Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR005C (DNL4)6.18ON94494449650.0
Smik_15.1746.18ON94594541200.0
Suva_15.1806.18ON94894839770.0
Skud_15.1666.18ON94794638850.0
NCAS0D026506.18ON95094025860.0
TDEL0G045106.18ON96994225840.0
ZYRO0C07854g6.18ON94494925800.0
KAFR0A050506.18ON94894525350.0
NDAI0I022606.18ON96795925130.0
KNAG0F028706.18ON95495125030.0
Kpol_1032.76.18ON96594523920.0
TPHA0M002606.18ON96695723570.0
CAGL0E02695g6.18ON94693723100.0
TBLA0G010406.18ON97295122700.0
Kwal_56.224146.18ON96394222670.0
KLTH0C11286g6.18ON95194721600.0
ACR008W6.18ON98194820330.0
KLLA0D01089g6.18ON90794118830.0
ACL155W7.343ON6974113004e-27
KLLA0D12496g7.343ON7004142872e-25
SAKL0F10912g7.343ON6934102782e-24
CAGL0I03410g7.343ON7242972746e-24
Kpol_2001.717.343ON7264252683e-23
TBLA0E020507.343ON7204132657e-23
YDL164C (CDC9)7.343ON7552972622e-22
Suva_4.827.343ON7554432612e-22
Smik_4.747.343ON8453812613e-22
KLTH0H01408g7.343ON7234522603e-22
NDAI0A019407.343ON7654582594e-22
Kwal_56.246167.343ON7154592594e-22
KAFR0B008307.343ON7104172576e-22
TPHA0D045707.343ON7364252532e-21
Skud_4.937.343ON7552972532e-21
TDEL0C020407.343ON7053832479e-21
ZYRO0F11572g7.343ON7314092433e-20
KNAG0C037407.343ON7272942362e-19
NCAS0A141107.343ON7532682336e-19
CAGL0E05588g7.46ON88789970.008
KAFR0C051907.46ON89691900.054
Suva_8.4007.46ON98590890.065
AFR095C1.276ON67094860.14
Ecym_63411.276ON76792860.16
NDAI0E039307.46ON102891830.33
Ecym_21886.228ON461105810.58
KNAG0E004107.46ON81791810.69
ZYRO0G15180g1.276ON68863791.1
Ecym_50527.46ON87366791.1
Kpol_1023.875.547ON330130771.5
Suva_5.1233.517ON423102752.6
ZYRO0E07150g6.228ON449120752.6
KLLA0F02750g3.109ON114868753.0
NCAS0G016102.48ON84086753.2
Ecym_82575.245ON80275744.3
TDEL0F045608.331ON238286744.5
TPHA0E027706.228ON450281734.8
TDEL0E053706.228ON457105735.1
NCAS0E023707.46ON89766735.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR005C
         (944 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...  1917   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...  1591   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...  1536   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...  1501   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...  1000   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   999   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   998   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   981   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   972   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   968   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   926   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   912   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   894   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   879   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   877   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   836   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   787   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   729   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   120   4e-27
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   115   2e-25
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   111   2e-24
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   110   6e-24
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   107   3e-23
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   106   7e-23
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   105   2e-22
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   105   2e-22
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   105   3e-22
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   104   3e-22
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   104   4e-22
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   104   4e-22
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   103   6e-22
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   102   2e-21
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   102   2e-21
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   100   9e-21
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    98   3e-20
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    96   2e-19
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    94   6e-19
CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} simila...    42   0.008
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    39   0.054
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    39   0.065
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    38   0.14 
Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar t...    38   0.16 
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    37   0.33 
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    36   0.58 
KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}...    36   0.69 
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    35   1.1  
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    35   1.1  
Kpol_1023.87 s1023 (207344..208336) [993 bp, 330 aa] {ON} (20734...    34   1.5  
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    33   2.6  
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    33   2.6  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    33   3.0  
NCAS0G01610 Chr7 complement(285839..288361) [2523 bp, 840 aa] {O...    33   3.2  
Ecym_8257 Chr8 (522575..524983) [2409 bp, 802 aa] {ON} similar t...    33   4.3  
TDEL0F04560 Chr6 (855489..862637) [7149 bp, 2382 aa] {ON} Anc_8....    33   4.5  
TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.2...    33   4.8  
TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {O...    33   5.1  
NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.4...    33   5.1  

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 1917 bits (4965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 932/944 (98%), Positives = 932/944 (98%)

Query: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM 60
           MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM
Sbjct: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM 60

Query: 61  WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG 120
           WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG 120

Query: 121 KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC 180
           KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC
Sbjct: 121 KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC 180

Query: 181 VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR 240
           VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR
Sbjct: 181 VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR 240

Query: 241 LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK 300
           LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK
Sbjct: 241 LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK 300

Query: 301 FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS 360
           FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS 360

Query: 361 AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420
           AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS
Sbjct: 361 AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420

Query: 421 SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
           SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI
Sbjct: 421 SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 481 VIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSI 540
           VIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSI
Sbjct: 481 VIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSI 540

Query: 541 ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600
           ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD
Sbjct: 541 ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600

Query: 601 NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLI 660
           NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLI
Sbjct: 601 NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLI 660

Query: 661 RKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGG 720
           RKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGG
Sbjct: 661 RKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGG 720

Query: 721 KLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYC 780
           KLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYC
Sbjct: 721 KLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYC 780

Query: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDSEVRRFPLFL 840
           FNVSQKMRAVAEKRVDCLGDSFENDISET            PPMGELEIDSEVRRFPLFL
Sbjct: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLFL 840

Query: 841 FSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE 900
           FSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE
Sbjct: 841 FSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE 900

Query: 901 KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY 944
           KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY
Sbjct: 901 KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY 944

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 1591 bits (4120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/945 (80%), Positives = 851/945 (90%), Gaps = 1/945 (0%)

Query: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM 60
           M+S LDS+PEPQNFAPSPDFKWLCEELF KI EVQ+ GT GTGKSRSFKYYE++SNFVEM
Sbjct: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM 60

Query: 61  WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG 120
           WRKTVGNNIYPAL+LALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATE RLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG 120

Query: 121 KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC 180
           KG NLSSLLVEEIAKRR+EP+ KAITID +N  LD LS DR  SGRGFK+LVKS PFLHC
Sbjct: 121 KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC 180

Query: 181 VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR 240
           +E+MSFVELKYFFDI+LK+RVIGGQEHK L+CWHPDAQDYLSV+SDLKVV SKLYDP+VR
Sbjct: 181 LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR 240

Query: 241 LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK 300
           LK+DDL+IKVGFAFAPQLAKKVNL YEKICR LH+DFLVEEKMDGERIQVHYMNYG+S++
Sbjct: 241 LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR 300

Query: 301 FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS 360
           F+SRRGIDYTYLYGASLSSGTIS HL FTD+V+ECVLDGEMVTFDA+R+VILPFGLVKGS
Sbjct: 301 FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS 360

Query: 361 AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420
           AK+ALSFNSINNVDFHPLY+VFDLLYLNGTSLTPLPLHQRK+YL SIL+P+KN+VE+VR+
Sbjct: 361 AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT 420

Query: 421 SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
           SRCY VESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDL+
Sbjct: 421 SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV 480

Query: 481 VIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSI 540
           +IGRD GKKDSFMLGLL+L+E+E  K   + S  + ++S+ ++I  S+++VKKILSFCS+
Sbjct: 481 IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSV 540

Query: 541 ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600
           ANGISQEEFKEIDRKTRG WK+TSEVAPPASI EFGSKIPAEWI+P+ESIVLEIKSRSLD
Sbjct: 541 ANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLD 600

Query: 601 NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLI 660
           NTETNMQKYAT+CTLYGGYCKRIR+DK+WTDC+TLN+LY+SR+ + NPSYQAE+S L L+
Sbjct: 601 NTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLV 660

Query: 661 RKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGG 720
           RKKR+ VL S++F Q  +Q+P S IFAGL FYVLSDYVT  + +RITR ELE  IV HGG
Sbjct: 661 RKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGG 720

Query: 721 KLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYC 780
           +LIYN+ILKRH IGDVRLISCK TTEC+ALI+RGYDILHP+WV+DC+AYK+LI IEP YC
Sbjct: 721 RLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYC 780

Query: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDSEVRRFPLFL 840
           FNVSQKMRAVAEKRVDCLGDSFENDISET            PP  E+E D+EV+ FPLFL
Sbjct: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLFL 840

Query: 841 FSNRIAYVPRRKISTE-DDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVH 899
           FSNRI Y+P RKI  + +  +EMKI+LFGGKITD+QSLCNL+IIPY DP  RKDC+ EV+
Sbjct: 841 FSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVN 900

Query: 900 EKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY 944
           E+IKEQ+KA DTIPKI R+VAPEWVDHSI  NCQVPEEDFPVV Y
Sbjct: 901 EQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVTY 945

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 1536 bits (3977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/948 (77%), Positives = 831/948 (87%), Gaps = 4/948 (0%)

Query: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM 60
           M SAL +IPEP NFAPSPDF+WLCEELF K+ EV INGTAGTGKS SF+YYEIISNF E+
Sbjct: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL 60

Query: 61  WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG 120
           WRKTVGNNIYPAL+LALPYRDRRIYNIKDYVLIRT+CSYLKLPKNS TEQRLKDWKQRVG
Sbjct: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG 120

Query: 121 KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC 180
           KG +LSSLLVEEI+KRR EP+ K+IT+D+VN YLD LS +  ASGRGFK+LVKSKPFLHC
Sbjct: 121 KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC 180

Query: 181 VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR 240
           +ENM+FVELK+FFDI+LKNRVIGGQEHKLLNCWHPDAQDYLSV+SDL+VVTSKLYDP +R
Sbjct: 181 LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR 240

Query: 241 LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK 300
           LK+DDLSIKVGFAFAPQLAKKVNLSYEKIC  L +DF VEEKMDGERIQVHYMNYG+SIK
Sbjct: 241 LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK 300

Query: 301 FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS 360
           FFSRRGIDYTYLYG +L SGTISQ+L+F+DSVKECVLDGEMVTFDA R+VILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS 360

Query: 361 AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420
           AKEALSFN INN DFHPLYMVFDLLYLNGTSLTPLPL+QRK+YL+SIL P K++VEIVR 
Sbjct: 361 AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY 420

Query: 421 SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
           SRCY  ES+KKSLEVAISLGSEGVVLK+Y+SSYNVASRNNNWIKVKPEYLEEFGENLDLI
Sbjct: 421 SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 481 VIGRDSGKKDSFMLGLLVLDEEEY-KKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCS 539
           +IGRDSGKKDSFMLGLLV+DE+E  K  Q   SEI++ SS E+   N ++RV+K+LSFCS
Sbjct: 481 IIGRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCS 540

Query: 540 IANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSL 599
           IANGISQEEFKEIDRKTRGHWK+TS ++PP SILEFGSK+PAEWI+PSESIVLEIKSRSL
Sbjct: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600

Query: 600 DNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGL 659
           DNTETNMQKYATNCTLYGGYC+RIRYDK+WT+CYTL++LYE+R  KSNPS+Q E  QL L
Sbjct: 601 DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQL 660

Query: 660 IRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHG 719
           + KKRKR L+SD F Q+R+Q PIS +FAGL FYVLSDY+   TG+RITR+EL   IV+HG
Sbjct: 661 VPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHG 720

Query: 720 GKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNY 779
           GKLI+NVILKRH IGDVRLI CK T EC+ALIDRGYDILHP W++DC AY +L+ IEP+Y
Sbjct: 721 GKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSY 780

Query: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDSEVRRFPLF 839
           CF+VS K+RAVA +RVDC GDSFENDISE+                + +   E++  PLF
Sbjct: 781 CFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFELQIIPLF 840

Query: 840 LFSNRIAYVPRRKISTEDD-IIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEV 898
           LFSNRI Y+PR KI  +D+ ++EMKI+LFGGKITDQQSL NLIIIPY DPI R DC+ EV
Sbjct: 841 LFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEV 900

Query: 899 HEKIKEQIKA--SDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY 944
           H +I E +KA  SDT+P+I R+V PEWVDHSI+ENCQVPEEDFPV +Y
Sbjct: 901 HSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPVSHY 948

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 1501 bits (3885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/946 (76%), Positives = 827/946 (87%), Gaps = 4/946 (0%)

Query: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM 60
           M  A + IPEPQNFAPSPDFKWLCEELFV+I  V+INGTAGTGKS SFKYYEIISNFVE 
Sbjct: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES 60

Query: 61  WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG 120
           WRK VGNNIYPALVLALPYRDRRIYNIKDY+LIRTICSYLKLP+NS TEQRLK WKQRV 
Sbjct: 61  WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS 120

Query: 121 KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC 180
           +  NLSSLLVEEIAKRR EP+ K+ITID VN YLD LS +R  SGRGFK LV SKPFL C
Sbjct: 121 RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC 180

Query: 181 VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR 240
           +E+MSFVELKYFFDIVLKNRVIGGQEH+ LNCWHPDAQDYLSV+SDLKVVTSKLYDP+VR
Sbjct: 181 LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR 240

Query: 241 LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK 300
           LK+DDLSIKVGFAFAPQLAKKV+L YEKICR LH+DFL+EEKMDGERIQVHYMNYG+SIK
Sbjct: 241 LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK 300

Query: 301 FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS 360
           FFSRRGIDYTYLYGASLSSGTISQ+L+ T++VKECVLDGEMVTFD+ R+VILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS 360

Query: 361 AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420
           AK  LS + INN DF PLYMVFDLLYLN  SL PLPLHQRK+YL+SIL+P KN+VEIV+S
Sbjct: 361 AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS 420

Query: 421 SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480
           +RCY V+S+K SLEVAISLGSEGVVLKYYNSSYN+ASRN NWIKVKPEYLEEFGENLDLI
Sbjct: 421 TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI 480

Query: 481 VIGRDSGKKDSFMLGLLVLDEEEYKKHQGD--SSEIVDHSSQEKHIQNSRRRVKKILSFC 538
           +IGRDSGKKDSFMLGLLV+DE E ++   +  SSE+V+ S  E+ + NS+++VKK+LSFC
Sbjct: 481 IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540

Query: 539 SIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRS 598
           S+ANGIS EEFKEI+R+TRGHWKRTS+ +PP SIL+FGS+IPAEWI+PS+SIVLEIKSRS
Sbjct: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKSRS 599

Query: 599 LDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLG 658
           LDNTET++++YAT+CTLYGGYC+RIRYDK+WTDCYTL  LYE R +KS P+ Q E  QL 
Sbjct: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQ 659

Query: 659 LIRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEH 718
           L  KKRKR LISD FHQ R+Q  IS+IFAGL FYVLSDYVT+DTG+RITRA LE  IV+H
Sbjct: 660 LAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719

Query: 719 GGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPN 778
           GGKLI+NVILKRH IGDVRLISCKTT EC+ LIDRGYDI+HP+WV+DCIAYK+LI IEP+
Sbjct: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779

Query: 779 YCFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDSEVRRFPL 838
           YCF+VS K+R VAEKRVDCLGDSFEN+ISE               +GE+ IDSE +  PL
Sbjct: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPL 839

Query: 839 FLFSNRIAYVPRRKIST-EDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNE 897
           FLFSNRI Y+PR K    E+ ++EMKI+LFGG+IT QQSLCNLIIIPY D   RKDC+ +
Sbjct: 840 FLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEK 899

Query: 898 VHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVN 943
           V+E+IKEQ+KAS T+PK+AR+V+P WVDHSINENCQVPEEDFPVVN
Sbjct: 900 VNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVVN 945

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 1000 bits (2586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/940 (51%), Positives = 664/940 (70%), Gaps = 14/940 (1%)

Query: 11  PQNFAPSPDFKWLCEELFVKIHEVQIN-GTAGTGKSRSFKYYEIISNFVEMWRKTVGNNI 69
           P NF+PSP F+WLC+ELFVK+ ++Q        GK  + +YYE+I++F+ +WRKTVGN+I
Sbjct: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76

Query: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129
           +PAL+L LPYRDRR++NI+DY LI+ IC+YLKLP+NS TE+RL  WK R GKG  LS   
Sbjct: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136

Query: 130 VEEIAKRRAEPSSK-AITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVE 188
           V EI KR++EP  K  ITID +N  LD L+ +R + GRGFK L  S  F  C+ENMSF+E
Sbjct: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196

Query: 189 LKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSI 248
           L++FFDI+LKNRVIGGQEHK LN WHPDAQDYLSV+SDL+ VT++L+DP++RL+++DL I
Sbjct: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256

Query: 249 KVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGID 308
             GFAFAPQLAKK+++SYEKIC  L +DF++EEKMDGERIQ+HY +YGE +KFFSRRG D
Sbjct: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316

Query: 309 YTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFN 368
           YTYLYG S+  G I +HL+    VK+C+LDGEM+T+D  + +ILPFGLVK SA+  L+ +
Sbjct: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376

Query: 369 SINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVES 428
            I N  + PL+MVFDL+++NGTSL  +PL+ RK+YLN I +P  +I+E++ S   +  +S
Sbjct: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436

Query: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGK 488
           I+KSLE+AIS+GSEG+VLK Y+S Y VASRN++WIKVKPEYLE+FGEN+DLIVIGRD GK
Sbjct: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496

Query: 489 KDSFMLGLLVLDEEEYKK-HQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQE 547
           KDS M GL V++E+E    ++ +   ++     E       R + K +SFC IANG+SQE
Sbjct: 497 KDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTIHKFVSFCVIANGLSQE 556

Query: 548 EFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQ 607
           EFK+IDRKTRG W R+ E+ PP ++L+FG+++P EWIDP +S+V+E+K+RS+D  E+N +
Sbjct: 557 EFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAESNGR 616

Query: 608 KYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKK--RK 665
           K+AT CTLYGGYC+ IR DK+W  CYTL++   ++ VKS  +  +++   G+ R+K  R+
Sbjct: 617 KFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRN-GSDQVIHGVKRQKKNRR 675

Query: 666 RVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKLIYN 725
           + ++  S  +    L  +  F  L FYV+SD   +  G RI +  + K I E GG LI+N
Sbjct: 676 KYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHN 735

Query: 726 VILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCFNVSQ 785
           +I K+    ++R+IS K T EC ALI+RGYD+++P W++DC+  K L+ +EP YCFNVS 
Sbjct: 736 IISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVST 795

Query: 786 KMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEI---DSEVRRFPLFLFS 842
           +++ + EKRVD  GDS+E  I+E               +  L     D E+ + PLFLF 
Sbjct: 796 ELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPYADEELIKIPLFLFQ 855

Query: 843 NRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHEKI 902
           +RI   P  + S     ++ KIKL+GGK+T     CNLII+P  +    +  +    + +
Sbjct: 856 DRIMLFPNTE-SKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGN----QQLLQRTRDLL 910

Query: 903 KEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
            + I  S  +P I  +V P W++ SI EN QVPEED+PV+
Sbjct: 911 TKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/942 (53%), Positives = 657/942 (69%), Gaps = 11/942 (1%)

Query: 11  PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTG-KSRSFKYYEIISNFVEMWRKTVGNNI 69
           P NFAPSPDF WLCEELFVK+ +VQ  G    G K  S +YYE+IS+F+ +WRKTVGNNI
Sbjct: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86

Query: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129
           +PALVL+LPYRDRRIYNIKDY L++ ICSYL LPK SATE+RL  WK+R  +G  LS+  
Sbjct: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146

Query: 130 VEEIAKRRAEPS-SKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVE 188
           VEEI KR++EPS  + ITID +N  LD L  +R A G GFK L  S  F  C++NMSF+E
Sbjct: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIE 205

Query: 189 LKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSI 248
           L++FFDIVLKNRVIGGQEHKLLNCWHPDA DYLSV+SDL+ V S+L+DP+ RL+ DDLSI
Sbjct: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265

Query: 249 KVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGID 308
            +G+AF PQLAKK+ +SYEKIC  L++DFL+EEKMDGERIQVHYM+YG  I+F SRRG+D
Sbjct: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325

Query: 309 YTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFN 368
           YT LYG +L SGT++ +L F  +V++CVLDGEM+TFD  R V+LPFG+VK SA++ALS  
Sbjct: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385

Query: 369 SINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVES 428
            I +    P+ MV DL+YLNG SL  LPL+QRK++LN +L P  + VEI+   RC    +
Sbjct: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445

Query: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGK 488
           I+KSLE +IS+GSEG+VLK Y + Y + +RN+ WIKVKPEYLE+FGENLDL++IGR  GK
Sbjct: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505

Query: 489 KDSFMLGLLVLDEEE--YKKHQGDSSEIVDHSSQEKHIQNS--RRRVKKILSFCSIANGI 544
           KDS M GL V + EE   +      S IV+  S+   + ++  ++ +K  +SFC IANGI
Sbjct: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565

Query: 545 SQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTET 604
           SQ+EFKEIDRKTRG W ++ +  P A +L FGSKIP EWIDP  SI+LE+K+RSLDNTE+
Sbjct: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625

Query: 605 NMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKKR 664
           + +K+A  CTL+GGYC+RIR DK+WT CY+ ++L++ R  KS+    +   Q     K +
Sbjct: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNKQYSKKMKSK 685

Query: 665 KRVLISDSFHQNRKQ--LPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKL 722
           KR +   S    +K      +NIF GL FYVLSDY+     +RIT++E +  I+++ GKL
Sbjct: 686 KRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSGKL 745

Query: 723 IYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCFN 782
           + N+I K HS    R+IS K T EC+ALI+RGYDIL P W+LDCI  + ++ +EP +CFN
Sbjct: 746 VRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHCFN 805

Query: 783 VSQKMRAVAEKRVDCLGDSFENDISETXX-XXXXXXXXXXPPMGELEIDSEVRRFPLFLF 841
           VS ++  +   RVD  GDSF N I+E               P    E +SE+   PLFLF
Sbjct: 806 VSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDVVPLFLF 865

Query: 842 SNRIAYVPRRKISTEDDI-IEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE 900
           S R  Y+P +  +  D   +  K KL GG I      CNLII+P  +  L    + E+ +
Sbjct: 866 STRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLVEMRQ 925

Query: 901 KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
            + + +  +D+ P I  +V P+WV+ SI ENCQVPEEDF  V
Sbjct: 926 SVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/949 (52%), Positives = 661/949 (69%), Gaps = 12/949 (1%)

Query: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQING-TAGTGKSRSFKYYEIISNFVE 59
           M +  D   +P NFAPSPDFKWLC+ELFVKI  VQ      G  KS + KY+EIIS FV+
Sbjct: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60

Query: 60  MWRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRV 119
           +WRKTVG+NIYPAL+L LPYRDRRI+NIKDY LI+ ICS+L+LP NS TE+RL  WK+R 
Sbjct: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120

Query: 120 GKGGNLSSLLVEEIAKRRAEP-SSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFL 178
           G+G  LS   VEEI +RR+EP + + ITID +N  LD L+ +R   GRGFKSL  S  F 
Sbjct: 121 GRGIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFK 180

Query: 179 HCVENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPK 238
           +C+ENMSF E+KY+FDI+LK+RVIGGQEHK LNCWHPDA+DYLSV+SDLK V  KL+DP 
Sbjct: 181 YCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPS 240

Query: 239 VRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGES 298
            RLK+DDL + +G  FAP LAK++ +SY+K+   L  DF +EEKMDGERIQ+HYM+YG  
Sbjct: 241 HRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRK 300

Query: 299 IKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVK 358
           +K+FSRRG DYTYLYG  + +GT++++L+    V+ECVLDGEM++FD +   +LPFGLVK
Sbjct: 301 LKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVK 360

Query: 359 GSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIV 418
            SA+++L+   I    + PLYMV D LYLNG SL  +PL+ RKQYL++IL+P  + VEI+
Sbjct: 361 SSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEII 420

Query: 419 RSSRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLD 478
           +S  CY   SIK SLE AI +GSEG++LK++ S Y + +R +NWIK+KPEYLE+FGENLD
Sbjct: 421 QSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLD 480

Query: 479 LIVIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFC 538
           L+VIGRD GKKDS M GL VL+ +E    Q D  ++V+  S+E+  +  R+ VKK +SFC
Sbjct: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSD-KQVVNLDSEEE--EEPRKAVKKFISFC 537

Query: 539 SIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRS 598
           +IANGISQEEFK+I+RKT G WK T +  PP  ILEFGSK+P EWI P +S+VLE+K+RS
Sbjct: 538 TIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEVKARS 596

Query: 599 LDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLG 658
           LDNTE++ +K+   CTL+GGYC+RIR DK WT+CYTL +L++ R  K  P  +   +Q  
Sbjct: 597 LDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERR-KKVPLSEDSNNQKP 655

Query: 659 LIRKKRKRVLISDSFHQN---RKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTI 715
           +  KK +R  I    +Q      +   S+IF GL+FYV+SDY+      RI++ +L   I
Sbjct: 656 MKSKKIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLI 715

Query: 716 VEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILI 775
             +GGKL +NVI      G +R+IS K T ECKALI+RGYDIL P W++DC+    L+ I
Sbjct: 716 SGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTI 775

Query: 776 EPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPM--GELEIDSEV 833
           EP +CF+VS+ M  +A  RVD  GDS++ +I+E                  G L++ S+V
Sbjct: 776 EPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDV 835

Query: 834 RRFPLFLFSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKD 893
              PLFLFS RI ++P      +  +++ K++L+GG++TD  + CNLII+P     LR  
Sbjct: 836 EDIPLFLFSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGR 895

Query: 894 CMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
            ++++   +      ++  P I  +V P W+D SI EN QVPEEDF  V
Sbjct: 896 IISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/945 (51%), Positives = 670/945 (70%), Gaps = 15/945 (1%)

Query: 7   SIPE---PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRK 63
           ++PE   P+NFAPSP FKWLCEELF K+ EV  N    T K  + +YYEII+NFV +WR 
Sbjct: 4   TVPEVEVPRNFAPSPQFKWLCEELFSKLEEVP-NQRHLTTKRITLRYYEIITNFVNLWRT 62

Query: 64  TVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGG 123
           TVG++IYPAL+LALPYRDRR+YN+KDY LI+ IC+YLKLPKNS TE+RL +WKQR  +  
Sbjct: 63  TVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSV 122

Query: 124 NLSSLLVEEIAKRRAEPSSKA-ITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVE 182
            LS   V E+ KR++EP  K+ IT+D +N  LD LS DR   GRG+K+L +S  F +C+E
Sbjct: 123 KLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIE 182

Query: 183 NMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLK 242
            MSF+EL+YFFDI+LK RVIG  EHKLLN WHPDA+DYLSV+SDLK V ++L++P +RL+
Sbjct: 183 KMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLR 242

Query: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302
            D+LSI +G+AFAP LAKK+++SY+KIC+ L +DF +EEKMDGERIQ+HYM+YG  IKF 
Sbjct: 243 HDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFL 302

Query: 303 SRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAK 362
           SRRG+DYTYLYG +LS+GTI+ +L+    VKECVLDGEMVT+D  + ++LPFG+VK +A 
Sbjct: 303 SRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAM 362

Query: 363 EALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSR 422
            AL+   I+  D+HPL MVFDL++LNG+SL   PL+QRK YL S+L P +  V+IV  +R
Sbjct: 363 NALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTR 422

Query: 423 CYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVI 482
           C     I+KSLE AIS+GSEG+VLK YNS Y + SRN++WIK+KPEYLE+FGEN+DLIVI
Sbjct: 423 CSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

Query: 483 GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQN--SRRRVKKILSFCSI 540
           GRDS KKDSF  GL VLDEEE K  +     +V+  S E   +N  + R +KK++SFC I
Sbjct: 483 GRDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMI 542

Query: 541 ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600
           ANGISQ E+KEI RKTRG WK+T EV PP  ++EFG+++P EWI+P  S+VLEIK+RSLD
Sbjct: 543 ANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLD 602

Query: 601 NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLI 660
           NTE++ +++   CTLYGGYC+RIR D +W   ++L +L   R +K  P    + + L   
Sbjct: 603 NTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSK 662

Query: 661 RKKRKRVLISDSFHQNRKQL-PISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHG 719
           ++++K++L   + + N + +   S IF GL FY+LSDY   +  +RI++ +L+K ++E+G
Sbjct: 663 KRRKKQLLTPLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENG 722

Query: 720 GKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNY 779
           GK+ +N++ KR S  ++R++  K T EC  LI RGYDIL P WV+DC+  K+++ IEP++
Sbjct: 723 GKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSH 782

Query: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPP--MGELEIDSEVRRFP 837
           CF+VS  + A+A +RVD  GDS+E+ +S +             P  +    +  +  + P
Sbjct: 783 CFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEKVP 842

Query: 838 LFLFSNRIAYVPRR---KISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDC 894
            FLF  R A+V      K S  + I  +KI+L+GGK+    S CN++I P  +  + ++ 
Sbjct: 843 YFLFWRRKAFVMEHNFDKSSIRETI--LKIQLYGGKVVKNISECNIVIFPKAEITVIRES 900

Query: 895 MNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDF 939
           M  +   + + +  S  +P + R+V+ EW+D SI +N QVPEED+
Sbjct: 901 MKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/959 (51%), Positives = 657/959 (68%), Gaps = 37/959 (3%)

Query: 11  PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSR----SFKYYEIISNFVEMWRKTVG 66
           P NFAPSP F+WLC+ELFVK+  +Q   T+   K      + +YYE+I +F+ +WRKTVG
Sbjct: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78

Query: 67  NNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLS 126
           N+IYPAL+L LPYRDRRIYN++DY LI+ ICSYLKLPKNS TE+RL  WKQR G+   LS
Sbjct: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138

Query: 127 SLLVEEIAKRRAEP---SSKAITIDNVNHYLDSLSGDRFASGR-GFKSLVKSKPFLHCVE 182
           S +V EI KR++EP   + + ITID +N  LDSLS +R + G  G++ L  S  F+ C+E
Sbjct: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198

Query: 183 NMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLK 242
           NM+FVEL++FFDI+LK+RVIGG EHK LN WHPDAQDYLSV+SDLK V +KL+DP V LK
Sbjct: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258

Query: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302
           +DDL+I VG  FAPQ AKK+++SYEKIC  L  DF +EEKMDGERIQ+HY +YG  + F 
Sbjct: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318

Query: 303 SRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAK 362
           SRRG DYTYLYG S+  GT+S++L   ++V+ CVLDGEMVTFD +R  +LPFGLVK SA+
Sbjct: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378

Query: 363 EALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSR 422
             ++   + N  + PL MVFDL+YLNG SL  +PL+QRK YL  I +P ++IVE++RS R
Sbjct: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438

Query: 423 CYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVI 482
           C    SIK +LE AIS+GSEGVVLK+YNS Y VASRN++WIKVKPEYLE+FGEN+DLIVI
Sbjct: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

Query: 483 GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQ---------EKHIQNSRRRVKK 533
           G+D GKKDS M GL V++E+E +  + D +EIV+  SQ         E +     + +K+
Sbjct: 499 GKDPGKKDSLMCGLAVVEEDEPEIDE-DGNEIVNLDSQDSIGEGEDKEGNEIEREKTIKR 557

Query: 534 ILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLE 593
            +SFCSIANGISQEEFK I R T+G WK++ E+ PP+ +LEFGS++PAEWIDP +SIV+E
Sbjct: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617

Query: 594 IKSRSLDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAE 653
           +K+RSL+N E   +K+ T  TLYGGYC++IR DK+W  CYTL++L   +  K   + +A 
Sbjct: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN 677

Query: 654 RSQLGLI--RKKRKRVLISDSFHQNRKQLPI----SNIFAGLLFYVLSDYVTEDTGIRIT 707
                 +   K+RK   I   F +  +Q P     S IF GL FYV+SD V + TG R++
Sbjct: 678 NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISD-VVDATGSRVS 736

Query: 708 RAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCI 767
           R EL   I+  GG +++NVI K H     R++  K T EC++LIDRGYDI+ P WVLDCI
Sbjct: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796

Query: 768 AYKRLILIEPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETXXX----XXXXXXXXXPP 823
               L+ +EP YCFNVS+++  +A++RVD  GDSFE  ISE                 PP
Sbjct: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPP 856

Query: 824 MGELEIDSEVRRFPLFLFSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIII 883
             + ++   V   PLFLF  R   + R K       ++++I+L+GGK T   + CNL++I
Sbjct: 857 SIQYDM---VDTVPLFLFYGRTILL-RIKDKALFTKLKVQIRLYGGKTTGDLASCNLVVI 912

Query: 884 PYTDPILRKDCMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
              +  + KD    V   + +    +D  P +  +V PEW+D SI+E CQVPEED PVV
Sbjct: 913 QQNEIAVAKD----VRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/951 (51%), Positives = 650/951 (68%), Gaps = 23/951 (2%)

Query: 11  PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIY 70
           P NFAPSPDF+WLC+ELFVK   V         K  + +YYE++SNFV++WRKTVGNN Y
Sbjct: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68

Query: 71  PALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLV 130
           P L+LALPYRDRR YNIKD  LI+ IC YL LPK S+TE++L +WKQR  +   LSS  V
Sbjct: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128

Query: 131 EEIAKRRAEPSS---KAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFV 187
            EI KR++ P     +AIT+D +N  LD L+  + + G+G ++L  S  F  C+ENMSF+
Sbjct: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFI 188

Query: 188 ELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLS 247
           ELKYFFDI+LK R+IGG EHKLLN WHPDA DY SV+SDL  VT KLY+P VRL+++DL+
Sbjct: 189 ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT 248

Query: 248 IKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGI 307
           +K+G AFAP LAK++N+SYEKI + L  DF +EEKMDGERIQ+HYM+YG  IKF SRRG 
Sbjct: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308

Query: 308 DYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSF 367
           DYTYLYG   S+GTI+ +L+  ++VKEC+LDGEMVT+D ++++ILPFGLVK SAK  LS 
Sbjct: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368

Query: 368 NSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVE 427
            SI+N  +HPL+M FDL+YLNGTSL  LPL+QRK YL+ IL+     V+IV  +RC  +E
Sbjct: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428

Query: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSG 487
           SI KSL  AIS+GSEG++LK  NS Y VASRN++WIK+KP+YL++FGEN+DLI+IGRD G
Sbjct: 429 SITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPG 488

Query: 488 KKDSFMLGL-LVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSR-RRVKKILSFCSIANGIS 545
           KKD+FM  L + +D+ + +  Q + +  +D  +++   +  +  R+ K +SFC+IANGIS
Sbjct: 489 KKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGIS 548

Query: 546 QEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETN 605
             EFKEID+KTRG W+R  +V PP+  L+FG+K P EWIDP ES+VLE+KSRSLDNTE+N
Sbjct: 549 NAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTESN 608

Query: 606 MQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTV---KSNPSYQAERSQLGLIRK 662
           ++KY    TL+GGYC+ +RYDK+WT CYT+++    R     K N       S  G  RK
Sbjct: 609 VKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKG--RK 666

Query: 663 KRKRVLISDSFHQNRKQLP---ISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHG 719
           KR    I       +K+ P    S+IF  L F VLSDY+   TG RI R  L + I+++G
Sbjct: 667 KRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYG 726

Query: 720 GKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNY 779
           GK+IYNV+ K    G +R+I      EC ALI RGYDIL P+WVLDCI   RL+ +E N+
Sbjct: 727 GKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLERNH 786

Query: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELE---IDSEVRRF 836
           CFNVS+++  ++  RVD   DSFEN+IS T             P G      +D E+R  
Sbjct: 787 CFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELRGL 846

Query: 837 PLFLFSNRIAYVPRRKISTEDDIIEMKI----KLFGGKITDQQSLCNLIIIPYTDPILRK 892
           P  LF +R  ++   K+S   D I  KI    KLFGG++T     CNLIIIP TD   + 
Sbjct: 847 PPLLFFDRSVFIAETKLS---DRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKI 903

Query: 893 DCMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVN 943
             + ++  K+   I+  ++  +I  +V+ EW+  SI EN QVPEE++ V++
Sbjct: 904 QVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS 954

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/945 (48%), Positives = 643/945 (68%), Gaps = 13/945 (1%)

Query: 6   DSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTG-KSRSFKYYEIISNFVEMWRKT 64
           + I EP NF+PSPDFKWLC+ELFVK+ ++Q       G K +  +YY+II+NF+++WR+T
Sbjct: 26  NDIEEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRT 85

Query: 65  VGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGN 124
           VGN+IYPAL+L +PYRDRR+YNIK+  LIR +C YLKLPKNS TE+RL  WK R  +   
Sbjct: 86  VGNDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVR 145

Query: 125 LSSLLVEEIAKRRAEPSSK-AITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVEN 183
           LS+  VEEI KR+ EP  K  ITID +N  LD+L  +R   G   + + +S+ F  C EN
Sbjct: 146 LSTFCVEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFEN 205

Query: 184 MSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKD 243
           M++VELKYFFDI+LK++++GG EHK LNCWHPDAQDYLSV+SDLK+V+SKL++P+ RLK 
Sbjct: 206 MTYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKY 265

Query: 244 DDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFS 303
           DDL+I +  AF P+ AK++  SY+ I R L +DF +EEKMDGERIQ+HYMNYG  +KF S
Sbjct: 266 DDLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLS 325

Query: 304 RRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKE 363
           RRG+DY+YLYG + ++G I ++L F   VKEC+LDGEMVT+D+ +  ILPFGLVK SA +
Sbjct: 326 RRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQ 385

Query: 364 ALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRC 423
           +LS + I    +HPLYM FDL+YLNG+SL+ LPLHQRK YL+ +L P  + VEI+ +  C
Sbjct: 386 SLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHC 445

Query: 424 YGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIG 483
                IK SLE AI LGSEG++LK ++S Y VA R+++WIK+KPEYLE+FGEN+DLIVIG
Sbjct: 446 NDSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIG 505

Query: 484 RDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANG 543
           RD GKKDS M GL++  + E ++     S   D  + E  ++  +R   KI+SFC+IANG
Sbjct: 506 RDPGKKDSLMCGLILTGDNEPEEITSLDSNPTD--TAESFLKPDKR---KIISFCNIANG 560

Query: 544 ISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTE 603
           ISQ+EF++IDR T GHW +  +  PP  + EFG+K P EWI P  S+VLEIK+RSL+  E
Sbjct: 561 ISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETNE 620

Query: 604 TNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSN-PSYQAERSQLGLIRK 662
           +   KY T  TL+GGYC++IRYDK+W  C+T N+  ESR +K+   +Y   ++ +G  ++
Sbjct: 621 SARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKKR 680

Query: 663 KRKRVLIS-DSFHQNRKQLPISN--IFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHG 719
            +KR+  S     +N K  P  +  IF GL FYV+SDY+ E  G R+++++L   ++EH 
Sbjct: 681 PKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEHN 740

Query: 720 GKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNY 779
           GKL++N I +   +  +R+IS K T E  +LI+RGYDI+HP W+LDCI+ ++L+ + P++
Sbjct: 741 GKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPSH 800

Query: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDSEVR--RFP 837
           CFNVS  +  V + RVD  GDS+E  ++E                 +  I       + P
Sbjct: 801 CFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITEGENHLKIP 860

Query: 838 LFLFSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNE 897
           + LF NR  ++P    ST    ++ K++L+GGK+ ++ S CN+I+   T    RK+ M +
Sbjct: 861 ILLFCNRRFFIPETLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTHTENRKEVMKK 920

Query: 898 VHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
           +   +      S  +P + R+V   W+D  I+E  QVPEED+P V
Sbjct: 921 IRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/957 (48%), Positives = 653/957 (68%), Gaps = 30/957 (3%)

Query: 10  EPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNI 69
           EP+NF+PSPDFKWLC ELFVK+ EV++   +   + ++ +Y  +I+NF+ +WR TVGN+I
Sbjct: 15  EPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHLWRVTVGNDI 74

Query: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129
           YPAL L LPYRDRR Y I+++ LIR +C YLKL KNS TEQRL+ WKQ+  +  NLSS  
Sbjct: 75  YPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSSFC 134

Query: 130 VEEIAKRRAEPSSK-AITIDNVNHYLDSLSGDRFAS----GRGFKSLVKSKPFLHCVENM 184
           ++EI KR +EP SK  ITID +N  LDSLS +R +S    G   K L + +   +C ENM
Sbjct: 135 IQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYCFENM 194

Query: 185 SFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDD 244
           SF+EL+YFFDI++K R+IGG EHK LN WHPDA DYLSV+S+L +VT KL++P  RL   
Sbjct: 195 SFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNSK 254

Query: 245 DLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSR 304
           DL+I +  AF PQLAKKVNLSYE + R +++ F +EEKMDGERIQ+HYM+YG  IK+FSR
Sbjct: 255 DLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSR 314

Query: 305 RGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEA 364
           RG DYTYLYG   S+ TIS++L+  + VKEC+LDGEMV++D  R  ILPFG+VK  A  +
Sbjct: 315 RGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANS 374

Query: 365 LSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCY 424
           L  + + N    PL++VFD+L+LNG+ LT LPL+QRK+YL++IL+P K+ +EI++ S  +
Sbjct: 375 LKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAH 434

Query: 425 GVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGR 484
             ESI+ +L+ AIS+GSEG+VLK Y+S Y+V  RNN+WIKVKPEYLE+FGENLDLIVIGR
Sbjct: 435 DSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGR 494

Query: 485 DSGKKDSFMLGLLVLD-EEEYKKHQGDSSEIVDHSSQEKHIQNS--------RRRVKKIL 535
           D GKKDS M G+ VL+ EE Y+K   +  E++  +S +   QN+         +R+ K +
Sbjct: 495 DPGKKDSLMCGVAVLENEESYEKILQE--EVITLTSDDDDSQNNIPEDKPIRTKRITKFI 552

Query: 536 SFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIK 595
           SFC IANGIS EEFKEIDRKT G WK+ S+ APP   LEFG+++P EWI+P +S+VLE+K
Sbjct: 553 SFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVK 612

Query: 596 SRSLDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLY-ESRTVKSNPSYQAER 654
           +RSL+N E    K+ T  TLYG YC+RIR DK++ DCYT +DL   +   +S+       
Sbjct: 613 ARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNH 672

Query: 655 SQLGLIRKKRKRV----LISDSFH-QNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRA 709
           S    I+KKR R     +++ +   Q+      S IF GL F+V+SDYV  ++  R+   
Sbjct: 673 SH---IKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRLRID 729

Query: 710 ELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAY 769
           EL   I  +GG+LI+N++ +  +   VR++SCK T EC  LI RGYDI+HP W+LDCIA 
Sbjct: 730 ELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDCIAN 789

Query: 770 KRLILIEPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPM--GEL 827
            +L+  EP++CFNVSQ +  ++++RVD LGDS++  I+E               +    L
Sbjct: 790 DKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQLYSNPL 849

Query: 828 EIDSEVRRFPLFLFSNRIAYVPRRKISTEDDIIE--MKIKLFGGKITDQQSLCNLIIIPY 885
           + D ++ + P+FLFSN+ AY P++  S E  + E  + IKL+GG   +  + CN+III  
Sbjct: 850 QFDQQIEKIPIFLFSNKKAYTPKQCFS-EKLLKETNLYIKLYGGTSVNNINDCNVIIIGD 908

Query: 886 TDPILRKDCMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
                  + ++ + +++     +S+ +  I R+V+ +W++ SI +  QV EEDFP++
Sbjct: 909 EHSKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDFPII 965

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/937 (47%), Positives = 636/937 (67%), Gaps = 27/937 (2%)

Query: 13  NFAPSPDFKWLCEELFVKIHEVQINGTAGT-GKSRSFKYYEIISNFVEMWRKTVGNNIYP 71
           NFAPSPDF WLCE+LF KI  VQ         K  + +YYE+ISNF  +WR TVGNNIYP
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83

Query: 72  ALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLVE 131
           AL L LPYRDRR++NIKDY LI+ IC++LKLPK+S+TE++L +WKQ  G+   LS   VE
Sbjct: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143

Query: 132 EIAKRRAEPS---SKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVE 188
           EI KRR+EP    ++ ITID++N YLD L+ +R   GR FK+L  S     C+ +M+F+E
Sbjct: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203

Query: 189 LKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSI 248
           ++YFFDI+LKNR +GG EHKLLNCWHPDAQDYLSV+SDL+ V  +L+DP  RL + DL I
Sbjct: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263

Query: 249 KVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGID 308
            +G AFAPQLA K+++SY+KI   L  DF +EEKMDGERIQ+HY N+G  IKF+SRR  D
Sbjct: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323

Query: 309 YTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFN 368
           YTYLYG +L +GT++  +    +VK+CVLD E+VTFD+  +++LPFG+VK SAK  LS +
Sbjct: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383

Query: 369 SINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVES 428
            I+   FHPL MVFD+LYLNG +L  LP ++R++YL  IL+P  + +EI++S R    + 
Sbjct: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443

Query: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGK 488
           IKKSLE A+S+GSEG++LK Y+S Y +ASR+++WIK+KPEYLE+FGEN+DL+++GRD  K
Sbjct: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503

Query: 489 KDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEE 548
           KDS MLGLL     +Y++   DS  +V+  S E++ Q    R +  +S C IANGIS EE
Sbjct: 504 KDSLMLGLL-----DYEEVIQDSPIMVNSQSSEENSQ----RFRGFVSLCIIANGISNEE 554

Query: 549 FKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQK 608
           +KEIDRKT+G W   SE  PP   ++FGSK+P +WIDP +S++LEIK+RSLDNT ++ +K
Sbjct: 555 YKEIDRKTKGLWN-DSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERK 613

Query: 609 YATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKKRKRVL 668
           +A  CTL+GGYC++IR DK W  CYTL +   +++  +     + + Q  + +K+R  ++
Sbjct: 614 FAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVISKKRRYNII 673

Query: 669 --ISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKLIYNV 726
             ++ +     +    S+IF G+ FYVLSDY       RI ++E++K IV +GG+L+ NV
Sbjct: 674 SSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNV 733

Query: 727 ILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCFNVSQK 786
           I + +++ D+R+IS + T EC +LI RGYDI+ P WV DC+   +++ +EP++CFN S++
Sbjct: 734 ITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSKQ 793

Query: 787 MRAVAEKRVDCLGDSFENDIS--ETXXXXXXXXXXXXPPMGELEIDSEVRRFPLFLFSNR 844
           +   A KR+D  GD +E DI+  E                 +++ D+ +   P FLF  R
Sbjct: 794 LMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHGR 853

Query: 845 IAYVPRRKISTEDDIIE--MKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHEKI 902
           I ++    +S  ++I +    +  +GGK+T++ S  NL+I+       R   +N++ ++I
Sbjct: 854 IVFL----LSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVGAVTQRR---INDIRKQI 906

Query: 903 KEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDF 939
             ++   D  P+I  +V+  W+   I +N QV E+++
Sbjct: 907 SSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/951 (46%), Positives = 640/951 (67%), Gaps = 20/951 (2%)

Query: 11  PQNFAPSPDFKWLCEELFVKIHEV--QI-NGTAGT--GKSRSFKYYEIISNFVEMWRKTV 65
           P+NFAPSPDFKWLC+ELFVKI ++  QI N TA T   K  S +Y++ I++F+++WR T+
Sbjct: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82

Query: 66  GNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNL 125
           G++I+PAL L LPYRDRR+YNIKD  LIR ICSYLKLPKNS  E+RL  WK +  +   L
Sbjct: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142

Query: 126 SSLLVEEIAKRRAEPSS---KAITIDNVNHYLDSLSGDRFA-SGRGFKSLVKSKPFLHCV 181
           ++  + EI+KR+ EP     + I+ID +N  LD L  +R   + +   +L++ + F  C+
Sbjct: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202

Query: 182 ENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRL 241
           ENM+F+ELKYFFDI++KN+++G  E+  L  WHPD+++YLSV+SDL+ +++KL++P +++
Sbjct: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262

Query: 242 KDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKF 301
            + DLSIKVG+ FAPQLAK++ LSY+ I   L++DF +EEKMDGERIQ+HYMNYGE++KF
Sbjct: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322

Query: 302 FSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSA 361
           FSR G DYTYLYG   S+GTI++ LR   +VKECVLDGEMVTFD+  + +LPFGLVK SA
Sbjct: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382

Query: 362 KEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSS 421
              L+   I+N  FHPL+MVFD+LYLNG+SL  LPL +RK++LN++L+P K+ VEI+ S 
Sbjct: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442

Query: 422 RCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIV 481
           RC     IKK L+ AIS+GSEG+VLK Y S Y   +R+NNWIKVKPEYLEEFGEN+DLIV
Sbjct: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502

Query: 482 IGRDSGKKDSFMLGLLVLDE-EEYKKHQGDSS--EIVDHSSQEKHIQNSRRRVKKILSFC 538
           IGRDSGKKD  + G+LV +E +E  ++    S  EI+  S  +       + +KK++SFC
Sbjct: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKVISFC 562

Query: 539 SIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRS 598
           +IANG+SQ E KEI+R TRG WK  +   PP  +LEFG+K P EWI P +S+VLEIK+RS
Sbjct: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622

Query: 599 LDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLG 658
           LD T+    KYAT CTLYGGYC++IR DK+WT CYTL+DL  +   +     + +++ + 
Sbjct: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQTLIR 682

Query: 659 LIRKKRKRVLISDSFHQNRKQLP-ISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVE 717
              +K+ +++       N   L  IS++F GL FY++SDY+ +    RI R ++   I++
Sbjct: 683 SYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLIIK 742

Query: 718 HGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEP 777
           +GG++IYNVI K ++I  +R++S K+T EC  L+ RGYD+++ +W+ DC+    ++ +EP
Sbjct: 743 NGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPLEP 802

Query: 778 NYCFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEI-----DSE 832
            +C  VS ++ A+A  R+D  GDS+E  + ++                   +     D  
Sbjct: 803 AHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNSNLLLINKDEG 862

Query: 833 VRRFPLFLFSNRIAYVPRRKISTED-DIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILR 891
           V   P+FLF+NR  ++ +  I   D D +  +IKL+GG +  +   CN+I+      ++ 
Sbjct: 863 VDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGSQLVN 922

Query: 892 KDCMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
           K   +   + +K+ + A+   P I R V   W+  SI    Q+  ED+P++
Sbjct: 923 KKLGDLRCKLVKQYVDANFPQP-IPRAVNVSWITESIKAGYQLSPEDYPIL 972

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/942 (47%), Positives = 621/942 (65%), Gaps = 26/942 (2%)

Query: 10  EPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNI 69
           +PQNFAPSPDF+WLC+ELF K+ E+        GK+ + K  E+I  F+++WR TVG+NI
Sbjct: 35  KPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNI 93

Query: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129
           YP L L LPYRD R YNIKDY L++ +C  L LPK+S TE+RL +WKQ   +G +LS   
Sbjct: 94  YPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFC 153

Query: 130 VEEIAKRRAEP-SSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVE 188
           VEEI KRR EP  S+ +TID +N  LD LS +  A   GF  L KS  F +C++NMSF E
Sbjct: 154 VEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSE 213

Query: 189 LKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSI 248
            +YFFDI+LK RVIGG EHK LNCWHPDAQDYL V+SDLKV++  L++P +RL  ++LSI
Sbjct: 214 QRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSI 273

Query: 249 KVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGID 308
            +G AFAP LAK+++LSYE++C  L  DF++EEKMDGERIQ+HY+  G  I+F SRRG D
Sbjct: 274 NIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTD 333

Query: 309 YTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFN 368
           +T+LYG SL  G ISQHL+F + V++CVLDGEMV+FD ++ V+LPFG+VK +A E L  N
Sbjct: 334 FTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEEL-MN 392

Query: 369 SINNVD---FHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYG 425
           S   VD   + PLYM+FDL+YLNG SLT LPLH RK YL SILSP+ NIVEI+   R   
Sbjct: 393 SDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASE 452

Query: 426 VESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRD 485
             +IK SLE AI +GSEG++LK ++S Y + +RN++WIK+KPEY EE GE +DL+VIGRD
Sbjct: 453 PNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRD 512

Query: 486 SGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGIS 545
            GKKDS M GL++ DE +     G S   V+ +SQ+  ++  ++R  K++SFC+IANG+S
Sbjct: 513 PGKKDSLMCGLILADETD-----GSS---VNLASQDDPLR-PKQRNPKVISFCNIANGVS 563

Query: 546 QEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETN 605
             EFKEI+RKTRG W  T+   PP+ +LEFG+K+P EWIDP  S+VLE+K+RS+D  E +
Sbjct: 564 DAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELS 623

Query: 606 MQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKKRK 665
            +KY T  TL G YC+ +R++K+W+ C T+   YE      N      +S     RK+RK
Sbjct: 624 SKKYKTGSTLRGAYCRALRFNKDWSTCATVQQ-YEQAKRAHNYHKGKRKSHQISPRKQRK 682

Query: 666 RVLISDSF----HQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGK 721
              +S+ +      +R+ +  SNIF GL FY+LSDY+ +    R  + ++   + ++ G 
Sbjct: 683 LANVSELYPLLADDSRESIFESNIFQGLQFYILSDYI-DSQKKRYEKDQIGTLVRKNSGH 741

Query: 722 LIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCF 781
           +++N  ++R     +R+IS K T EC++L ++GYDI+HP+W+ DC+ Y  L+ +EP +CF
Sbjct: 742 VLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCF 801

Query: 782 NVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDSEVRRFPLFLF 841
             S+K+   + +RVD  GDSF   +S T             P   L    E+   PLFLF
Sbjct: 802 RTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSP--HLSAPEELDGIPLFLF 859

Query: 842 SNRIAYVPR-RKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRK--DCMNEV 898
            N   Y  R      +++ +E  ++LFGG+ +     CNL+++  +    +K    +  +
Sbjct: 860 QNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEGL 919

Query: 899 HEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFP 940
            ++I     +S+   +I  +V+  W++  INE C VPEEDFP
Sbjct: 920 RKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/947 (44%), Positives = 612/947 (64%), Gaps = 29/947 (3%)

Query: 10  EPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNI 69
           EP NFAPSPDF+WLCEELF ++  +        GK+ + K  EII+ F+++WR TVG++ 
Sbjct: 20  EPHNFAPSPDFRWLCEELFHRLDAIN-EHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78

Query: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129
           +PAL L  PYRD R Y+IKD+ LI+ +C  L L ++S TE+RL +WKQ  G+G +LS   
Sbjct: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138

Query: 130 VEEIAKRRAEP-SSKAITIDNVNHYLDSLSGDRFASGR---GFKSLVKSKPFLHCVENMS 185
           V+EI+KRR EP   + +TID +N  LD L+ +  ASG+   G   L +S  F  C++N+S
Sbjct: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKE--ASGKKAWGTTGLSESHSFQFCLKNLS 196

Query: 186 FVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDD 245
           F+EL+YFFDIVLKNRVIGG EHK L CWHPDAQ YL V++DLK+++ KL++P VRL   D
Sbjct: 197 FLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRD 256

Query: 246 LSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRR 305
           LSI +G AFAP LAK++++SYE+IC  L  DF++EEKMDGERIQ+HY+N G  +KF SRR
Sbjct: 257 LSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRR 316

Query: 306 GIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEAL 365
           GID+++LYG  ++ G ISQ+L+    V++CVLDGEMV++D KR++ILPFG+VK +A + L
Sbjct: 317 GIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDEL 376

Query: 366 SFNSINNVD--FHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRC 423
             + + N +  + PLYMVFDL+YLNG SLT +PLH RK+YL  ILSP+ ++VEI++  R 
Sbjct: 377 INSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRA 436

Query: 424 YGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIG 483
              ++IK  ++ AI +GSEGV++K  +S+Y V +RN++W+K+KPEY E+ GE +DL+VIG
Sbjct: 437 CDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIG 496

Query: 484 RDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANG 543
           RD GKKDS M GLLV D E   ++ G     ++H  +   I        K +SFC++ANG
Sbjct: 497 RDPGKKDSLMCGLLVSDSEHILENFGP----IEHGKEGDPII-------KCVSFCNVANG 545

Query: 544 ISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTE 603
           +S EEFKEI+RKTRG W    E  PP S+LEFGSKIP EWIDP  S+V+E+K+RS++N+E
Sbjct: 546 VSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSE 605

Query: 604 TNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKK 663
            + ++Y    TL+  YC+RIR DK+WT C ++    +++   +   Y+ +  Q+   RK+
Sbjct: 606 YSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKR 665

Query: 664 RKRVLISDSFHQNRKQLPI--SNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGK 721
               +      + + +L    S+IF GL FY+LSDYVT     R  R  +   +V+HGG 
Sbjct: 666 NVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRR-RYERGMVAAKVVKHGGL 724

Query: 722 LIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCF 781
           ++ N+ ++   +  +R++S KTT EC+ L++RGYDI+ P W+ DCI+    + IEP +CF
Sbjct: 725 IVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCF 784

Query: 782 NVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDS----EVRRFP 837
             S+++   + +RVD  GDSF   +  T            P      I S    ++   P
Sbjct: 785 QTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDLDEAP 844

Query: 838 LFLFSN-RIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKD-CM 895
           LFL    +I  +    I  +  I+  KI+L+GG +++     NL+++P      R    +
Sbjct: 845 LFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAYYV 904

Query: 896 NEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
            E+ +KI     A +T  +I  +V  EW+D    E C VPEEDF  +
Sbjct: 905 QELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/948 (43%), Positives = 584/948 (61%), Gaps = 33/948 (3%)

Query: 11  PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIY 70
           P NF+PSPDF WLC+ELF+K+ EV +      GK R  +  EI SNFV +WRKTVGN+IY
Sbjct: 51  PINFSPSPDFCWLCDELFIKLEEVALK-KKDLGKPRKVRNLEITSNFVSLWRKTVGNDIY 109

Query: 71  PALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLV 130
           PALVL+LPY DRR Y +KD  L++ +C ++KLP+NS TE+RL  WKQ   +G  LS+  V
Sbjct: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169

Query: 131 EEIAKRRAEPS-SKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVEL 189
           EE+ KRR EP   K ++ID VN  LD L  +       + SL +S  F +C+E+MS+VEL
Sbjct: 170 EELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVEL 229

Query: 190 KYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIK 249
           ++FFDIVLK  ++ G E  LL+CWHPDA+ Y  V+SDL++V   LYDP  RL+ +DLS++
Sbjct: 230 RFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVR 289

Query: 250 VGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDY 309
           +G+AFAP +A++V + YEK+   L +DF VEEKMDG+RIQVHYM+YG SI +FSR GI+Y
Sbjct: 290 IGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINY 349

Query: 310 TYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNS 369
           TYLYG + S G+IS HL+F + VKEC+LDGEMV++D + + ILPFGL K  A   ++F +
Sbjct: 350 TYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFET 409

Query: 370 INNVD--FHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVE 427
             + +  + PLY VFDLLYLNG  LT   + +RK+YL  IL P KN+V ++   RC   E
Sbjct: 410 TGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAE 469

Query: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSG 487
           +I  +L  A++ GSEG+VLK   S Y+V  R+++WIK+KPEYLE FGEN+DL+VIGRD G
Sbjct: 470 AITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKG 529

Query: 488 KKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQE 547
           +KDSF+  L V D+ E        S     S  E  I   + +++K +SFCSIANGIS E
Sbjct: 530 RKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPII--VQPKIEKFISFCSIANGISNE 587

Query: 548 EFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQ 607
           EFKEIDR TRG+W    E  PP   +EFG+K P EWIDP  S+VLE+K+RS+DN E+   
Sbjct: 588 EFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSD 647

Query: 608 KYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKS------NPSYQAERSQLGLIR 661
            Y T  TLY  YCKRIR+DK W+   T+ +   +R  +S      N  +  +RS     R
Sbjct: 648 LYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSS---PR 704

Query: 662 KKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGK 721
           K+R   L+ D    +  +   ++   G  FYV S Y    +   I  +E+ + +V  GG 
Sbjct: 705 KRRTFHLVGDI---DVTKPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGT 761

Query: 722 LIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCF 781
            I+N+ + R S+  + ++ CK T E K LI+RGYDI+HP W++DC+ Y  ++ IEP Y +
Sbjct: 762 YIHNLRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVY 820

Query: 782 NVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDSEVRRFPLFLF 841
           + S+++   A  + D  G+S++  ++E                 E+  D+      L +F
Sbjct: 821 SASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIF 880

Query: 842 SNRIAYVPRRKI--STEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNE-- 897
              + Y+       S+  DI++  I+  GG++T+   L  +++         KDC ++  
Sbjct: 881 KGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVA-------VKDCFSQLS 933

Query: 898 ---VHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942
              V   I  +I  S+ +  I ++V  EWV+  +     V E+++  +
Sbjct: 934 LQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/941 (41%), Positives = 568/941 (60%), Gaps = 70/941 (7%)

Query: 12  QNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIYP 71
           +NF+PSP+FKWLC+EL  KI+E   +     GK  + +Y EII+NF+++WR TVGN IYP
Sbjct: 5   ENFSPSPEFKWLCDELLGKIYETS-SKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63

Query: 72  ALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLVE 131
           AL L +P+RDRRIYN+K+  LI+ +C YL+LPK+S TE RL  WKQR  +G  LS   VE
Sbjct: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123

Query: 132 EIAKRRAE-PSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVELK 190
           EI KR+ +   +  ITID +N YLD +S +      G+ +L  S+ F +C+ +M+F+E+K
Sbjct: 124 EIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMK 183

Query: 191 YFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKV 250
           +FFDI+LK RV+ G E+  L  WHPDA DYLSV+SDL V++ +LY+P  RL+  DLSI +
Sbjct: 184 FFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITI 243

Query: 251 GFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYT 310
             AF PQLAK+ +LSYE++   L  DF++EEKMDGER+Q+HY+NYGE IK+ SRRG+D++
Sbjct: 244 SHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFS 303

Query: 311 YLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALS--FN 368
           YLYG + SSG IS  L+   +VK+C+LDGEM+T+D ++ ++LPFGLVK SA   +     
Sbjct: 304 YLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELA 363

Query: 369 SINNVD-FHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVE 427
            I   + + PL++ FDL+YLNG SLT L L +RK YL  IL+P++  VEI++  +    E
Sbjct: 364 GIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAE 423

Query: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSG 487
           +IK SLE AIS+GSEG+VLK+ +S Y V SRN +WIK+KPEYLE+FGEN+DL++IGR+ G
Sbjct: 424 AIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQG 483

Query: 488 KKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQE 547
           KKDSF  GL + D  E  +                          + +SFC+IANG+S E
Sbjct: 484 KKDSFFCGLSISDPNEVAEK------------------------PRFISFCTIANGLSNE 519

Query: 548 EFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQ 607
           EFK+I+RKT G W   SE  P  ++L FG+K+P EWI P +S+VLE+K+R++D  E+  +
Sbjct: 520 EFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKR 579

Query: 608 KYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYE------------SRTVKSNPSYQAERS 655
           KY + CTL+ GYCK+IRYDK+W    + ++  +            S  V       ++R+
Sbjct: 580 KYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRA 639

Query: 656 QLGLIRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTI 715
           ++G++       L++          P+SN F+   F V+SDY       RI++ +L   I
Sbjct: 640 KIGIVNSSEPTALVA----------PVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVI 689

Query: 716 VEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCI--AYKRLI 773
           +EHGG+++Y          ++ +I  K T ECK L++    I+ P+W+  CI   YK   
Sbjct: 690 LEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKT-- 747

Query: 774 LIEPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETXXXXXXXXXXXXPPMGELEIDSEV 833
                  F  S   R   E  +DC    F  D +                +   + D  +
Sbjct: 748 ------PFTESDIFRGELESSMDC--SQFYTDFNTASLNHLLETANRG--IKNPDSDLLL 797

Query: 834 RRFPLFLFSNRIAYVPRRKISTEDDIIEMK--IKLFGGKITDQQSLCNLIIIPYTDPILR 891
              PLFLFSN    V   +   +  I+E++  IK  GG++   ++    III + D I R
Sbjct: 798 PEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENAS--IIIVFNDFISR 855

Query: 892 KDCMNEVHEKIKEQIKAS-DTIPKIARVVAPEWVDHSINEN 931
           +D  +   +   + +K S ++ P+I R+V   W   SI +N
Sbjct: 856 EDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN 896

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  120 bits (300), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 106/411 (25%), Positives = 174/411 (42%), Gaps = 56/411 (13%)

Query: 251 GFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYT 310
           G    P LAK      E + R     F  E K DGER QVH M  G +I+ +SR   + T
Sbjct: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388

Query: 311 YLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNSI 370
             Y          Q L    + +  ++D E V +D +++ ILPF ++    ++ +    +
Sbjct: 389 ERY----PEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVE---L 441

Query: 371 NNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIK 430
            +V        FDLLYLNG SL    L  R+++L S+L  +   ++         +  ++
Sbjct: 442 KDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501

Query: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI----- 482
             LE ++S   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL V+     
Sbjct: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYG 561

Query: 483 -GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIA 541
            G+ +G    F+LG    D EE++                              + C I 
Sbjct: 562 RGKRTGTYGGFLLGCYNPDLEEFE------------------------------TCCKIG 591

Query: 542 NGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDN 601
            G S+E  + +        K T   AP   +    S  P  W +P  +++ E+ +  L  
Sbjct: 592 TGFSEEVLQSL----HAQLKDTVIAAPRGDVSYDDSSPPDVWFEP--AMLFEVLTADLSL 645

Query: 602 T---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPS 649
           +   +     Y    +L      RIR DK  TD  + + + E    ++N S
Sbjct: 646 SPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 102/414 (24%), Positives = 179/414 (43%), Gaps = 61/414 (14%)

Query: 246 LSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRR 305
           + ++ G    P LAK      E + R     F  E K DGER QVH    G S+K +SR 
Sbjct: 329 IKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIYSRN 387

Query: 306 GIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEAL 365
           G D T  Y        +  +++   + K  ++D E V +D ++  ILPF ++    ++ +
Sbjct: 388 GEDMTERY----PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGV 443

Query: 366 SFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYG 425
               + +V        FD+L LN   L     H+R+Q L    +  +   +         
Sbjct: 444 E---LKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTN 500

Query: 426 VESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI 482
            + ++K L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL+V+
Sbjct: 501 FDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVL 560

Query: 483 ------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILS 536
                 G+ +G    F+LG   LD EE++                              +
Sbjct: 561 GAYYGRGKRTGTYGGFLLGCYNLDSEEFE------------------------------T 590

Query: 537 FCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAE-WIDPSESIVLEIK 595
            C I  G S E  +++  K      + + V  P++ + + S  PA+ W +P  S++ E+ 
Sbjct: 591 CCKIGTGFSDEMLQDLYTKL-----KDTTVEHPSTNVIYDSSAPADVWFEP--SMLFEVL 643

Query: 596 SRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLN---DLYESRT 643
           +  L  +   +   + +    +L      RIR DK  TD  + +   + YES+ 
Sbjct: 644 TADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQA 697

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 173/410 (42%), Gaps = 59/410 (14%)

Query: 248 IKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGI 307
           +K G    P LAK      E + R   + F  E K DGER QVH +  G S+  +SR G 
Sbjct: 323 LKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDG-SMNIYSRNGE 381

Query: 308 DYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSF 367
           + T  Y        I  +L   ++    +LD E V +D ++  ILPF ++    ++ +  
Sbjct: 382 NMTERY----PELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVE- 436

Query: 368 NSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVE 427
               +V        FD+L  NG SL    L +R++YL  +L P+    +         +E
Sbjct: 437 --AKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLE 494

Query: 428 SIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI-- 482
            ++K LE ++    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL V+  
Sbjct: 495 DVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGA 554

Query: 483 ----GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFC 538
               G+ +G    F+LG    D  E++                              + C
Sbjct: 555 YYGRGKRTGTYGGFLLGCYNQDTGEFE------------------------------TCC 584

Query: 539 SIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRS 598
            I  G S E    +  K     K +S   P A  +   S  P  W +P  +++ E+ +  
Sbjct: 585 KIGTGFSDEMLVSLYEK----LKPSSLEQPKAFYVYDSSAEPDVWFEP--TMLFEVLTAD 638

Query: 599 LDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYT---LNDLYESR 642
           L  +   +     Y    +L      RIR DK+  D  +   + +LYES+
Sbjct: 639 LSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQ 688

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 141/297 (47%), Gaps = 17/297 (5%)

Query: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277
           +D    + + ++V +   D  +   D+  +I+ G    P LAK      E + R     F
Sbjct: 324 RDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTF 383

Query: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337
             E K DGER QVH +  G +++ +SR G + T  Y        I   L    S    +L
Sbjct: 384 TSEYKYDGERAQVHLLKDG-TMRIYSRNGENMTERY----PEIQIKDFLADPASTTSLIL 438

Query: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397
           D E V +D ++  ILPF ++    ++ ++   IN V        FD+L  N   L   PL
Sbjct: 439 DCEAVAWDKEQNKILPFQVLTTRKRKDVN---INEVKVRVCLFAFDILLHNDMRLINEPL 495

Query: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454
            +R++ L+ +  P++   +         ++ ++K L+ ++    EG+++K  +   S Y 
Sbjct: 496 SKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYE 555

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYK 505
            + R+ NW+K+K +YLE  G++LDL V+      G+ +G    F+LG    D E+++
Sbjct: 556 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFE 612

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 106/425 (24%), Positives = 179/425 (42%), Gaps = 55/425 (12%)

Query: 229 VVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERI 288
           ++ S L D  + L D++  ++ G    P LAK      E +     ++F  E K DGER 
Sbjct: 334 IIQSCLNDGIMEL-DNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERG 392

Query: 289 QVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKR 348
           QVH ++ GE ++ +SR G + T  Y        + +    TD     +LD E+V +D ++
Sbjct: 393 QVHLLSNGE-MRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQ 451

Query: 349 RVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSIL 408
             ILPF ++    ++ +    + +V        FD+LY NG  L    L +R++ L+ + 
Sbjct: 452 NKILPFQVLSTRKRKGVE---LKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVT 508

Query: 409 SPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKV 465
             +    +   S     ++ I+K L+ AI    EG+++K  +   S Y  + R+ NW+K+
Sbjct: 509 KCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKL 568

Query: 466 KPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSS 519
           K +YL   G++LDL V+      G+ +G    F+LG    D  EY+              
Sbjct: 569 KKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEYE-------------- 614

Query: 520 QEKHIQNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKI 579
                           + C I  G S E   ++         R  E+  P S   F S  
Sbjct: 615 ----------------TCCKIGTGFSDEMLTKL-----YELFREEEIEVPKSFYNFDSSA 653

Query: 580 -PAEWIDPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTL 635
            P  W +P   ++ E+ +  L  +   +     Y    +L      RIR DK   D  + 
Sbjct: 654 EPDIWFEP--KVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSS 711

Query: 636 NDLYE 640
           + + E
Sbjct: 712 DQIIE 716

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 175/413 (42%), Gaps = 69/413 (16%)

Query: 251 GFAFAPQLAKKVNLSYEKICRTLHD-DFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDY 309
           G    P LAK    S  ++  T  +  F  E K DGER QVH +  G S++ +SR G D 
Sbjct: 353 GIPLKPMLAKPTK-SISEVLDTFQNIQFTSEYKYDGERAQVHLLPDG-SMRIYSRNGEDM 410

Query: 310 TYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNS 369
           T  Y        I  +L  + +  + +LD E V +D + + ILPF ++    ++++    
Sbjct: 411 TQRY----PELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVD--- 463

Query: 370 INNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESI 429
           + ++        FD+L  N  SL    L +R+  L+SI  P     +         ++ +
Sbjct: 464 LKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDEL 523

Query: 430 KKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI---- 482
           +  L+ AI    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL V+    
Sbjct: 524 QTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYY 583

Query: 483 --GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSI 540
             G+ +G    F+L     D EE++                              + C I
Sbjct: 584 GRGKRTGTYGGFLLACYNQDTEEFE------------------------------TCCKI 613

Query: 541 ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600
             G S E  + +        K T+  +P A+ +   S  P  W +P  ++V E+ +  L 
Sbjct: 614 GTGFSDEMLQTL----YNGLKETAIESPRANFVFDSSAEPDVWFNP--TMVFEVLTADLS 667

Query: 601 NTETNMQKYATNCTLYGGYCK-------RIRYDKEWTDCYT---LNDLYESRT 643
            +      Y    T+YG           RIR DK   D  +   + D YE+++
Sbjct: 668 LSPI----YKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQS 716

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 141/297 (47%), Gaps = 17/297 (5%)

Query: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277
           +D    + + ++V +   +  +   D   +++ G    P LAK      E + R   + F
Sbjct: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414

Query: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337
             E K DGER QVH +N G +++ +SR G + T  Y        I+  ++  D+ K  +L
Sbjct: 415 TSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY----PEINITDFIQDLDTTKNLIL 469

Query: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397
           D E V +D  +  ILPF ++    ++ +    +N+V        FD+L  N   L    L
Sbjct: 470 DCEAVAWDKDQGKILPFQVLSTRKRKDVE---LNDVKVKVCLFAFDILCYNDERLINKSL 526

Query: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454
            +R++YL  +   +    +         ++ ++K L+ +++   EG+++K      S Y 
Sbjct: 527 KERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYE 586

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYK 505
            + R+ NW+K+K +YLE  G++LDL V+      G+ +G    F+LG    D  E++
Sbjct: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFE 643

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 102/443 (23%), Positives = 191/443 (43%), Gaps = 63/443 (14%)

Query: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277
           +D    + + ++V +   +  +   D   ++K G    P LAK      E + R   + F
Sbjct: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETF 414

Query: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337
             E K DGER QVH ++ G +++ +SR G + T  Y        I+  ++  D+ K  +L
Sbjct: 415 TSEYKYDGERAQVHLLDDG-TMRIYSRNGENMTERY----PEIKITDFIQDLDATKNLIL 469

Query: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397
           D E V +D ++  ILPF ++    ++ +    +++V        FD+L  NG  L    L
Sbjct: 470 DCEAVAWDKEQGKILPFQVLSTRKRKDVE---LSDVKVRVCLFAFDVLCHNGERLINKSL 526

Query: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454
            +R++ L  +   +    +         ++ ++K L+ +++   EG+++K      S Y 
Sbjct: 527 RERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYE 586

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQ 508
            + R+ NW+K+K +YLE  G++LDL V+      G+ +G    F+LG    D  E++   
Sbjct: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFE--- 643

Query: 509 GDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTSEV-- 566
                                      + C I  G S E  +++      H + T  +  
Sbjct: 644 ---------------------------TCCKIGTGFSDESLQQL------HERLTPTIID 670

Query: 567 APPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCKRI 623
            P A+ +   S  P  W +P  + + E+ +  L  +   +     +A   +L      RI
Sbjct: 671 GPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRI 728

Query: 624 RYDKEWTDCYT---LNDLYESRT 643
           R DK   D  +   + +LYE+++
Sbjct: 729 REDKGVEDATSSEQIVELYENQS 751

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 90/381 (23%), Positives = 164/381 (43%), Gaps = 55/381 (14%)

Query: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277
           +D    + + ++V +   +  +   D   +++ G    P LAK      E + R   + F
Sbjct: 445 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 504

Query: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337
             E K DGER QVH +N G +++ +SR G + T  Y        I+  ++  D  K  +L
Sbjct: 505 TSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY----PEIKITDFIQDLDITKNLIL 559

Query: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397
           D E V +D  +  ILPF ++    ++ +    +N+V        FD+L  N   L  + L
Sbjct: 560 DCEAVAWDKDQAKILPFQVLSTRKRKDVE---LNDVKVRVCLFAFDILCHNDERLINMSL 616

Query: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYNSS---YN 454
            +R++YL  +   +    +         ++ ++K L+ +++   EG+++K  + S   Y 
Sbjct: 617 RERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYE 676

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQ 508
            + R+ NW+K+K +YLE  G++LDL V+      G+ +G    F+LG    D  E++   
Sbjct: 677 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFE--- 733

Query: 509 GDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTSEV-- 566
                                      + C I  G S E  + +      H + T  +  
Sbjct: 734 ---------------------------TCCKIGTGFSDEMLQLL------HARLTPTIID 760

Query: 567 APPASILEFGSKIPAEWIDPS 587
            P A+ +   S  P  W +P+
Sbjct: 761 GPKATYVFDSSAEPDVWFEPT 781

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 106/452 (23%), Positives = 185/452 (40%), Gaps = 61/452 (13%)

Query: 208 KLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYE 267
           +L++      +D    + + ++V     +  +   D    +  G    P LAK      E
Sbjct: 314 ELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISE 373

Query: 268 KICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLR 327
            + R     F  E K DGER QVH +  G S++ +SR G + T  Y     S  I+   R
Sbjct: 374 VLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERYPEIRISDFIADPAR 432

Query: 328 FTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYL 387
                   +LD E V +D ++  ILPF ++    ++ ++   + +V        FD+L  
Sbjct: 433 ----THTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVA---VEDVKVRVCLFAFDILCY 485

Query: 388 NGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLK 447
           N   L   PL +R+  L   L P+   +++        ++ ++  L+ A+    EG+++K
Sbjct: 486 NDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVK 545

Query: 448 YYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLV 498
                 S Y  + R+ NW+K+K +YL+  G++LDL V+      G+ +G    F+LG   
Sbjct: 546 ILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYN 605

Query: 499 LDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKEI-DRKTR 557
            D  EY+                              + C I  G S+E  + + DR   
Sbjct: 606 QDSGEYE------------------------------TCCKIGTGFSEEMLQTLFDR--- 632

Query: 558 GHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNT---ETNMQKYATNCT 614
                T+   P A  +   S  P  W +P  +++ E+ +  L  +   +     Y    +
Sbjct: 633 --LSPTAIPTPKAFYVHSESAPPDVWFEP--TLLFEVLTADLSLSPVYKAGTSSYGKGIS 688

Query: 615 LYGGYCKRIRYDK---EWTDCYTLNDLYESRT 643
           L      R+R DK   E T    + + YES++
Sbjct: 689 LRFPRFIRLRDDKTPEEATSSEQVVEFYESQS 720

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 107/458 (23%), Positives = 195/458 (42%), Gaps = 61/458 (13%)

Query: 206 EHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLS 265
           + +LL       +D    + + ++V +      +   ++  S++ G    P LAK     
Sbjct: 353 DMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAI 412

Query: 266 YEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQH 325
            E + R   + F  E K DGER QVH +  G +++ +SR G + T  Y        I   
Sbjct: 413 NEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY----PEIHIGDF 467

Query: 326 LRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSA-KEALSFNSINNVDFHPLYMVFDL 384
           ++  +  K  +LD E V +D +++ ILPF ++     K+ L+     +V        FD+
Sbjct: 468 VKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLA----KDVKVRVCLFAFDI 523

Query: 385 LYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGV 444
           L  N   L    L +R++ L+ + +P     +         ++ ++K L+ +++   EG+
Sbjct: 524 LCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGL 583

Query: 445 VLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLG 495
           ++K      S Y  + R+ NW+K+K +YLE  G++LDL V+      G+ +G    F+LG
Sbjct: 584 MVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLLG 643

Query: 496 LLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKEIDRK 555
                   Y  + G+                         + C I  G S E  +++  K
Sbjct: 644 C-------YNDNTGE-----------------------FETCCKIGTGFSDEMLQQLHEK 673

Query: 556 TRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNT---ETNMQKYATN 612
                K T    P A+ +   S  P  W +P  S++ E+ +  L  +   +     Y   
Sbjct: 674 ----LKATVIDGPKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLSPIYKAGSSAYDKG 727

Query: 613 CTLYGGYCKRIRYDKEWTDCYT---LNDLYESRTVKSN 647
            +L      RIR DK   D  +   + +LYE+++ +S+
Sbjct: 728 VSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS 765

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 107/459 (23%), Positives = 189/459 (41%), Gaps = 63/459 (13%)

Query: 203 GGQE--HKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAK 260
           GG+E    L++      +D    + + ++V +   +  +   +    +  G    P LAK
Sbjct: 299 GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAK 358

Query: 261 KVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSG 320
                 E + R     F  E K DGER QVH +  G S++ +SR G + T  Y       
Sbjct: 359 PSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERY----PEI 413

Query: 321 TISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYM 380
            IS  +   D     +LD E V +D  + VILPF ++    ++ +      +V       
Sbjct: 414 NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVV---AEDVKVRVCLF 470

Query: 381 VFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLG 440
            FD+L  N   L    L +R+ YL  IL P+   +++        ++ ++  L+ ++   
Sbjct: 471 AFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDC 530

Query: 441 SEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDS 491
            EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL V+      G+ +G    
Sbjct: 531 CEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGG 590

Query: 492 FMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKE 551
           F+LG    D  E++                              + C I  G S E  + 
Sbjct: 591 FLLGCYNQDTGEFE------------------------------TCCKIGTGFSDEMLQN 620

Query: 552 IDRKTRGHWKRTSEVAPPASILEFG-SKIPAEWIDPSESIVLEIKSRSLDNT---ETNMQ 607
           +  K        +E+  P +   +  S  P  W++P  S++ E+ +  L  +   +    
Sbjct: 621 LYEKL-----SPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYKAGGS 673

Query: 608 KYATNCTLYGGYCKRIRYDKEWTDCYT---LNDLYESRT 643
            Y    +L      RIR DK   D  +   + + YES++
Sbjct: 674 SYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQS 712

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 180/417 (43%), Gaps = 61/417 (14%)

Query: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302
           D+  S++ G    P LAK      E   R  +  F  E K DGER QVH MN G S++ +
Sbjct: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIY 393

Query: 303 SRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAK 362
           SR G + T  Y        ++  ++  +  K  ++D E V +D + + ILPF ++    +
Sbjct: 394 SRNGENMTERY----PEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKR 449

Query: 363 EALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSR 422
           + +    I ++        FD+L  N   L    L +R++ L+S+   +       +   
Sbjct: 450 KDVD---IKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506

Query: 423 CYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479
              ++ ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL
Sbjct: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566

Query: 480 IVI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKK 533
            V+      G+ +G    F+LG    D  E++                            
Sbjct: 567 CVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFE---------------------------- 598

Query: 534 ILSFCSIANGISQEEFKEI-DRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVL 592
             + C I  G S E  + + DR      K T+   P A+ +   S  P  W +P  +++ 
Sbjct: 599 --TACKIGTGFSDEVLQSLYDR-----LKSTTIDGPKATYIYDSSAQPDVWFEP--TLLF 649

Query: 593 EIKSRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDK---EWTDCYTLNDLYESRT 643
           E+ +  L  +   +     Y+   +L      R+R DK   E T    + +LYE+++
Sbjct: 650 EVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQS 706

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 102/425 (24%), Positives = 179/425 (42%), Gaps = 64/425 (15%)

Query: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302
           D   +++ G    P LAK      E +      +F+ E K DGER QVH +  GE ++ +
Sbjct: 348 DKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIY 406

Query: 303 SRRGIDYTYLYG--------ASLSSGTISQHLR-FTDSVKECVLDGEMVTFDAKRRVILP 353
           SR G + T  Y           + + T  Q        VK+ +LD E+V +D +++ ILP
Sbjct: 407 SRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILP 466

Query: 354 FGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKN 413
           F ++    ++ +    + +V        FDLLYLN   +    L +R++ L  +   +  
Sbjct: 467 FQVLTTRKRKNVD---LKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPG 523

Query: 414 IVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYL 470
             +   S     ++ ++  L+ A+    EG+++K  +   S Y  + R+ NW+K+K +YL
Sbjct: 524 EFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYL 583

Query: 471 EEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHI 524
           +  G++LDL+V+      G+ +G    F+LG    D +E++                   
Sbjct: 584 DGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE------------------- 624

Query: 525 QNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWI 584
                      + C I  G S E    +        + T    PP + +   S  P  W 
Sbjct: 625 -----------TCCKIGTGFSDEMLGNL----HTLLQPTEIDNPPMTYIYDSSAEPDVWF 669

Query: 585 DPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDL--- 638
                ++ E+ +  L  +   +    +Y    +L      RIR DK+ TD  T  D+   
Sbjct: 670 QA--KVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEF 727

Query: 639 YESRT 643
           YES++
Sbjct: 728 YESQS 732

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 144/297 (48%), Gaps = 17/297 (5%)

Query: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277
           +D    + + ++V +   +  +   D   +++ G    P LAK      E + R   + F
Sbjct: 355 RDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414

Query: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337
             E K DGER QVH +N G +++ +SR G + T  Y        I+  ++  +S K  +L
Sbjct: 415 TSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY----PEIKITDFIQDLNSTKNLIL 469

Query: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397
           D E V +D +++ ILPF ++    ++ +    +++V        FD+L  N   L    L
Sbjct: 470 DCEAVAWDKEQKKILPFQILSTRKRKDVE---LHDVKVKVCLFAFDILCYNDERLINKSL 526

Query: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454
            +R+++L  +   +    +         ++ ++K L+ +++   EG+++K  +   S Y 
Sbjct: 527 RERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYE 586

Query: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYK 505
            + R+ NW+K+K +YLE  G++LDL V+      G+ +G    F+LG    D  E++
Sbjct: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFE 643

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 91/383 (23%), Positives = 163/383 (42%), Gaps = 59/383 (15%)

Query: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277
           +D    + + ++V +   D  +   D    ++ G    P LAK      E + R     F
Sbjct: 306 RDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTF 365

Query: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337
             E K DGER QVH +  G +++ +SR G + T  Y       +I   +   +  K  +L
Sbjct: 366 TSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY----PEISIRDFVADLEHTKTLIL 420

Query: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397
           D E V +D  ++ ILPF ++    ++ +      +V        FD++  NG       L
Sbjct: 421 DCEAVAWDKVQQKILPFQVLSTRKRKDVE---AKDVKVRVCLFAFDIICHNGERQINKSL 477

Query: 398 HQRKQYLNSILSPLKN----IVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN--- 450
            +R++ L  +  P+       VE+  SS    VE ++K L+ ++    EG+++K  +   
Sbjct: 478 RERRELLAQVTKPVAGEFQYAVELTTSS----VEELQKFLDQSVKDSCEGLMVKMLDGPE 533

Query: 451 SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEY 504
           S Y  + R+ NW+K+K +YL+  G++LDL V+      G+ +G    F+LG    D  E+
Sbjct: 534 SHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEF 593

Query: 505 KKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTS 564
           +                              + C I  G S E  +++  +    + +T+
Sbjct: 594 E------------------------------TCCKIGTGFSDEMLQQLYER----FSKTT 619

Query: 565 EVAPPASILEFGSKIPAEWIDPS 587
              P A+ +   S  P  W +P+
Sbjct: 620 LDGPKATYVFDSSAEPDVWFEPT 642

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 102/409 (24%), Positives = 171/409 (41%), Gaps = 62/409 (15%)

Query: 251 GFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYT 310
           G    P LAK      E + R     F+ E K DGER Q+H +  G +++ +SR G + T
Sbjct: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMT 424

Query: 311 YLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNSI 370
             Y        +S       S +  +LD E V +D ++  ILPF ++    ++ +     
Sbjct: 425 ERYPEIDIRDFLSD-----PSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVD---A 476

Query: 371 NNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIK 430
            +V        FDLL  NG  L    L +R+  L  +  P+              +E ++
Sbjct: 477 KDVKVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQ 536

Query: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI----- 482
             L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL   G++LDL V+     
Sbjct: 537 HFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYG 596

Query: 483 -GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIA 541
            G+ +G    F+LG    D  EY+                              + C I 
Sbjct: 597 RGKRTGTYGGFLLGCYNQDTGEYE------------------------------TCCKIG 626

Query: 542 NGISQEEFKEI-DRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600
            G S+E  +++ DR      K T+  AP A  +   ++ P  W +P  +++ E+ +  L 
Sbjct: 627 TGFSEELLQQLYDR-----LKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLS 679

Query: 601 NT---ETNMQKYATNCTLYGGYCKRIRYDK---EWTDCYTLNDLYESRT 643
            +   +    +Y    +L      RIR DK   E T    + DLYE++ 
Sbjct: 680 LSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQA 728

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 128/294 (43%), Gaps = 25/294 (8%)

Query: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302
           D   S++      P LAK      E   R     F  E K DGER QVH +  G +++ +
Sbjct: 352 DQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIY 410

Query: 303 SRRGIDYTYLYGASLSSGTISQHLR--FTD--SVKECVLDGEMVTFDAKRRVILPFGLVK 358
           SR G + T  Y           H+R   TD    K  +LD E V +D ++  ILPF ++ 
Sbjct: 411 SRNGENMTERYPEI--------HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLS 462

Query: 359 GSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIV 418
              ++ +    IN +        FD+L  N   L    L +R+  L+SI   +    +  
Sbjct: 463 TRKRKDVD---INEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFA 519

Query: 419 RSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGE 475
                  +E ++  L+ ++    EG+++K      S Y  + R+ NW+K+K +YL   G+
Sbjct: 520 TEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGD 579

Query: 476 NLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKH 523
           +LDL V+      G+ +G    F+LG    D  E++      +   D   Q+ H
Sbjct: 580 SLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLH 633

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 125/268 (46%), Gaps = 17/268 (6%)

Query: 247 SIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRG 306
           S++ G    P LAK      E + R   + F  E K DGER QVH ++ G +++ +SR G
Sbjct: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNG 441

Query: 307 IDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALS 366
            + T  Y        I+  L         +LD E V +D ++  ILPF ++    ++ + 
Sbjct: 442 ENMTERYPEIHIRDFIADPL----VTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVD 497

Query: 367 FNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGV 426
              + +V        FD+L  N   L    L +R+Q L  +   +    +         +
Sbjct: 498 ---LKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNL 554

Query: 427 ESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI- 482
           + ++K L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL VI 
Sbjct: 555 DELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614

Query: 483 -----GRDSGKKDSFMLGLLVLDEEEYK 505
                G+ +G    F+LG    D  E++
Sbjct: 615 AYYGRGKRTGMYGGFLLGCYNQDTGEFE 642

>CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346w REV1
           DNA repair protein
          Length = 887

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 11/89 (12%)

Query: 685 IFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTT 744
           IF GL+ Y+ + + T        R EL + IV HGGK ++++  KR     V  I     
Sbjct: 84  IFQGLVLYI-NGFTTPG------RFELHQMIVVHGGKFLHHMSAKR----SVTHIIASNL 132

Query: 745 TECKALIDRGYDILHPNWVLDCIAYKRLI 773
              K +    Y ++ PNW++D I  K+L+
Sbjct: 133 PLKKRIEFANYKVVKPNWIVDSIQQKKLL 161

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 11/91 (12%)

Query: 683 SNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCK 742
           SN+F  L  Y+       +   R +R +L + IV +GGK ++++  KR     V  I   
Sbjct: 107 SNLFKDLTVYI-------NGYTRPSRFQLHEMIVLNGGKFLHHLSAKRS----VTHIIAS 155

Query: 743 TTTECKALIDRGYDILHPNWVLDCIAYKRLI 773
           T T  K +    Y ++ P W++D I  K+L+
Sbjct: 156 TLTLKKKIEFANYKVVKPEWLVDSIKVKKLL 186

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 708 RAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCI 767
           R +L + IV HGGK ++++  K+     V  I        K +    Y +++P+W+ DCI
Sbjct: 182 RLQLHEMIVLHGGKFLHHLSAKKR----VTHIVASNLPLKKRIEFANYKVVNPDWITDCI 237

Query: 768 AYKRLILIEPNYCFNVSQKMRAVAEKRVDC 797
             +RL+   P   ++++ K+    +K  +C
Sbjct: 238 KERRLL---PWQNYSLTAKLDEQQKKLDNC 264

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 8/94 (8%)

Query: 686 FAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKLIYNVILKRHSIGDVR---LISCK 742
           F G  FYV   ++    G R++ AEL++     G + +      R +    R   +  C 
Sbjct: 111 FGG--FYV---FIGRVAGGRVSAAELQQLCESGGARRVVTSHFVRDTASSARSVFVTDCA 165

Query: 743 TTTECKALIDRGYDILHPNWVLDCIAYKRLILIE 776
                 A  ++G  ++HP WV DC+    ++ +E
Sbjct: 166 EGARAAAAREQGVAVVHPKWVTDCVRRGAVVEME 199

>Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii AFR095C
          Length = 767

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 691 FYVLSDYVTEDTGIRITRAELEKTI-VEHGGKLIYNVILK--RHSIGDVRLISCKTTTEC 747
           FY+   ++   +   ++  EL++   + H  + + N  +K    S   V +  C T    
Sbjct: 112 FYM---FIGRISAPEVSTGELQQLCEIGHSYRCLTNHFIKDIECSAQSVFITDCATGARA 168

Query: 748 KALIDRGYDILHPNWVLDCIAYKRLILIEPNY 779
           KA  + G  I+HP WV+DC   KR  ++E  Y
Sbjct: 169 KAAREEGVPIVHPKWVMDCT--KRGAVLEMEY 198

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 684 NIFAGLLFYVLSDYVTEDTGIRIT-RAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCK 742
           +I  GL   +  D +    G  I  R +L ++IV HGGK I+++  K+     +  I   
Sbjct: 170 HINEGLPPQIFKDCIIYINGYTIPGRLQLHESIVLHGGKFIHHLSAKKK----ITHIIAS 225

Query: 743 TTTECKALIDRGYDILHPNWVLDCIAYKRLI 773
             T  K L    Y ++ P+W++  I  K+L+
Sbjct: 226 NLTLKKKLEFEKYKVVKPDWIVKSIESKKLL 256

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 16/105 (15%)

Query: 379 YMVFDLLYLNGTSLTPLPLHQRKQYLN-SILSPLKNI--------------VEIVRSSRC 423
           Y++FD L +NG SL   P   R  +L      P  ++              + +   +  
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSNFPFKLSMKHMNFS 203

Query: 424 YGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPE 468
           Y +  I  +L+  +   S+G++    N+SYNV  +++N +K KP+
Sbjct: 204 YDLVKIASTLD-KLPHVSDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}
           Anc_7.46 YOR346W
          Length = 817

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 10/91 (10%)

Query: 683 SNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCK 742
             IFAGL+ YV       D      R +L   IV+HGG+  + +  KR     V  I   
Sbjct: 39  GGIFAGLVVYVNGYTRPWD------RLKLHAEIVKHGGEFCHYMSGKRQ----VTHIIAS 88

Query: 743 TTTECKALIDRGYDILHPNWVLDCIAYKRLI 773
             T  K +  R Y ++   WV+D I   RL+
Sbjct: 89  NLTLKKFVEFRNYKVVSAQWVVDSIQRGRLL 119

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 4/63 (6%)

Query: 748 KALIDRGYDILHPNWVLDCIAYKRLILIEPNYCFNV---SQKMRAVAEKRVDCLGDSFEN 804
           KA ++ G  I+HP WVLDC     L+  +P Y          +  +     DC  DS   
Sbjct: 166 KAAMELGIPIIHPKWVLDCHKRNALLEFDPYYLLETIEPGTTLDQIGINSCDCW-DSLAE 224

Query: 805 DIS 807
            IS
Sbjct: 225 PIS 227

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 708 RAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCI 767
           R +L K IV HGG+ +  +  K     DV  I  +  +  K +  R + ++ P W+  C+
Sbjct: 106 REQLRKEIVLHGGQFVQYLTKK----SDVTHIVAQNLSAAKCIEFRNFKVVQPGWIGACV 161

Query: 768 AYKRLI 773
              +++
Sbjct: 162 RIGKML 167

>Kpol_1023.87 s1023 (207344..208336) [993 bp, 330 aa] {ON}
           (207344..208336) [993 nt, 331 aa]
          Length = 330

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 25/130 (19%)

Query: 143 KAITIDNVNH-YLDSLSGDRFAS--GRGFKSLVKSKPFLHCVENMSFVELKYFFDIVLKN 199
           + I+ID V H Y+ + + D F      G  S ++  P L    NMS++++ Y   I LK 
Sbjct: 81  RTISIDMVLHDYISNHNDDGFIQIVNLGCGSDLRMIPLLSIYPNMSYIDIDYEPTIKLKG 140

Query: 200 RVIGGQE----------HKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKV--------RL 241
            ++G  E          ++LL+C   D   +  VI+ LK VT  L  P +         L
Sbjct: 141 NLLGNSEFFGKVLPADRYRLLSC---DLSKHDEVINLLKEVTD-LTKPTIFITECALCYL 196

Query: 242 KDDDLSIKVG 251
           KDDD  + + 
Sbjct: 197 KDDDAQLLIN 206

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 10/102 (9%)

Query: 511 SSEIVDHSSQEK--HIQNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAP 568
           S+E    +S  K  H  +S+   + + +   IA  I +E     D  TR H     + AP
Sbjct: 253 SNEPQQQASDNKSNHADDSQSAKRPMSARSRIALEIEKEPDDMGDGYTRFH-----DEAP 307

Query: 569 PASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQKYA 610
           P   LE+   IPA + DP+   V+E    +LD  + N Q  A
Sbjct: 308 PKPDLEYTQDIPAVFTDPN---VMEQYYLTLDQQQNNHQNMA 346

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 51/120 (42%), Gaps = 22/120 (18%)

Query: 379 YMVFDLLYLNGTSLTPLPLHQRKQYLNS-----------------ILSPLKNIVEIVRSS 421
           Y++FD L +NG  LTP P   R  +L                   +  P K  + +   S
Sbjct: 144 YLMFDCLAINGRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFK--ISMKHMS 201

Query: 422 RCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIV 481
             Y +  +  SLE    + S+G++     + Y V  +++  +K KPE  EE   +  LI+
Sbjct: 202 FSYDLLKVANSLEKLPHM-SDGLIFTPVKTPYFVGGKDSLLLKWKPE--EENSVDFKLIL 258

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 35/68 (51%), Gaps = 10/68 (14%)

Query: 347 KRRVILPFGLVKGSAKEALSFNSINNVD----FHPLYMVFDLLY--LNGTSLTPLPLHQR 400
           K+ V     LV  SA    SF  INNVD    F  L M+ DL Y   NGTS+T L L Q 
Sbjct: 898 KQHVFFDLLLVVLSA----SFYVINNVDSSAAFELLCMLKDLYYRVTNGTSITELHLQQN 953

Query: 401 KQYLNSIL 408
            ++L SI 
Sbjct: 954 IKWLVSIF 961

>NCAS0G01610 Chr7 complement(285839..288361) [2523 bp, 840 aa] {ON}
           Anc_2.48 YNL201C
          Length = 840

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 6/86 (6%)

Query: 647 NPSYQAERSQLGLIRKKRKRVLISDSFHQNRKQLPISNIFAGLL---FYVLSDY---VTE 700
           +P  Q ++SQL L +   K +       +N + L  S  F  L+    ++  DY   +  
Sbjct: 363 DPPNQLDQSQLELRKNGIKLIHQCIQVSRNLEPLDKSKFFKTLVRKGLFIALDYAFNIEA 422

Query: 701 DTGIRITRAELEKTIVEHGGKLIYNV 726
           D+ IRI   ++  TI+EH   LI+NV
Sbjct: 423 DSNIRILATDMIITIIEHDILLIHNV 448

>Ecym_8257 Chr8 (522575..524983) [2409 bp, 802 aa] {ON} similar to
           Ashbya gossypii ACR044C
          Length = 802

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 443 GVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLD--LIVIGRDSGKKDSFMLGLLVLD 500
            ++L    + +++A   + WI+ K E  +   ++ D    + GRD G   SF+LGLL + 
Sbjct: 685 ALILMLKGTPWDLAMWKSYWIEFKKEEPQATEKDRDTGFFIFGRDEGIIRSFVLGLLRIP 744

Query: 501 EEEYKKHQGDSSEIV 515
           +  +K    D   IV
Sbjct: 745 DPTWKTFISDQLRIV 759

>TDEL0F04560 Chr6 (855489..862637) [7149 bp, 2382 aa] {ON} Anc_8.331
            YDR150W
          Length = 2382

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 20/86 (23%)

Query: 455  VASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEI 514
            V  RN++  K  P+ + E     DL+  GR         LGL VL+++EY+K   +++  
Sbjct: 1852 VTPRNDDQGKATPDSMGEMCSKEDLLTRGRS--------LGLAVLEQDEYQKLLDNTNSG 1903

Query: 515  VDHSSQEKHIQNSRRRVKKILSFCSI 540
             DH    KH        KK+LS  S+
Sbjct: 1904 EDH----KH--------KKLLSELSV 1917

>TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.228
           YGL130W
          Length = 450

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 112/281 (39%), Gaps = 60/281 (21%)

Query: 222 SVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEE 281
           +V  DLK++ SKL +    LK    S  V F  +  + +K++            D+ V E
Sbjct: 16  NVTQDLKMIVSKLLNSPKPLKTFPGSQPVSFQHS-DMKEKLS----------SHDYYVCE 64

Query: 282 KMDGER----IQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337
           K DG R    I ++ M   +S  F   R  +Y  + G               ++ ++  L
Sbjct: 65  KTDGLRVLMLIVINPMTKEQST-FMIDRENNYYLVNGFHFPKLPKKDKKELIETAQDGTL 123

Query: 338 -DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLP 396
            DGE+V                      +  N + N+     Y++FD L +NG +LT  P
Sbjct: 124 IDGELV----------------------IQTNPMTNLT-ELRYLMFDCLTMNGRNLTHSP 160

Query: 397 LHQRKQYLN-SILSPLKNIVEIVRSSRC---------------YGVESIKKSLEVAISLG 440
              R  +L      P  ++  I    RC               Y + ++ K+L+    L 
Sbjct: 161 TSSRLAHLGKEFYKPYFDMRSIF-PDRCINFPFKISMKQMNFSYDLVNVYKTLDKLPHL- 218

Query: 441 SEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIV 481
           S+G++    N+ Y V ++++  +K KPE  EE   +  LI+
Sbjct: 219 SDGLIFTPVNTPYVVGAKDSYLLKWKPE--EENSVDFKLIL 257

>TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {ON}
           Anc_6.228 YGL130W
          Length = 457

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 16/105 (15%)

Query: 379 YMVFDLLYLNGTSLTPLPLHQRKQYLN-SILSPLKNIVEIVRSSRCYGVE---SIKKS-- 432
           Y++FD L +NG  +TP P   R  +L      P  ++  +  + +C       S+K    
Sbjct: 144 YLMFDCLAINGRCITPSPTSSRLAHLGKEFFKPYYDLRSLF-AEQCVTFPFKLSMKHMNF 202

Query: 433 ----LEVAISLG-----SEGVVLKYYNSSYNVASRNNNWIKVKPE 468
               L+VA SL      S+G++       Y+V S+++  +K KPE
Sbjct: 203 SYDLLKVANSLSSLPHESDGLIFTPVKLPYSVGSKDSYLLKWKPE 247

>NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.46
           YOR346W
          Length = 897

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 708 RAELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCI 767
           R +L + IV HGGK ++++  K+     V  I        K L  + Y ++ P+W++  I
Sbjct: 148 RLQLHEMIVLHGGKFLHHLSAKKK----VTHIIASNLPLKKRLEFQNYKVVKPDWIVQSI 203

Query: 768 AYKRLI 773
           A  +L+
Sbjct: 204 AQGKLL 209

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,993,010
Number of extensions: 4661742
Number of successful extensions: 13763
Number of sequences better than 10.0: 72
Number of HSP's gapped: 13974
Number of HSP's successfully gapped: 72
Length of query: 944
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 825
Effective length of database: 39,836,145
Effective search space: 32864819625
Effective search space used: 32864819625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)