Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR004W (UTP23)6.15ON25425411621e-163
Smik_15.1736.15ON25120610281e-142
Suva_15.1796.15ON25920610041e-138
Skud_15.1656.15ON2572069881e-136
KAFR0A050606.15ON2692107751e-103
NDAI0I022506.15ON2712127701e-103
Kpol_1045.746.15ON2572077411e-98
KNAG0F028806.15ON2692147422e-98
KLLA0D01023g6.15ON2682107394e-98
NCAS0D026606.15ON2612087351e-97
SAKL0E01056g6.15ON2692107352e-97
CAGL0E02673g6.15ON2632097221e-95
ZYRO0C07920g6.15ON2932117155e-94
KLTH0C11352g6.15ON2682097092e-93
ACR011C6.15ON2532107021e-92
TDEL0G045406.15ON2452066959e-92
TPHA0J002806.15ON2712116841e-89
Kwal_56.223996.15ON2742166813e-89
Ecym_30196.15ON2662146717e-88
TBLA0A072906.15ON2591875883e-75
KLTH0E02860g5.392ON1891451302e-08
KLLA0A07018g5.392ON1891451283e-08
Kwal_55.200895.392ON1891451283e-08
Kpol_1055.185.392ON1891451275e-08
CAGL0M01056g5.392ON1891451267e-08
ZYRO0A06754g5.392ON1891481258e-08
KAFR0D042805.392ON1891451241e-07
NDAI0C045505.392ON1891451232e-07
KNAG0C052705.392ON1891451222e-07
TDEL0E023305.392ON1891481213e-07
AEL102W5.392ON1891411213e-07
TPHA0D023105.392ON1891451203e-07
TBLA0H017505.392ON1891451204e-07
NCAS0F030905.392ON1891451195e-07
Ecym_74695.392ON1891451186e-07
Suva_2.5095.392ON1891451187e-07
YDR339C (FCF1)5.392ON1891451187e-07
Smik_4.5995.392ON1891451187e-07
Skud_4.6065.392ON1891451187e-07
SAKL0G07766g5.392ON1891411188e-07
TPHA0H019806.279ON993145731.00
KNAG0B064804.305ON130493683.9
Ecym_20393.38ON82451666.4
TPHA0F024306.31ON79870658.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR004W
         (254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   452   e-163
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   400   e-142
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   391   e-138
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   385   e-136
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   303   e-103
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   301   e-103
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   290   1e-98
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   290   2e-98
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   289   4e-98
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   287   1e-97
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   287   2e-97
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   282   1e-95
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   280   5e-94
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   277   2e-93
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   275   1e-92
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   272   9e-92
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   268   1e-89
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   266   3e-89
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   263   7e-88
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   231   3e-75
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    55   2e-08
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    54   3e-08
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    54   3e-08
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    54   5e-08
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    53   7e-08
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    53   8e-08
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    52   1e-07
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    52   2e-07
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    52   2e-07
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    51   3e-07
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    51   3e-07
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    51   3e-07
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    51   4e-07
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    50   5e-07
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    50   6e-07
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    50   7e-07
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    50   7e-07
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    50   7e-07
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    50   7e-07
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    50   8e-07
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    33   1.00 
KNAG0B06480 Chr2 complement(1281542..1285456) [3915 bp, 1304 aa]...    31   3.9  
Ecym_2039 Chr2 (61513..63987) [2475 bp, 824 aa] {ON} similar to ...    30   6.4  
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    30   8.5  

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  452 bits (1162), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 223/254 (87%), Positives = 223/254 (87%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 181 ESGDGSGKESITKKRKLGPKAPNPLSXXXXXXXNSPXXXXXXXXXXXXXXXXXXXXXXXX 240
           ESGDGSGKESITKKRKLGPKAPNPLS       NSP                        
Sbjct: 181 ESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKEDTSKEKKKRRRRKHKS 240

Query: 241 NTNVPVSNGTTAAQ 254
           NTNVPVSNGTTAAQ
Sbjct: 241 NTNVPVSNGTTAAQ 254

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  400 bits (1028), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECN SNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCCIQALYETRN+GAI+LAKQFERRRCNHSFKDPKSPA+CIESVV+I+GANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           SQDI LRRKLR VPGVPLIHLTRSVMVMEPLSTASAKASK+TEE+KLYKGLNDPN++K+Q
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 181 ESGDGSGKESITKKRKLGPKAPNPLS 206
           E  +GSGKES+TKKRK GPKAPNPLS
Sbjct: 181 EISEGSGKESVTKKRKFGPKAPNPLS 206

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  391 bits (1004), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 185/206 (89%), Positives = 195/206 (94%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+ SNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCCIQALYETRN+GAI+LAKQFERRRCNHSFKDPKSPAECIESVVN++GANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           SQDIDLRRKLRTVPGVPLIHLTRSVM+MEPLSTASAKAS++TEEQKLYKGLNDPNIEK +
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 181 ESGDGSGKESITKKRKLGPKAPNPLS 206
               GS KES  KKRK GPKAPNPLS
Sbjct: 181 AISKGSEKESTPKKRKAGPKAPNPLS 206

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  385 bits (988), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+ SNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCCIQALYETRN+GAI+LAKQFERRRCNHSFKDPKSPAECIESVV+++GANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           SQDI LRRKLRTVPGVPLIHLTRSVM+MEPLSTASAK SK TEEQKL+KGLNDPN+EK +
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180

Query: 181 ESGDGSGKESITKKRKLGPKAPNPLS 206
           +    SGKES  KKRK+GPKAPNPLS
Sbjct: 181 KVSSESGKESAPKKRKIGPKAPNPLS 206

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  303 bits (775), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 171/210 (81%), Gaps = 4/210 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V   +NSNF+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALYETR+  AI++AK FERRRCNH  K+PK+P EC+ SVVN++G NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL- 179
           SQDID+RR+LR VPGVPL+H++RSVM+MEPLS  SAK S   E++KLYKGLNDP    L 
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 180 ---QESGDGSGKESITKKRKLGPKAPNPLS 206
              +E+ +  G    T K+K GPK PNPLS
Sbjct: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLS 210

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  301 bits (770), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 172/212 (81%), Gaps = 6/212 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+VL+C+NSN++L  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALYE  N  AI LA++FERRRCNH+ K+PK+  ECIESVVNI+G NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           SQD+  RRKLR VPGVPLIH++R+VM+MEPLS  SA+ S+  E +KLYKGLNDP    ++
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 ESGDGSG---KESIT---KKRKLGPKAPNPLS 206
            + D      KES     KKRK+GPK PNPLS
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLS 212

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  290 bits (741), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 169/207 (81%), Gaps = 1/207 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLVL+C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALY+T N  AI++AK+FERRRCNH  KDPKSP ECIES+V+I G+NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDP-NIEKL 179
           SQD+D+RRKLR +PGVP++H++R+VM++EPLS AS K S+  E+ KLYKGLND  +   L
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 QESGDGSGKESITKKRKLGPKAPNPLS 206
            E      +++   K+  GPK PNPLS
Sbjct: 181 DEPKSEKSEKTSESKKNKGPKQPNPLS 207

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  290 bits (742), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 139/214 (64%), Positives = 171/214 (79%), Gaps = 9/214 (4%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQV++D+++VL+   S F+L   L+RT+QA+VK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALY T N  AI++AK++ERRRCNH  KDPKSP ECIESVV+I G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLND------- 173
            Q+IDLRRKLR VPGVPLIH++R+VM+MEPLS ASA+ SK  E+QKL+ GLND       
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 174 -PNIEKLQESGDGSGKESITKKRKLGPKAPNPLS 206
               EK+++ G     E+  KKRKLGPK PNPLS
Sbjct: 181 AAETEKVEDKG-KEAPEAKPKKRKLGPKQPNPLS 213

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  289 bits (739), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 172/210 (81%), Gaps = 5/210 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLVLE  NS+F+   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+Q+LY+T N GAI+  KQFERRRCNH  K+PKS  EC+ SVV+++G NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL- 179
           +QD+++RR+LR +PGVPL+++ RSVMVMEPLS AS K S+  EEQKLYKGLNDP    + 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 180 QESGDGSG---KESITKKRKLGPKAPNPLS 206
           ++  D +G   +E+  KKRK GPK PNPLS
Sbjct: 181 RDENDEAGAENQENKPKKRK-GPKEPNPLS 209

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  287 bits (735), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 171/208 (82%), Gaps = 2/208 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V +C+ SN++L  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALYE  +  AI LA++FERRRCNH+ KDPK+P ECIESVVNI+G NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           +QD+ +RRKLR VPGVPL+H++R+VM+MEPLS ASAK SK  E +KLYKGLNDP    ++
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 ESGDG--SGKESITKKRKLGPKAPNPLS 206
            + +      +   KK K GPK+PNPLS
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLS 208

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  287 bits (735), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 142/210 (67%), Positives = 168/210 (80%), Gaps = 4/210 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V+    S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALY T++ GAI +AK +ERRRCNH  K+ K+  ECIESVVN +G NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL- 179
           +QDID+RRKLR VPGVPLI++ RSVMVMEPLS AS + SK+ EE+KL+KGLNDP    L 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 180 -QESGD--GSGKESITKKRKLGPKAPNPLS 206
             ES D   S K+    K+K GPK PNPLS
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLS 210

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  282 bits (722), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 133/209 (63%), Positives = 169/209 (80%), Gaps = 3/209 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V++   S ++L   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALYET+N+ AI+L K+FERRRC H   +  SP ECI +VV++ G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
            QD+++RR LR VPGVPL+H++RSVM+MEPLS ASAK S++ EE KL++GLNDP    L+
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 181 ---ESGDGSGKESITKKRKLGPKAPNPLS 206
              E  + S ++++ KKRK+GPK PNPLS
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLS 209

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  280 bits (715), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 169/211 (80%), Gaps = 6/211 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLV +C  S+++L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALY T+N  AI L K FERRRCNH  K+ K P ECI+SVVN++G+NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           SQD+ LRRKLR VPGVPLIH++RSVMVMEPLS AS++ ++++E +KL KGLNDP +  L+
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 -----ESGDGSGKESITKKRKLGPKAPNPLS 206
                E+   S  +   KKRK GPK PNPLS
Sbjct: 181 TTPSVENELESESQPPAKKRK-GPKGPNPLS 210

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  277 bits (709), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 164/209 (78%), Gaps = 3/209 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V + + ++F+L  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCCIQA+YET+N  AI LAK FERRRCNH  K+ K P EC++SVV+++G NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL- 179
           SQD  +R+KLR VPGVPLI++ RSVMVMEPLS AS   S+  E++KL+KGLNDP    L 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 180 --QESGDGSGKESITKKRKLGPKAPNPLS 206
             +E G       ++K ++ GPK PNPLS
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLS 209

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  275 bits (702), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 132/210 (62%), Positives = 167/210 (79%), Gaps = 6/210 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+VLE N S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+Q LY+T+N  AI   K +ERRRCNH  K+PK P EC++SVV ++G N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           SQDI +RR LR VPGVPL+++ R+VMVMEPLS+ S + S+  E+QKL+KGLNDP    + 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 ESGDGSGKE----SITKKRKLGPKAPNPLS 206
           E+   +G +    + T KRK GPKAPNPLS
Sbjct: 180 ENSAPAGAQPAEGAPTLKRK-GPKAPNPLS 208

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  272 bits (695), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 161/206 (78%), Gaps = 7/206 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+VL+C+ SNF+L  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+QALYET   GAI LAK FERRRCNH  K+PK P EC+ES+V ++G NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180
           SQDID RR LR  PGVPL+H  RSVMVMEPLS ASAK S   E +KL+KGLNDP    ++
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 ESGDGSGKESITKKRKLGPKAPNPLS 206
                +   SI K+     K PNPLS
Sbjct: 181 TENPQT---SIKKR----TKQPNPLS 199

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  268 bits (684), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 162/211 (76%), Gaps = 5/211 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQAD-VKV 59
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVV 119
           MITQCC+Q LY T N   I+ AK+FERRRCNHS KDPK P ECIES+VNI G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL 179
           A+Q+++LRRKLR VPGVP++HL+RSVM+MEP+S +S + ++  E+ KLYKGLNDP     
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 QESGDGS----GKESITKKRKLGPKAPNPLS 206
               +G+    G +    K++ G K PNPLS
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLS 211

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  266 bits (681), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 160/216 (74%), Gaps = 11/216 (5%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V + + + F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCCIQA+YET +  AI LAK FERRRCNH  K+ K P EC++SVVN++G NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL- 179
           +Q+ ++R  LR VPGVPL+ + RSVMVMEPLS AS   S++ E +KL+KGLNDP    L 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 180 ---------QESGDGSGKESITKKRKLGPKAPNPLS 206
                      + D  G  +  KKRK GPK PNPLS
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRK-GPKGPNPLS 215

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  263 bits (671), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 167/214 (78%), Gaps = 11/214 (5%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLVLE N S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120
           ITQCC+Q LYE++N GAI  AK +ERRRCNH +K+PK P+ECI SVV+I+G N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDP------ 174
           +QDI++RR LR VPGVPLI++ RSVMVMEPLS+ S + S+  E +KL KGLNDP      
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 175 -NIEKLQESGDGSGKESITKKRKL-GPKAPNPLS 206
            N E    S D    ++   KRK+ GPK PNPLS
Sbjct: 180 NNTE--DASVDPKSPDANQLKRKIKGPKEPNPLS 211

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  231 bits (588), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 144/187 (77%), Gaps = 4/187 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQAD--VK 58
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + +NL  GL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  VMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYV 118
            MITQCCI ALY++ +  +I++ K FERRRCNHS K+P SP+EC+ S+V+++G NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLND--PNI 176
           VA+QD++LRRKLR +PGVPLIH  RSVMVMEPLS AS + ++  E +KL  GLN    ++
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180

Query: 177 EKLQESG 183
           E  QE+G
Sbjct: 181 EGGQENG 187

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+  TL A    MIT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A   ++IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     +    +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRVRKVPGIPLMSVGGHSYVIEKL 185

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+  TL A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     ++   +H+ Y+VA+ D+ L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDVGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 71/145 (48%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C H  ++ D     +CI     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    R PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C H  ++ D     +C+     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD-----DCL-----VNRVMQHKCYIVATNDAPL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPLSTA 154
           ++++R +PG+PL+ +     V+E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 71/148 (47%), Gaps = 17/148 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C H  ++ D     +CI     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPLSTA 154
           ++++R +PG+PL+ +      +E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYAIEKLPDA 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 9/141 (6%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHR-YVVASQDIDLRRKL 130
            +   A+ LA+    +R N S K   +    +  V+      +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYADDCLVNRVL------QHKCYIVATNDAGLKQRI 164

Query: 131 RTVPGVPLIHLTRSVMVMEPL 151
           R VPG+PL+ +     V+E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 71/145 (48%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L +      R PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDQGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVVEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     ++   +H+ ++VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCFIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     ++   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R VPG+PL+ +     V+E L
Sbjct: 161 KQRIRKVPGIPLLSVGGHSYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 71/145 (48%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     +    +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 71/145 (48%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     +    +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 71/145 (48%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     +    +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 71/145 (48%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAK--QFERRRCNH--SFKDPKSPAECIESVVNISGANKHR-YVVASQDIDL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     +    +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMVMEPL 151
           ++++R +PG+PL+ +     V+E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 69/141 (48%), Gaps = 9/141 (6%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   +        ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHR-YVVASQDIDLRRKL 130
            +   A+ LA+    +R N S K   +  +C+     ++   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYA-DDCL-----VNRVLQHKCYIVATNDAALKQRI 164

Query: 131 RTVPGVPLIHLTRSVMVMEPL 151
           R VPG+PL+ +     V+E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 32.7 bits (73), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 59/145 (40%), Gaps = 19/145 (13%)

Query: 10  RKQLLVYSHTFKFREPYQVLVDNQLVL---ECNNSNFNLPSGLKRTLQADVKVMITQCCI 66
           R   L+Y   F+      +L+D    L   E N  N +LPS L  +LQ      +   CI
Sbjct: 474 RIWWLIYIQEFQL----SLLLDRPTQLGHCETNVFNISLPSSLDNSLQHTTHPTMYILCI 529

Query: 67  QALYETRNDGAINLAKQFERR--RCNHSFKDPKSPAECIESVVNISGANKHRYVVASQDI 124
           +   ETR      L K F RR    N ++ D  S ++C++    I    K+R      DI
Sbjct: 530 E---ETR------LVKTFLRRGDNSNKTYHDITS-SKCLQVCDEIEKWAKNRPKYLQTDI 579

Query: 125 DLRRKLRTVPGVPLIHLTRSVMVME 149
                   +   P +  TR +++ +
Sbjct: 580 SASALANYLQEYPWLAFTRFLLMWQ 604

>KNAG0B06480 Chr2 complement(1281542..1285456) [3915 bp, 1304 aa]
           {ON} Anc_4.305 YLR425W
          Length = 1304

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 7/93 (7%)

Query: 116 RYVVASQDIDLRRKLRTVP-GVPLIHLTRSVMVMEPLSTASAKASKITEE------QKLY 168
           R +  S ++  +R+L   P  V +  L   ++V EPL     K  K++E+        L 
Sbjct: 705 RKLFWSGNLLKKRELWLDPIKVYVALLDNYLLVTEPLVKNGQKVYKLSEKPIPLDYLNLE 764

Query: 169 KGLNDPNIEKLQESGDGSGKESITKKRKLGPKA 201
           K +N  +I  L ES  G     +   RKLGP++
Sbjct: 765 KKVNVDSIHSLLESSAGDSYHQLDSARKLGPQS 797

>Ecym_2039 Chr2 (61513..63987) [2475 bp, 824 aa] {ON} similar to
           Ashbya gossypii ADL171W
          Length = 824

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 153 TASAKASKITEEQKLYKGLNDPNIEKLQESGDGSGKESITKKRKLGPKAPN 203
           T SA+ S++       + L +P+ +      DG+G  S   K + G KAP+
Sbjct: 122 TGSARPSRVAHSMPFQQQLYNPSKDTFAVDTDGTGHHSAGAKPRRGSKAPS 172

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 12/70 (17%)

Query: 12  QLLVYSHTFKFREPYQVLVDNQLVLEC--NNSNFNLPSGLKRTLQADVKVMITQCCIQAL 69
           Q L YSH  KF + ++  ++  ++LE   N S  +L    K   +A+VK M TQ C    
Sbjct: 145 QNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVC---- 200

Query: 70  YETRNDGAIN 79
                 GAIN
Sbjct: 201 ------GAIN 204

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,398,701
Number of extensions: 886109
Number of successful extensions: 2305
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2311
Number of HSP's successfully gapped: 47
Length of query: 254
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 147
Effective length of database: 41,212,137
Effective search space: 6058184139
Effective search space used: 6058184139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)