Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR006C (TSR3)6.19ON31331314870.0
Smik_15.1756.19ON31231213510.0
Skud_15.1676.19ON31231213320.0
Suva_15.1816.19ON33631213150.0
Kpol_1037.246.19ON36628311091e-152
TDEL0G045006.19ON30127610981e-151
TPHA0J003206.19ON34228210831e-148
SAKL0E01144g6.19ON43024010891e-148
ZYRO0C07832g6.19ON28124610441e-143
CAGL0E02717g6.19ON32527810451e-143
KLLA0D01111g6.19ON31427810401e-142
ACR007W6.19ON31329210241e-140
KNAG0M011506.19ON30727510171e-139
Ecym_30236.19ON34923810141e-137
KLTH0C11264g6.19ON3462949511e-128
NDAI0D007906.19ON4012619411e-126
NCAS0H008106.19ON3232889301e-125
Kwal_56.224216.19ON3372829291e-125
TBLA0A072506.19ON3043278331e-111
KAFR0L003906.19ON3292718301e-110
Suva_10.216singletonOFF5422661.1
TDEL0C036301.190ON820106694.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR006C
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   577   0.0  
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   525   0.0  
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   517   0.0  
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   511   0.0  
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   431   e-152
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   427   e-151
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   421   e-148
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   424   e-148
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   406   e-143
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   407   e-143
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   405   e-142
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   399   e-140
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   396   e-139
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   395   e-137
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   370   e-128
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   367   e-126
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   362   e-125
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   362   e-125
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   325   e-111
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   324   e-110
Suva_10.216 Chr10 complement(399264..399425) [162 bp, 54 aa] {OF...    30   1.1  
TDEL0C03630 Chr3 (637838..640300) [2463 bp, 820 aa] {ON} Anc_1.1...    31   4.5  

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/313 (93%), Positives = 292/313 (93%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240
           GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240

Query: 241 GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKXXXXXXXXXXXXXXXXXXXX 300
           GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMK                    
Sbjct: 241 GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKSREAQSEESEDEESGSKENG 300

Query: 301 XPLSYDPLGNLIR 313
            PLSYDPLGNLIR
Sbjct: 301 EPLSYDPLGNLIR 313

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/312 (84%), Positives = 278/312 (89%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNK HEPKNGRPQRGANGHSSRQNHRRMEMKY+NS+K+KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLE+VEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240
           GFLELNKELLEIYQQCTD DSVKRAEEEWLQKLEKETQERKS+AKEEDIWMMGNINRRG 
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

Query: 241 GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKXXXXXXXXXXXXXXXXXXXX 300
           G QSD SES  +S +S+ EG+ QC+EYDSLGNAI ID++                     
Sbjct: 241 GWQSDESESGGSSGESESEGDKQCVEYDSLGNAICIDSINSRKSLSEESEDEENDLEENK 300

Query: 301 XPLSYDPLGNLI 312
            P+SYD LGNLI
Sbjct: 301 EPVSYDSLGNLI 312

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/312 (79%), Positives = 271/312 (86%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNK HEPKN R QRGANGHS+RQNH+ MEMKYD SEKMKFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG+GVVCP+DLEIVEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MDWASELLSHFSWG+
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240
           GFL+LNKELLEIYQ+CTD DSVK+AE+EWL+KLE ETQERKS  K+ DIWMMGNINRRGN
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRRGN 240

Query: 241 GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKXXXXXXXXXXXXXXXXXXXX 300
           G QSD  ES E+SEQS LE + Q IEYD+LGNAI +D++K                    
Sbjct: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300

Query: 301 XPLSYDPLGNLI 312
            P++YD LGNLI
Sbjct: 301 KPVNYDSLGNLI 312

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  511 bits (1315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/312 (82%), Positives = 277/312 (88%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNK HEPKNGRPQRGANGHSSRQNH+RMEMKYDNSE   FPVKLAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDDLE+VEQHGASVVECSWARLEEV
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAS LLSHFSWG+
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240
           GFL+LN+ELLEIYQ+CTD +SVK+AEEEWLQKLEKETQERKS++K+EDIWMMGN+NR+ N
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264

Query: 241 GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKXXXXXXXXXXXXXXXXXXXX 300
           G+QSD SESEE+S+QS+LE + Q IEYDSLGNAI IDN+K                    
Sbjct: 265 GAQSDESESEEDSDQSELESDKQSIEYDSLGNAICIDNVKSRKMLSEGSEDEESEFEEDE 324

Query: 301 XPLSYDPLGNLI 312
            P+SYD LGN+I
Sbjct: 325 EPVSYDSLGNII 336

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  431 bits (1109), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 209/283 (73%), Positives = 240/283 (84%), Gaps = 12/283 (4%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKY---DNSEKMKFPVKLAMWDFDHCD 57
           M KGKNK HE + G+P RG+NGHSS+ NH+ MEMK    + S+  KFPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 58  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARL 117
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNGKGV+CP+D EIVE+ GASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 118 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFS 177
           +EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA+ELLS+FS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 178 WGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINR 237
           WG+GFLE+N+ELL+IYQQCTD +SVK+AEEEWL K+E+E QERK++A+E DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 238 RGNGSQSDTSESEENSEQS------DLEGNNQCIEYDSLGNAI 274
             NG   D  E E NS ++      + E NN+   YD+LGN I
Sbjct: 241 NMNG---DDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII 280

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  427 bits (1098), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 234/276 (84%), Gaps = 3/276 (1%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           M KGKNK  E KNG   +G+NGHSSRQNH+RMEMK   +E  KFPVKLAMWDFDHCDPKR
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKR-GTEDTKFPVKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCPDD  IVE+HGASVVECSWARL+EV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWASELLSHFSWG+
Sbjct: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240
           GFLELN+ELLEIYQQCTD DSVK AE  WL K++KE +ERKS+AK+EDIWM GN+NR+G 
Sbjct: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239

Query: 241 G--SQSDTSESEENSEQSDLEGNNQCIEYDSLGNAI 274
                ++  ES E  E  + E N + + YD LGN I
Sbjct: 240 TFLDDNEEEESSEVEESDEEEDNGKTLRYDRLGNLI 275

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  421 bits (1083), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 206/282 (73%), Positives = 236/282 (83%), Gaps = 12/282 (4%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDN------SEKMKFPVKLAMWDFD 54
           M KGKNK  E ++G+P RG+NGH +R NH+RMEMK+ N      S++  FPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 55  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSW 114
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDD E VE+ GASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 115 ARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLS 174
           ARL+EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 175 HFSWGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGN 234
           HFSWG+GFLELNKELLE+YQ+CTD +SVK+ EEEWL+K++KE QERKS+++E DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 235 INRRGNGSQSDTSESEE-NSEQSDLEGNNQ-CIEYDSLGNAI 274
            NR       D S+ EE +SEQ   E N +  I YD+LGN +
Sbjct: 241 TNR----DLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVL 278

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  424 bits (1089), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 201/240 (83%), Positives = 219/240 (91%), Gaps = 2/240 (0%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKY--DNSEKMKFPVKLAMWDFDHCDP 58
           MGKGKNK HE ++ RP RGANGHSSR NH+RMEMK   D+S   KFPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 59  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLE 118
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG+GVVCP+D  IVE+HGASVVECSWARL+
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 119 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSW 178
           EVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D ASELLS+FSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 179 GMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR 238
           G+GFLELNKELLEIYQQCTD DSVK AEE WL+K+E+E Q+RK ++KEEDIWMMGN+NRR
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 216/246 (87%), Gaps = 3/246 (1%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKY---DNSEKMKFPVKLAMWDFDHCD 57
           MGKGKNK HE ++ RP RGANGH+S+QNH+ MEMK+    NS K  FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 58  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARL 117
           PKRCSGKKLERLGLI+SLRVGQKFQG+VV+PNG GVVCP+D  IVE+HGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 118 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFS 177
           +EVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWASELLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 178 WGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINR 237
           +G  FLE+N ELLEIYQQCTD +SVK AE  WL+K+EKE ++RK++AK EDIWM GN+NR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

Query: 238 RGNGSQ 243
               SQ
Sbjct: 241 MPAASQ 246

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  407 bits (1045), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 201/278 (72%), Positives = 226/278 (81%), Gaps = 5/278 (1%)

Query: 2   GKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKY-DNSEKMKFPVKLAMWDFDHCDPKR 60
           GKGKNK H+        G+NGH +R+NHR MEMKY   S+   FPVKLAMWDFDHCDPKR
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNGK VVCPDD EIVE HGASVVECSWARLEEV
Sbjct: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A ELLSHFSWG+
Sbjct: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240
           GFLELNK+LLE YQQCTD +S+K+ EE+WLQ++++E QERK +A+ ED+WMMGN NR  +
Sbjct: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243

Query: 241 G----SQSDTSESEENSEQSDLEGNNQCIEYDSLGNAI 274
           G    S S+    EE  E+ +     + + YD+LGN I
Sbjct: 244 GLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNII 281

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  405 bits (1040), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 204/278 (73%), Positives = 231/278 (83%), Gaps = 8/278 (2%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNK    +  R Q+G+NGHSSR NH+RMEMK+ +S   KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRVGQKFQG+VVSPNGK VVCPDD  +VE++GASVVECSWARL+EV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A++LLS+FSWG 
Sbjct: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240
            FLELNKELL+IYQQCTD DSVK AEE+WLQK+E+E  ERK +AK EDIWM+GN+NR   
Sbjct: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR--- 236

Query: 241 GSQSDTSESEENSEQSDLEGNNQC----IEYDSLGNAI 274
            S+     S E  E+  L G++      I+YDSLGN I
Sbjct: 237 ASRDLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 192/292 (65%), Positives = 230/292 (78%), Gaps = 19/292 (6%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           M KGKNK  E +  +P +G++ H+ + N RR E+K+ ++++ +FP KLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+D EIVEQHG SVVECSWARL+E+
Sbjct: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240
           GFLELN+ELLE YQQCTD  S+K AEE WLQKLE+E ++R+ +  EEDIWMMGN+NR+  
Sbjct: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 239

Query: 241 GSQSDTSESEENSEQ-----------SDLE-------GNNQCIEYDSLGNAI 274
             +S   +S++NS+            SD E       G+ + + YDSLGN I
Sbjct: 240 NMRSSMLDSDDNSDSEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVI 291

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  396 bits (1017), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 196/275 (71%), Positives = 229/275 (83%), Gaps = 8/275 (2%)

Query: 2   GKGKNKMHEPKNGR-PQRGANGHSSRQNHRRMEMK-YDNSEKMKFPVKLAMWDFDHCDPK 59
           GKGKNK    +  R   +G+NGHSSR NH+RME++ +D  +  KFPVK+AMWDFDHCDPK
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63

Query: 60  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEE 119
           RCSGKKLERLGLI SL+VGQKFQGIVVSPNG+GVVCPDD  IVE+ GASVVECSWARL+E
Sbjct: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123

Query: 120 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWG 179
           VPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD AS+LLS+FSWG
Sbjct: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183

Query: 180 MGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRG 239
           +GFLELNKELLE+YQ+CTD +SVK+AEE+WL K+E+E Q+RK+ A++ DIWMMGN+NR  
Sbjct: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNRNM 243

Query: 240 NGSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAI 274
           N       ES+E   ++        I YD+LGNAI
Sbjct: 244 NKMTLSDEESDEEETEA------SSIRYDNLGNAI 272

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  395 bits (1014), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 207/238 (86%), Gaps = 2/238 (0%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           MGKG+NK ++  +   Q+G+NGHSSR NHRR+E KY+  +  KFPV LAMWDFDHCDPKR
Sbjct: 1   MGKGRNKDYDKNHS--QKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKR 58

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIKSLRV QKFQGIVVSPNGK VVCP+D EI E++G SVVECSWARLEE+
Sbjct: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A  LLSHFSWG+
Sbjct: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR 238
           GFLELNKE+LEIYQ+CTD DS+K AEE WL+++E E  ER+ + KE DIWMMGN+NR+
Sbjct: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  370 bits (951), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 184/294 (62%), Positives = 226/294 (76%), Gaps = 24/294 (8%)

Query: 2   GKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYD-NSEKMKFPVKLAMWDFDHCDPKR 60
           GKG NK     + +P   ++GH+S   HR +E K+  N     FPVKLAMWDFD CDPKR
Sbjct: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKR 61

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLG+IKSLRVGQKFQGIVVSPNGK VVCP+D  IVE++GA+VVECSWARL+EV
Sbjct: 62  CSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEV 121

Query: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180
           PFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ELLSHFSWG+
Sbjct: 122 PFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGL 181

Query: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNIN-RRG 239
            FLELNKELLE+YQ+CTD DS+K+AE+ WL+++EKE QERK+R   +D+W+ GN+N ++G
Sbjct: 182 QFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKKG 241

Query: 240 NGSQSDTSESE-------ENSEQSDLEGNNQC----------IEYDSLGNAIRI 276
           +G   + ++ E       E  E S+ E +             ++YDSLGN I +
Sbjct: 242 HGVTQNENKDEAEVGSTWEQGENSEYESDESAADGEEAYHGPVKYDSLGNEITL 295

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  367 bits (941), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 209/261 (80%), Gaps = 24/261 (9%)

Query: 1   MGKGKNKMHE--PKNGRPQRGANGHSSRQNHRRMEMKYDN---SEKM------------- 42
           MGKGKNK  +  PKN R  RGANGHSSR NH+ MEMK  N   S +M             
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 43  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLE 100
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD +
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 101 IVEQHGASVVECSWARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 156
           I+++ GA+VVECSWARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 157 AACFAIVGRMDWASELLSHFSWGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKE 216
           AACFAI+GR DWAS+LLS+FSWG+ FL+LN+EL E+Y +CTD DSVK A+EEWL K+E+E
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 217 TQERKSRAKEEDIWMMGNINR 237
             ERK +A+E DIWMMGN NR
Sbjct: 285 ATERKLQAQETDIWMMGNTNR 305

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 175/288 (60%), Positives = 226/288 (78%), Gaps = 15/288 (5%)

Query: 1   MGKGKNKMHEPKN--GRPQRGANGHSSRQNHRRMEMKY----DNSEKMKFPVKLAMWDFD 54
           MGKGKNK  +  +  GR  RGANGHSSR NH+ MEM+     D S   K PVKL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 55  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSW 114
           HCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV P+D +I+++ GA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 115 ARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAS 170
           ARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR DWA+
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 171 ELLSHFSWGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIW 230
           +LLS+FSWGM FL LN+EL E+Y QCTD DS++ A+E WL K+++E +ERK +A++ DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 231 MMGNINRRGNGSQSDTSESEENSEQSDLEG----NNQCIEYDSLGNAI 274
           +MGN NR  N +  D + S+ + ++ + +       + ++YD+LGN I
Sbjct: 241 LMGNTNRV-NDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNVI 287

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 181/282 (64%), Positives = 223/282 (79%), Gaps = 19/282 (6%)

Query: 12  KNGRPQRGAN----GHSSRQNHRRMEMKYD-NSEKMKFPVKLAMWDFDHCDPKRCSGKKL 66
           K GR  +G+N    GHS+R +   +E K+  ++    FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62

Query: 67  ERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEVPFNKIG 126
           ERLG+IKSLRVGQKFQGIVVSPNGKGVVCP+D +IVE+ GA+VVECSWARL E+PFNKIG
Sbjct: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122

Query: 127 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGMGFLELN 186
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A+ELL+HFSWG+GFLELN
Sbjct: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182

Query: 187 KELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR---GNGSQ 243
           KEL+E+YQ+CTD +SVK AE  WL+K+E+E  ER++ +  +D+WM GN+NRR   GN ++
Sbjct: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242

Query: 244 S---------DTSESEENSEQSDLEGNN--QCIEYDSLGNAI 274
           S         DT + E++  + D    N  + ++YD+LGN I
Sbjct: 243 SSQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDNLGNEI 284

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  325 bits (833), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 173/327 (52%), Positives = 215/327 (65%), Gaps = 41/327 (12%)

Query: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60
           M KGKNK HE ++ R       ++SR+N  +  +    S K  FPVKLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKGHEERSNRKS-----NNSRRNESKHSLSI-KSTKTNFPVKLAMWDFDHCDPKR 54

Query: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P D E +EQ+G +VVECSWARL+EV
Sbjct: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114

Query: 121 PFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSW 178
           PFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++AS++L  FSW
Sbjct: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174

Query: 179 GMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR 238
           G  FLELN ELL+IY  CTD  SV++A++EWL+K+E E +ERK +    D W++GN NR+
Sbjct: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234

Query: 239 GNGSQSDTSESEENS--------EQSDLEGN-----NQCIEYDSLGNAIRIDNMKXXXXX 285
                 ++SES E++        E+ D  GN     +  ++YDSLGN I  +        
Sbjct: 235 NLNDFDNSSESTEDNISTVSSADERYDALGNLISNDSHSLKYDSLGNVIESEG------- 287

Query: 286 XXXXXXXXXXXXXXXXPLSYDPLGNLI 312
                           P  YD LGN+I
Sbjct: 288 -------------DALPPKYDKLGNII 301

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  324 bits (830), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/271 (59%), Positives = 201/271 (74%), Gaps = 9/271 (3%)

Query: 13  NGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKRCSGKKLERLGLI 72
           NG  +  +NGH SR N+++ME K   S +  FPVKLAMWDFDHCDPKRCSGKKLERL LI
Sbjct: 16  NGAIRTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLI 75

Query: 73  KSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEVPFNKIGG-KHER 131
           +SL++ QKFQGI VSPNGK  V P+D E+V + G +VVECSWAR++E+PF+K    K +R
Sbjct: 76  RSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDR 135

Query: 132 LLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGMGFLELNKELLE 191
           LLPYLVAANQVNYGRPW+LNCVEA+AAC AIVG MD A ELLSHFSWG+ FL+LN+ELLE
Sbjct: 136 LLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLE 195

Query: 192 IYQQCTDCDSVKRAEEEWLQKLEKETQERKS--RAKEEDIWMMGNINRRGNGSQSDTSES 249
           IYQQCTD D ++ A++ W+ ++EKE QERK+   A+  DIWM GN+NR     + +  E 
Sbjct: 196 IYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIDESDEDNEDED 255

Query: 250 EENSEQS------DLEGNNQCIEYDSLGNAI 274
            E+ E +       +E   + + YD+LGN I
Sbjct: 256 SEDEEVTYDNLGNIIENEPREVRYDNLGNII 286

>Suva_10.216 Chr10 complement(399264..399425) [162 bp, 54 aa]
          {OFF} YOR006C (INTER)
          Length = 54

 Score = 30.0 bits (66), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 16/22 (72%)

Query: 10 EPKNGRPQRGANGHSSRQNHRR 31
          EP+ GRPQ G +GH +RQ  ++
Sbjct: 27 EPEIGRPQAGFSGHKARQGKKK 48

>TDEL0C03630 Chr3 (637838..640300) [2463 bp, 820 aa] {ON} Anc_1.190
           YJL157C
          Length = 820

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 8/106 (7%)

Query: 174 SHFSWGMGFLELNKELLEIYQQCTDC-DSVKRAEEEWLQKLEKETQERKSRAKEEDI--- 229
           SH+   +  LE    L + Y QC+ C  +VK ++E  L+K+      RKS  ++ D+   
Sbjct: 225 SHYQCYLATLEY-LYLQKKYPQCSVCGKTVKPSDEGTLEKMMSRLLSRKSYEEDPDLTIG 283

Query: 230 --WMMGNINRRGNGSQSDTSESEENSEQSDLEGNNQCIEYDSLGNA 273
             W+   +    + S S  +  E+  + +D+  N     Y SLG+A
Sbjct: 284 PQWLDLKLPHTADRS-SLFTPGEQVIQTADISSNGFRTPYQSLGSA 328

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,213,633
Number of extensions: 1408418
Number of successful extensions: 8447
Number of sequences better than 10.0: 101
Number of HSP's gapped: 8633
Number of HSP's successfully gapped: 102
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)