY R G      G+ EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 193 YKKVLDIEGD 202
           Y+  L   G+
Sbjct: 127 YENGLKQAGE 136

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 43/96 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
           GN     +D++ AI  + +A +V P  A  Y  +   HSS    D A      AI+ DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      G+ EEAL  ++K   I   N 
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV 611

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E     GN     K++  AI  + +A +V P  A  Y  +   ++S   +D A +    A
Sbjct: 529 ETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKA 588

Query: 163 ISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           I+ DP ++  Y  LG      G+ EEAL  ++K   I   N  
Sbjct: 589 IACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVV 631

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155
           ++ +A A  LK +GN     K++  AI  Y  AI++ P   ++Y+N +A + S  + ++ 
Sbjct: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180

Query: 156 VKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           ++    A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E +K QGN A  N ++  A   Y + I + P N I Y+NRA A   L+++ + +   +  
Sbjct: 5   ETVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRG 64

Query: 163 I 163
           +
Sbjct: 65  L 65

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
           GN    NKD++ AI  + +AI++ P  A  Y  +   +S+   +D A      A++I+ +
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKK 195
           ++     LG      GK EEAL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  A+ 
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           + P Y +   R   A    GK  +A+     VL + GD
Sbjct: 161 LKPDYSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
           N + +A+K+   N+  Y +R   +  L+ YDQA KD + A  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%)

Query: 100 AKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDA 159
           ++ E  K QGN       Y  A++ Y + I   P N + Y+N+A A   L EY QA++  
Sbjct: 2   SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMC 61

Query: 160 ESAI 163
           +  +
Sbjct: 62  QQGL 65

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           GN+     +Y+LAI +Y + I + PTNA+ Y+N A A+   +  D+A    E  +S
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGLS 97

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%)

Query: 146 HSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEA 189
           H    EYD A++     IS++P+   GYS L  A      P+EA
Sbjct: 45  HFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEA 88

>KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.395
           YPR088C gene spans a gap in the genome sequence
          Length = 537

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 21/63 (33%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQ--------------------KMMQDPSIRQMAEGFAS 304
           +PQ+MQ AQ ++  NPG M+N+                     KMMQDP ++QMA+ F +
Sbjct: 474 SPQMMQQAQQRLKQNPGMMKNMMDMFGGANGGAGGMPNMNDMMKMMQDPKMQQMAQQFGA 533

Query: 305 GGG 307
           G G
Sbjct: 534 GMG 536

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155
           ++ +  A  LK +GN     K++  AI  Y  AI++ P + ++Y+N +A + S  + ++ 
Sbjct: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177

Query: 156 VKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           ++    A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156
           LK +GN      DYE A+  Y +AI   P+N I Y+N A     L+++ +AV
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAV 58

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN       +E AI  Y  AI+ L  N I+Y+N +A + SL + ++ +K    A+ 
Sbjct: 114 LKDKGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALE 172

Query: 165 IDPSY 169
           + P Y
Sbjct: 173 LKPDY 177

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  A+ 
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPSY 169
           I P Y
Sbjct: 161 IKPDY 165

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
           N + +A+K+ P N+  Y +R   +  L+ YDQA KD + A  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 55/125 (44%), Gaps = 21/125 (16%)

Query: 133 PTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLG--FAKYAQGKPEEAL 190
           P   I   NRAA+   +    +A+ DA+  I +D    +GY R G    K AQ K  EAL
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDK--EAL 124

Query: 191 EAYKKVLDIEGDNATEAMKRDY-----------ESAKKKVEQSLNLEKTVPEQ--SRDAD 237
             Y++ L      A EA +  +           E  K +V + LNL+K  P    S+   
Sbjct: 125 YVYREGL----SKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKLTPTTGASKRTH 180

Query: 238 VDASQ 242
           ++A Q
Sbjct: 181 IEAIQ 185

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEY 152
           E+ K++GN A    ++  A+N Y +AI   PTN + Y+N A A   L  Y
Sbjct: 5   EEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNY 54

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E  K +GN+      Y++A   Y + + + P N I Y+N+A A   L  Y + V+     
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKG 63

Query: 163 ISIDPS 168
           ++  P+
Sbjct: 64  LTFTPN 69

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 90  NIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSL 149
           N  E+  ET + A  LK +GN+    + YE A+  Y  A+  L  + ++Y+N +A + SL
Sbjct: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145

Query: 150 KEYDQAVKDAESAISIDPSYFRGYSR 175
              ++ V+ +  A+ + P Y +   R
Sbjct: 146 GNLEKVVESSTKALELKPDYSKALLR 171

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 20/117 (17%)

Query: 125 YTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQG 184
           + +A+ V P +A  Y +R   H   ++Y++A  D E A   D S    Y +L    Y +G
Sbjct: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEG 425

Query: 185 KPE-----------------EALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           K +                 E    Y +VL  +GD   +A  + Y+ A K++E+SL+
Sbjct: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD--FDAASKQYDIA-KRLEESLD 479

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  A+ 
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           + P Y +   R   A    G   +A+     VL + GD
Sbjct: 161 LKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
           N + +A+K+   N+  Y +R   +  L+ YDQA KD + A  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 45/105 (42%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           K E     GN     KD++ AI  + +A ++ P  A  Y  +   HSS    D A     
Sbjct: 550 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 609

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
            A++ D  ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 610 KALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 654

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+    K ++ AI  Y  A++ L  + ++Y+NR+A + S+ + ++ V+D  +A+ 
Sbjct: 105 LKDKGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALK 163

Query: 165 IDPSYFRGYSR 175
           +   Y +   R
Sbjct: 164 LKSDYSKCLLR 174

>TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {ON}
           Anc_3.395 YPR088C
          Length = 536

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQKMMQDPSIRQMAEGFASGGGTPNLSD---LMNNPALR 321
           +PQ+MQ AQ ++  NPG M+N   MM          G  S GG PN++D   +M +P ++
Sbjct: 472 SPQMMQQAQQRLRQNPGMMEN---MMNMFGGAGGMPGMGSAGGMPNMNDMMKMMQDPKMQ 528

Query: 322 NMA 324
            MA
Sbjct: 529 EMA 531

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E LK QGN     +DY  A+  Y + ++   TN I ++NRA     L    +A K  ++ 
Sbjct: 5   ERLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAG 64

Query: 163 ISI 165
           +++
Sbjct: 65  LAL 67

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  A+ 
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           + P Y +   R   A    G   +A+     VL + GD
Sbjct: 161 LKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182
           N + +A+K+   N+  Y +R   +  L+ YDQA KD + A  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%)

Query: 104 DLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRA 143
           DLK +GN      DY  A   Y + IK+ PTN I Y+N+A
Sbjct: 5   DLKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKA 44

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 45/104 (43%)

Query: 101 KAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAE 160
           K +     GN     +D+E AI  + +A K+    A  Y  +   HSS    D A     
Sbjct: 481 KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYR 540

Query: 161 SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            A++ DP ++  Y  LG      G+ ++AL  ++K  +I   N 
Sbjct: 541 RALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV 584

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 47/104 (45%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISID 166
           +QG++  +N   + A N Y  A+   P +   Y      +  L +YD+A+   E A +I+
Sbjct: 521 LQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNIN 580

Query: 167 PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           P         G A       E+AL+ Y++  +++  ++    K+
Sbjct: 581 PVNVILICCCGVALEKLSYQEKALQYYEQACELQPSSSLAKFKK 624

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E+ K +GN+     DY  A   Y   I   PTN I Y+N+A +    + +DQA++   + 
Sbjct: 4   EENKTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTG 63

Query: 163 I--SIDPSY 169
           +  S DP +
Sbjct: 64  LLYSSDPEH 72

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156
           ET A A  LK +GN+    K  E AI  Y  A++    + ++YAN +A + SL ++++ +
Sbjct: 103 ETYALA--LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVL 159

Query: 157 KDAESAISIDPSY 169
           ++   A+ + P Y
Sbjct: 160 ENCNKALELKPDY 172

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 89  INIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAA 144
           + +P    E     E  +  G +     DY+ A+++Y +++  LP       I Y+N  A
Sbjct: 534 VKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILA 592

Query: 145 AHSSLKEYDQAVKDAESAISIDP 167
           A   + EY Q+VKD + A+ + P
Sbjct: 593 AQLKVGEYSQSVKDCDVALELFP 615

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 104 DLKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLKEYDQAVKDA 159
           + K +G++   N DY  A+ +Y +++  LP       I Y+N  A    + EY ++++D 
Sbjct: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475

Query: 160 ESAISIDP 167
           + A+S+ P
Sbjct: 476 KIALSLFP 483

>Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {ON}
           YPR088C (REAL)
          Length = 539

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 24/64 (37%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQN-----------------------IQKMMQDPSIRQMAEG 301
           +PQ+MQ AQ K+  NPG MQN                       + KMMQDP +++MA+ 
Sbjct: 476 SPQMMQQAQQKLKQNPGLMQNMMSMFGGSGMGGGMGGGMPDMNEMMKMMQDPQMQEMAKQ 535

Query: 302 FASG 305
           F  G
Sbjct: 536 FGMG 539

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 27/134 (20%)

Query: 86  NVEINI-PEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIK----VLP------T 134
           N +IN  PED ++       +K  G      KDY+ A+ KY +++K     +P       
Sbjct: 221 NDDINFDPEDSSKAYEATNTIKESGTLLFKQKDYQNALLKYKKSLKYVNEFIPEMEVNKD 280

Query: 135 NAI--------YYANRAAAHSSLKEYDQAVK------DAESAISIDPSYFRGYSRLGFAK 180
           N I         Y N +  + +LK+ D  +       D E+   +D +  + Y R G A 
Sbjct: 281 NCILFTVLKMKLYLNISLVYFNLKDNDNCITYTTYLLDMENVPDLDQA--KAYYRRGNAY 338

Query: 181 YAQGKPEEALEAYK 194
           +A+ + EEAL  YK
Sbjct: 339 FAKKRLEEALNDYK 352

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 137 IYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKV 196
           ++Y+N         E+D+ +   ++A+ I P     ++RLG +     +PEEA++AY K 
Sbjct: 440 LFYSN--------NEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKA 491

Query: 197 LDIE 200
           L ++
Sbjct: 492 LQLK 495

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 61/145 (42%), Gaps = 7/145 (4%)

Query: 59  EFKGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQG--NKAMANK 116
           E KG     I N    +   N ++  ENV ++IP          + L +    N  +   
Sbjct: 351 ELKG---VTISNWPQELSILNVRETMENVLLDIPSTAINITRDKDILTVLALFNYLLGRS 407

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176
           D   AI  + + ++  P + I + +  A  ++ K YD A++   + I + PS+ R    L
Sbjct: 408 DN--AIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNL 465

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEG 201
           G      G+ +  +E+    L ++G
Sbjct: 466 GSTLVKNGELQRGIESLLTALVMQG 490

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 91  IPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAH 146
           IP    E    AE  + +G +   N DY  +  +Y +++  LP N     I Y+N  A+ 
Sbjct: 393 IPISHIELSGYAE-FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASE 451

Query: 147 SSLKEYDQAVKDAESAISIDP 167
             + EY +++K++ SA+ + P
Sbjct: 452 LKIGEYSKSLKNSSSALEMFP 472

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 60/137 (43%), Gaps = 29/137 (21%)

Query: 82  DDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIK----VLPTNAI 137
           DD +N +   PE  +E+   A  +K  G +    KD++ A  KY +A++     +P   +
Sbjct: 262 DDDKNFD---PESFSESYKAANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDV 318

Query: 138 --------------YYANRAAAHSSLKEYDQAVKDA------ESAISIDPSYFRGYSRLG 177
                          Y N +    +LK+YD A+  A      E   ++D +  + Y R G
Sbjct: 319 DEELSVKFAELKMKLYLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKA--KAYYRRG 376

Query: 178 FAKYAQGKPEEALEAYK 194
               A+ + EEAL+ YK
Sbjct: 377 NCYLAKNRLEEALKDYK 393

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
           GN    N+D++ AI    +A  + P  A  Y  +   +S+   +D A      A++I+P+
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  +  LG +    G+ +EAL  ++K   I   N 
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 540

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLK--EYDQAVKDAESAIS 164
           +QG++   N  ++ A   Y +A+ + P +  Y A+     S +K  +YD+A+   E A S
Sbjct: 477 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 534

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           I+P         G A    G+ E+AL+ Y+   +++ +++    K+
Sbjct: 535 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGY 173
           AN +++  I+ +  A+KV P + + +    A+ ++    ++A++    A+ + PS+ R  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEGD 202
             L  +    G  +EA E     L   D+EG+
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 141 NRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAY 193
           NRAA+   L + D+A+KDA++ I ++P   + Y R G       K +EA   Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa]
           {ON} Anc_3.395 YPR088C
          Length = 539

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 26/67 (38%)

Query: 266 NPQLMQAAQKMMS-NPGAMQNIQ-------------------------KMMQDPSIRQMA 299
            PQLMQ AQ+ +S NP  M+N+                          KMMQDP +++MA
Sbjct: 472 TPQLMQQAQQKLSQNPNLMKNMMNMFGGAGGMPGMGGAGGMPDMNEMMKMMQDPGMQEMA 531

Query: 300 EGFASGG 306
           + F  GG
Sbjct: 532 KQFGMGG 538

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAI 163
           K QGN       Y  A++ Y   I   P N + Y+N+A A   L E+ QA++  +  +
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGL 69

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 20/114 (17%)

Query: 104 DLKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLKEYDQAVKDA 159
           + K +G     N DY  A+ +Y +++  LP       I Y+N  A+   + ++ Q+V DA
Sbjct: 364 EFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDA 423

Query: 160 ESAISIDPSY-------------FRGYSRLGFAK--YAQGKPEEALEAYKKVLD 198
           + A+ + P                R Y+ + + K    Q +  EA+E YK  LD
Sbjct: 424 QEAMKLLPEEKSLWTAAIQNSDPVRSYNDI-WPKIILRQAESYEAIEKYKLALD 476

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 41/87 (47%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGY 173
           +N D++  +  +  A+K+ P + + +    A+ ++    ++A+K    AI++ PS+ R  
Sbjct: 453 SNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRAR 512

Query: 174 SRLGFAKYAQGKPEEALEAYKKVLDIE 200
             L  A    G  +EA      VL + 
Sbjct: 513 YNLAVASMNIGCYQEAAGHLLTVLKMH 539

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 35/55 (63%)

Query: 146 HSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           H S  ++D+ ++  ++A+ I+P+    ++RLG +     + EEA++AY K ++++
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E+ K  GN    + +Y  A+  Y + I+V P N I Y+N A +   L +Y +A++   + 
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 163 I 163
           +
Sbjct: 64  L 64

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
           GN    N+D++ AI    +A  + P  A  Y  +   +S+   +D A      A++I+P+
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  +  LG +    G+ +EAL  ++K   I   N 
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 559

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLK--EYDQAVKDAESAIS 164
           +QG++   N  ++ A   Y +A+ + P +  Y A+     S +K  +YD+A+   E A S
Sbjct: 496 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 553

Query: 165 IDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           I+P         G A    G+ E+AL+ Y+   +++ +++    K+
Sbjct: 554 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAI 163
           GN       Y  A++ Y + I   P N + Y+N+A A   L EY  A++  +  +
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGL 69

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164
           LK +GN     +D+E A+  Y  A+  L  + ++Y+N +A + SL + ++ V+ +  A+ 
Sbjct: 108 LKDKGNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALK 166

Query: 165 IDPSYFRGYSR 175
           +   Y +   R
Sbjct: 167 LKHDYSKALLR 177

>CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088c
          Length = 532

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 26/66 (39%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQN-------------------------IQKMMQDPSIRQMA 299
            PQLMQ AQ K+  NPG M+N                         + KMMQDP ++ MA
Sbjct: 466 TPQLMQQAQQKLRQNPGLMKNMMNMFGGAGGMGGMGGPGGMPDMNEMMKMMQDPQMQDMA 525

Query: 300 EGFASG 305
             F  G
Sbjct: 526 RQFGMG 531

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 139 YANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYK 194
           Y N +A +  L+  D+A   ++  I++DP   +GY  +G     Q K + A +AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 14/119 (11%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGY 173
           AN+DY+  I+ +  A+ V P + + +    A+ ++    ++A++    A+ + PS+ R  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG-----------DNATEAMKRDYESAKKK 218
             L  +    G  +EA E     L   ++EG            N  E +KR + + +++
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEGVPVASGGSIPSTNILETLKRAFIAMERR 552

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 42/97 (43%), Gaps = 1/97 (1%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
           G   M   DY  A   + +A+     N I++ +    +  + +Y  A+     AI ++P 
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 169 YFRGYSRLG-FAKYAQGKPEEALEAYKKVLDIEGDNA 204
               +  LG   +    +  +AL+AYK+   +E DN 
Sbjct: 353 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLEPDNT 389

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           +  K +GN+     +Y  AI  Y + I++ P N I Y+N+A A     +  +AV+  +  
Sbjct: 4   DHFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDG 63

Query: 163 I 163
           +
Sbjct: 64  L 64

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGY 173
           AN+D++  I+ +  A+ V P +   +    A+ ++    ++A++    AI + P++ R  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG------------DNATEAMKRDYESAKKK 218
             L  +    G   EA E     L   ++EG             N  E +KR + +  ++
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEGVAMAPGSGNVPSSNILETLKRAFIAMDRR 548

Query: 219 VEQSLNLEKTVP 230
                 LE+ VP
Sbjct: 549 DL----LERVVP 556

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 108 QGNKAMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAHSSLKEYDQAVKDAESAI 163
           +G+    N DY  A+ +Y +++  LP +     I Y+N  AA   + EY   VK A+ A+
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 164 SIDP 167
            + P
Sbjct: 423 KLFP 426

>TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.313
           YLR216C
          Length = 374

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 68/156 (43%), Gaps = 25/156 (16%)

Query: 88  EINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLP-------------- 133
           ++N+ + ++  KA AED+K+ G +     +Y +A+ KYT+  K+L               
Sbjct: 208 KVNMSDVNSVIKA-AEDVKVIGTEQFKKANYPIALQKYTKCEKLLKEYFPDDLPDEDSAR 266

Query: 134 ----TNAIYYANRAAAHSSLKEYDQAVKDAESAI-----SIDPSYFRGYSRLGFAKYAQG 184
                NAI   N       +K+Y +A+  A   +     + D    + Y R G A   + 
Sbjct: 267 LRQLRNAI-ALNITLCCLKVKDYTRAIYTASEVLYEESGATDKDKTKAYYRRGLAYKGRN 325

Query: 185 KPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
             +EAL+ +++ + +  ++ T         AK+K E
Sbjct: 326 DTDEALKDFQRAMVLNPNDTTVVAAMRETKAKRKQE 361

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 34/64 (53%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           ++ L+ +GN   +  +YE A+  Y  A    P+N ++ AN + A   L+ ++ A+   + 
Sbjct: 8   SDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDR 67

Query: 162 AISI 165
           A+ I
Sbjct: 68  ALEI 71

>ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR088C
          Length = 285

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 58/142 (40%), Gaps = 17/142 (11%)

Query: 90  NIPEDDAETKAKAEDLKMQGNKAMANK----DYELAINKYTEAIKVLPTNAIYYANRAAA 145
           N+ E   E    + D    G K +A +      EL + K    ++  P +A  +   A  
Sbjct: 109 NLLEKQLEYDTDSVDYLQVGKKLIALERPALSTELWMKKLLSLLEKFPLDAELWWTLAME 168

Query: 146 HSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           +  L ++DQA+   E  + I P  +  +++L    Y +   E+ +             +T
Sbjct: 169 YYKLGQFDQAIYCFEEVLLISPLAYSAFAQLAEVLYCKAMREKPV-------------ST 215

Query: 206 EAMKRDYESAKKKVEQSLNLEK 227
           + ++   E+A + VE S N  K
Sbjct: 216 DVLQEALENALRAVELSSNCLK 237

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 86  NVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN----AIYYAN 141
           N +  IP  D E     E  K +G     N DY  ++ +Y +++  LP N     I  +N
Sbjct: 359 NTDSTIPISDIELSGYNE-FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSN 417

Query: 142 RAAAHSSLKEYDQAVKDAESAISIDPS 168
             A+   + EY ++++++  A+ + PS
Sbjct: 418 IIASQLKIGEYSKSIENSSMALELFPS 444

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 60/134 (44%), Gaps = 22/134 (16%)

Query: 68  ILNSASRVPESNKKDDAENVEINIPEDDAETKAKA--EDLKMQGNKAMANKDYELAINKY 125
           +LN  +    SN  D  E + I+  E+     AK   E L++       + D +L +   
Sbjct: 346 MLNRWAETKYSNLLDSNEGITISNEEERFALNAKIRREFLQIANRLPRVDPDVQLCLG-- 403

Query: 126 TEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGK 185
                      ++YA+         E+D+ +   ++A+S++P+    ++RLG +     +
Sbjct: 404 ----------LLFYAD--------SEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNR 445

Query: 186 PEEALEAYKKVLDI 199
            EEA++AY K L +
Sbjct: 446 SEEAIQAYYKALQL 459

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 17/89 (19%)

Query: 121 AINKYTEAIKVLP---------TNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFR 171
            I KY +    LP            ++YAN        +E+ + +    +A+ ++P+   
Sbjct: 400 VITKYLQVANALPQVDPEVQLGLGTLFYAN--------EEFGKTIDCFRTALEVNPNDEL 451

Query: 172 GYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
            ++RLG +     + EEA++AY K L ++
Sbjct: 452 MWNRLGASLANSNRSEEAIQAYHKALALK 480

>KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 924

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 84  AENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRA 143
           A+ +E N  E DA   +   D++   N  +  K +E  I KY  A   L   A YY N  
Sbjct: 579 AKRIEDN--EHDARALSILGDIRQDPNLWL--KSWE--IGKYVNAKNSL---ARYYYNPP 629

Query: 144 AAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++    K+Y+  +K    ++S+ P  F  +   G      GK + A EA+ + + ++
Sbjct: 630 SSSGLTKDYNACLKHLNESLSLYPLAFDTWYFYGCIGLECGKTDLAAEAFTRCVSLD 686

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E   + GN     KD+  AI  + +A  +    A  Y  +   H++ + YD A      A
Sbjct: 522 ETWCVVGNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKA 581

Query: 163 ISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           I+ DP ++  Y  LG      GK ++AL  ++K   I   NA
Sbjct: 582 IACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA 623

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 31/50 (62%)

Query: 151 EYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ +   ESA+ ++P+    ++RLG +     + EEA++AY + L ++
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 39/84 (46%)

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176
           D++  I+ +  A+KV P + + +    A+ ++    ++A++    A+ + PS+ R    L
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 532

Query: 177 GFAKYAQGKPEEALEAYKKVLDIE 200
             +    G  +EA      VL + 
Sbjct: 533 AVSSMNIGCFKEAAGYLLSVLSMH 556

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 36/59 (61%)

Query: 142 RAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           R   + +  ++D+ ++  + ++ I+P+    ++RLG +     KPE+A++AY + L+++
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLK 495

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 31/50 (62%)

Query: 151 EYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ +   ESA+ ++P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 39/84 (46%)

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176
           D++  I+ +  A+KV P + + +    A+ ++    ++A++    A+ + PS+ R    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 177 GFAKYAQGKPEEALEAYKKVLDIE 200
             +    G  +EA      VL + 
Sbjct: 532 AVSSMNIGCLKEAAGYLLSVLSMH 555

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 31/50 (62%)

Query: 151 EYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ +   ESA+ ++P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 31/50 (62%)

Query: 151 EYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           ++D+ +   ESA+ ++P+    ++RLG +     + EEA++AY + L ++
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 39/84 (46%)

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176
           D++  I+ +  A+KV P + + +    A+ ++    ++A++    A+ + PS+ R    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 177 GFAKYAQGKPEEALEAYKKVLDIE 200
             +    G  +EA      VL + 
Sbjct: 532 AVSSMNIGCYKEAAGYLLTVLSMH 555

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 6/90 (6%)

Query: 141 NRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           NRAA    + +  +A+KDA  A   +P   + Y R G          +ALE Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 201 GDNATEAMKRDYE-SAKKKVEQSLNLEKTV 229
           G  A   M R Y     KK+ ++L  +K +
Sbjct: 131 GVKAIRDMTRKYHLDPPKKLYEALEYQKNL 160

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 42/87 (48%), Gaps = 17/87 (19%)

Query: 123 NKYTEAIKVLP---------TNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGY 173
           ++Y + I  LP            ++YAN         E+D+ +   ++A+ + P+    +
Sbjct: 407 DQYLKVINTLPEIDPDVQLGLGVLFYAN--------DEFDKTIDCFKAALHVRPNDECMW 458

Query: 174 SRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +RLG +     + EEA++AY + + ++
Sbjct: 459 NRLGASLANSNRSEEAIQAYHRAIQLK 485

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 5/90 (5%)

Query: 91  IPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAH 146
           IP  D E     E  K +G+    N DY  ++ +Y +++  LP+N     I  +N  A+ 
Sbjct: 364 IPISDIELSGYNE-FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQ 422

Query: 147 SSLKEYDQAVKDAESAISIDPSYFRGYSRL 176
             + EY ++++++  A+++ P     +S +
Sbjct: 423 LKVGEYSKSIENSSMALALFPPTKANWSNM 452

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 21/119 (17%)

Query: 95  DAETKAKAEDLKMQGNKAMANKD-YEL--AIN-KYTEAIKVLP---------TNAIYYAN 141
           D   + K  DL +  + +  N D Y +  AI  ++ + +  LP            ++Y+N
Sbjct: 380 DKWLETKYPDLVVPNDSSQTNIDRYSMNQAITLRFLQVVNKLPQVDASLQLGLGILFYSN 439

Query: 142 RAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
                    +YD+ V    +A+++ P     ++RLG +     + EEA++AY+K L ++
Sbjct: 440 --------DDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLK 490

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 59/139 (42%), Gaps = 34/139 (24%)

Query: 92  PEDDAETKAKAED----------LKMQGNKAMANKDYELAINKYTEAIKVLPT------- 134
           P+DD  T   +ED          +K  G+     KDY+ +  KY +A+K + T       
Sbjct: 216 PDDD--THFDSEDFAAAYNASNIIKDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDV 273

Query: 135 -----------NAIYYANRAAAHSSLKEYDQAVKDAESAISIDP----SYFRGYSRLGFA 179
                          Y N   A  +LK+YD+++K     + +D        + Y R+G +
Sbjct: 274 DEKHCLLFIELKKKLYLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNS 333

Query: 180 KYAQGKPEEALEAYKKVLD 198
            +A+ + +EAL+ Y+   D
Sbjct: 334 LFAKKRYDEALKNYRLCRD 352

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 10/93 (10%)

Query: 118 YELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLG 177
           YE  +  + +A  + P N I       A   L   ++A+++ + A  + P      S L 
Sbjct: 494 YEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM-----SSLA 548

Query: 178 FAKYAQ-----GKPEEALEAYKKVLDIEGDNAT 205
             K AQ     GK   ALE+++K++ I  D AT
Sbjct: 549 LFKRAQLLLAMGKYNYALESFEKLVKIAPDEAT 581

>Kwal_55.22039 s55 (1084478..1087192) [2715 bp, 904 aa] {ON} YNL313C
           - Protein required for cell viability [contig 124] FULL
          Length = 904

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 5/92 (5%)

Query: 113 MANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRG 172
           +  K +E  I KY  A   L   A YY N  A     K+Y   +K    ++S+ P  F  
Sbjct: 584 LWKKSWE--IGKYVNAKNSL---ARYYYNPPATSGLSKDYVACLKHLNESLSLYPLAFDT 638

Query: 173 YSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           +   G      GK E A EA+ + + ++  ++
Sbjct: 639 WYFYGCVGLECGKMELAAEAFTRCVSLDSTHS 670

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 137 IYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKV 196
           ++Y+N         +YD+ V    +A+++ P     ++RLG +     + EEA++AY+K 
Sbjct: 428 LFYSN--------DDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKA 479

Query: 197 LDI 199
           L +
Sbjct: 480 LQL 482

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 141 NRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           NRAA    + E ++A++DA     I+P   + + R G       K ++A   YK  L   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 201 GDNATEAMK 209
            + AT+++K
Sbjct: 158 ANFATDSLK 166

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           A+   + GN     KD++ AI  + +A ++ P  A  Y  +   ++S + +D A      
Sbjct: 494 AQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRK 553

Query: 162 AISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKK 195
           A++ D  ++  Y  LG      G  + +L  ++K
Sbjct: 554 ALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEK 587

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPS 168
           GN    NKD++ AI  + +A ++ P     Y  +   +SS   +D A      A++ +  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++     LG      G+ EE+L  ++K   I   N 
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNV 516

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAHSSLKEYDQAVKDAES 161
           K +G +     DY  A  +Y +++  LP N     + Y+N  AA   + EY + + D ES
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336

Query: 162 AISIDP 167
           A+ + P
Sbjct: 337 ALEMFP 342

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 91  IPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAH 146
           +P  D E    +E  K +G     N DY  ++ +Y +A+  LP+N     I  +N  A+ 
Sbjct: 346 VPISDIELSGYSE-FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQ 404

Query: 147 SSLKEYDQAVKDAESAISIDP 167
             + EY +++ +++ A+++ P
Sbjct: 405 LKVGEYSKSIVNSDLALALFP 425

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISI 165
           K +GN+      Y  AI  Y   I   P N + ++N+A A   L E+ QA++  +  + +
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 166 DPS 168
             S
Sbjct: 68  AAS 70

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/99 (19%), Positives = 46/99 (46%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGY 173
           +N +++  I+ +  A+KV P + + +    A+ ++    ++A++    A+++ PS+ R  
Sbjct: 462 SNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVRAR 521

Query: 174 SRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY 212
             L  +    G  +EA +     L +      +  K +Y
Sbjct: 522 YNLAVSSINIGCYKEAAQYLLTALSMHEVEGLKGSKSNY 560

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 31/50 (62%)

Query: 151 EYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +YD+ +   ++A++++P+    ++RLG +     + EEA+ AY + L ++
Sbjct: 508 DYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLK 557

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E     G  A+     E+A   +T    + PT+A+ ++N +AA+    +  +A    + A
Sbjct: 634 ETWYFYGCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQA 693

Query: 163 ISIDPSY-FRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATE 206
           IS D    +R +           + E+ L A K++++I+ D + E
Sbjct: 694 ISSDSQKNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKSGE 738

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 16/93 (17%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAI---------YYANRAAAHSS----- 148
           E   M G   M  KD++ AI  + E + ++P N +         YY  ++ +HSS     
Sbjct: 165 ELWWMLGEIYMNLKDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVE 224

Query: 149 -LKEYDQ-AVKDAESAISIDPSYFRGYSRLGFA 179
             KE  Q ++ +A  +I +   Y +G+S +   
Sbjct: 225 LRKEIVQKSMNNALRSIELSGLYLKGWSMVAIT 257

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 41/74 (55%)

Query: 130 KVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEA 189
           ++L + +  Y     A+   ++   +++  +SAI +DP+    +  LG A  A G+ E +
Sbjct: 663 RILQSTSWPYRVLGIAYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEAS 722

Query: 190 LEAYKKVLDIEGDN 203
           ++ ++K ++++G +
Sbjct: 723 MKVFEKAMELDGSH 736

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 36/66 (54%)

Query: 139 YANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLD 198
           Y     AH   +   ++++  +SA+ ++P+    +  LG A Y+ G+ E +++ ++K L+
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 199 IEGDNA 204
           +   NA
Sbjct: 744 VSPGNA 749

>Kpol_463.11 s463 complement(29915..32269) [2355 bp, 784 aa] {ON}
           complement(29915..32269) [2355 nt, 785 aa]
          Length = 784

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 70/151 (46%), Gaps = 20/151 (13%)

Query: 13  VNYFSSIVEKKEISEDGADSLNVAMDCISEAFGF-EREAVSGILGKSEFKGQHLADILNS 71
           VN+  S++    I+ + +  LN+ +  I   F   E E +S +   +E   + LA++   
Sbjct: 286 VNHLKSLLNSTTITNNDSFILNIVILKIYSHFEINEIEFISSL---NEVLKESLANL--- 339

Query: 72  ASRVPESNKKDDAE-NVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIK 130
                 SNKK+ ++ N ++          +  + L +Q N  +  +DYELA+N    A  
Sbjct: 340 ----SFSNKKNSSDSNFQL--------INSIIDLLNLQSNFLLGKQDYELALNVSKLATS 387

Query: 131 VLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161
           + P +   + N A +++ L ++ +++    S
Sbjct: 388 LSPDSFESWYNLAISYAFLNDFKRSLFSINS 418

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score = 31.2 bits (69), Expect = 5.7,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 30/71 (42%)

Query: 161  SAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
            + I  DP+ F G  R     Y +   EE   A K+V  +  +    +      ++ K V 
Sbjct: 1450 TIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVN 1509

Query: 221  QSLNLEKTVPE 231
            + LNLE  + E
Sbjct: 1510 KFLNLESEIAE 1520

>KAFR0B02640 Chr2 (532692..533918) [1227 bp, 408 aa] {ON} Anc_8.246
           YER178W
          Length = 408

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 9/129 (6%)

Query: 68  ILNSASRVPESNKKD-DAENVEINIPEDDAE-TKAKAEDLKMQGNKAMANKDY-ELAINK 124
           +  S +   +S KKD + +NVEIN+PE   E        L  Q NKA   + Y ++ I +
Sbjct: 21  VFRSMATAKKSAKKDTNDDNVEINLPEHSFEGYMLDTPSLTFQTNKAALLQMYKDMIIIR 80

Query: 125 YTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVK-DAESAISIDPSYFRGYSRLGFAKYAQ 183
             E    +  +A+Y A +      L    +A+    E+AI+   S    Y   GF  + +
Sbjct: 81  RME----MACDALYKAKKIRGFCHLSTGQEAIAVGVENAITKKDSVITSYRCHGFT-FMR 135

Query: 184 GKPEEALEA 192
           G   +A+ A
Sbjct: 136 GGSVKAVLA 144

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 103 EDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESA 162
           E     G   + +   ELA   ++  + + PT+   ++N +AA+  L +  +A    + A
Sbjct: 632 ETWYFYGCVGLESGKMELAAEAFSRCVSLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQA 691

Query: 163 ISIDPSY-FRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEA 207
           +S D    +R +           + ++ L A K ++ I+ D   EA
Sbjct: 692 VSTDARKNWRIWENYMLVAMKLNEWQDVLMACKNLVTIKRDRVGEA 737

>ZYRO0C17138g Chr3 complement(1330370..1331980) [1611 bp, 536 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088C SRP54 Signal recognition particle
           (SRP) subunit (homolog of mammalian SRP54) contains the
           signal sequence-binding activity of SRP interacts with
           the SRP RNA and mediates binding of SRP to signal
           receptor contains GTPase domain
          Length = 536

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%)

Query: 266 NPQLMQAAQ-KMMSNPGAMQNIQKMM 290
            PQ+MQ AQ ++  NPG M+N+Q M+
Sbjct: 468 TPQMMQQAQQRLKQNPGLMKNMQNML 493

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,962,734
Number of extensions: 1388257
Number of successful extensions: 6498
Number of sequences better than 10.0: 290
Number of HSP's gapped: 6413
Number of HSP's successfully gapped: 388
Length of query: 346
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 236
Effective length of database: 40,868,139
Effective search space: 9644880804
Effective search space used: 9644880804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)