Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR003W (YSP3)6.14ON47847824410.0
Smik_15.1726.14ON47847820010.0
Skud_15.1646.14ON48247818930.0
Suva_15.1786.14ON47647818830.0
Kwal_56.223876.14ON54350113091e-177
Suva_5.76.14ON66441812771e-170
Smik_5.276.14ON60841812641e-169
SAKL0E01012g6.14ON54441912571e-169
YEL060C (PRB1)6.14ON63541812651e-169
KLTH0C11396g6.14ON55042712561e-168
Skud_5.296.14ON60841712601e-168
TDEL0G045506.14ON56443712271e-164
KLLA0D00979g6.14ON56141912211e-163
TBLA0A073006.14ON57342012041e-160
NCAS0F002206.14ON69541412101e-160
ACR012C6.14ON54142111741e-156
CAGL0B03619g6.14ON46841811621e-155
ZYRO0C07942g6.14ON54850111681e-155
Ecym_30186.14ON57541711481e-152
NDAI0K028806.14ON70441911521e-151
KAFR0L003606.14ON50248211231e-149
Kpol_1032.56.14ON68042411301e-148
KNAG0E009206.14ON53150311081e-146
Kpol_1045.756.14ON47742410971e-146
CAGL0E02651g6.14ON48542310351e-136
TPHA0M002306.14ON58542610321e-134
KAFR0B065506.14ON4564689811e-128
NCAS0D026306.14ON4514259651e-126
NDAI0I022806.14ON4824258951e-115
KNAG0F02970singletonON4203158691e-112
CAGL0L13266gsingletonON5794236752e-81
NCAS0D043906.313ON4923165141e-58
Kpol_1018.56.313ON4653245093e-58
Suva_3.846.313ON5273235055e-57
SAKL0A02002g6.313ON4793215016e-57
ZYRO0D08822g6.313ON4903234992e-56
KLTH0A06094g6.313ON4963224992e-56
YCR045C (RRT12)6.313ON4913234921e-55
Smik_3.1496.313ON4913234922e-55
Kpol_1028.616.313ON5183184923e-55
TDEL0A072806.313ON4363204794e-54
KNAG0I024706.313ON4753224806e-54
KAFR0J024506.313ON4783364791e-53
TBLA0F039706.313ON7343194892e-53
Skud_3.1246.313ON5403214761e-52
KLLA0F06028g6.313ON5083224722e-52
NDAI0I005606.313ON4833214651e-51
Kwal_23.61836.313ON4933224651e-51
AAR069W6.313ON7683204762e-51
CAGL0L10802g6.313ON5173384635e-51
Ecym_21056.313ON6103204675e-51
TPHA0D037606.313ON6073164281e-45
TBLA0A067006.313ON4972603827e-40
Kwal_33.133721.78ON3772563713e-39
KLTH0F02288g1.78ON3802963442e-35
ZYRO0F16764g1.78ON3863442872e-27
TPHA0B045201.78ON3883122863e-27
Kpol_2000.691.78ON3863042765e-26
TBLA0A054101.78ON3822822511e-22
TDEL0C062301.78ON3642982314e-20
Smik_14.972.6ON8142761125e-05
NDAI0F038902.6ON8332501091e-04
Suva_14.1062.6ON8092781081e-04
Kwal_56.248002.6ON8032511082e-04
YNL238W (KEX2)2.6ON8142761063e-04
Skud_14.1012.6ON8192781054e-04
SAKL0G00440g2.6ON8362531045e-04
KAFR0A080402.6ON766248990.002
KLTH0H00418g2.6ON811257990.002
KLLA0D19811g2.6ON756243960.004
Ecym_64862.6ON78198960.005
NCAS0A008802.6ON833252930.010
TBLA0B001302.6ON842244910.016
ZYRO0F15598g2.6ON790103900.020
KNAG0F007702.6ON82688890.030
Kpol_1015.82.6ON843102870.057
ABL203W2.6ON76898830.14
TPHA0P017902.6ON79999770.86
TPHA0M009703.257ON1004117688.8
CAGL0J07546g2.6ON78987689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR003W
         (478 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   944   0.0  
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   775   0.0  
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   733   0.0  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   729   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   508   e-177
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   496   e-170
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   491   e-169
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   488   e-169
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   491   e-169
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   488   e-168
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   489   e-168
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   477   e-164
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   474   e-163
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   468   e-160
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   470   e-160
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   456   e-156
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   452   e-155
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   454   e-155
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   446   e-152
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   448   e-151
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   437   e-149
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   439   e-148
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   431   e-146
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   427   e-146
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   403   e-136
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   402   e-134
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   382   e-128
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     376   e-126
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   349   e-115
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              339   e-112
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   264   2e-81
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   202   1e-58
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   200   3e-58
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   199   5e-57
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   197   6e-57
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   196   2e-56
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   196   2e-56
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   194   1e-55
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   194   2e-55
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   194   3e-55
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   189   4e-54
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   189   6e-54
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   189   1e-53
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   192   2e-53
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   187   1e-52
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   186   2e-52
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    183   1e-51
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   183   1e-51
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   187   2e-51
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   182   5e-51
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   184   5e-51
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   169   1e-45
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   151   7e-40
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   147   3e-39
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   137   2e-35
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   115   2e-27
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   114   3e-27
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   110   5e-26
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...   101   1e-22
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    94   4e-20
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    48   5e-05
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    47   1e-04
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    46   1e-04
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    46   2e-04
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    45   3e-04
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    45   4e-04
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    45   5e-04
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    43   0.002
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    43   0.002
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    42   0.004
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    42   0.005
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    40   0.010
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    40   0.016
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    39   0.020
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    39   0.030
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    38   0.057
ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homo...    37   0.14 
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    34   0.86 
TPHA0M00970 Chr13 complement(186308..189322) [3015 bp, 1004 aa] ...    31   8.8  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    31   9.3  

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/478 (96%), Positives = 459/478 (96%)

Query: 1   MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60
           MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV
Sbjct: 1   MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60

Query: 61  AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXX 120
           AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVI        
Sbjct: 61  AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKS 120

Query: 121 QFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGL 180
           QFGGIDNFFDINGLFRGYTGYFTDE           KFVEQETTVKISNSSLQEEAPWGL
Sbjct: 121 QFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGL 180

Query: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240
           HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS
Sbjct: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240

Query: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300
           DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK
Sbjct: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300

Query: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360
           KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420
           VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420

Query: 421 LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW
Sbjct: 421 LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/478 (77%), Positives = 415/478 (86%)

Query: 1   MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60
           MKFSTILPILWA+C LCMIIP+FD IVRF +  D +R+ ++ + L Q   G F       
Sbjct: 1   MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60

Query: 61  AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXX 120
            HKTE +PYRY++VFNEDIS++ I+SH ++VQ+ HS SV KL E+D F  V+        
Sbjct: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120

Query: 121 QFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGL 180
           Q GGID+ FDINGLFRGY GYFTDE           KF+EQE+TV++SN+S+Q++APWGL
Sbjct: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180

Query: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240
           HR+SHREK KYGQDLEYLYEDAAG+GVTSYVLDTGIDTEHEDFEGRA WGAVIP NDEAS
Sbjct: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240

Query: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300
           DLNGHGTHCAGIIGSKH+GVAKNTK+VAVKVLRSNGEGTVSDVIKGIEYV +EHIESS+K
Sbjct: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300

Query: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360
           K+KEFKGSTANLSLGSSKSLAMEMAV+AAVDSGVHFAIAAGNE+EDACLSSPAGA+KSIT
Sbjct: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420
           VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMA+PHVAG+LSYF
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420

Query: 421 LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           LSLQPAPDSE+F++A SPQELKEKVLKFST GVLGDIGD+TPN+LIYNGGGK LD  W
Sbjct: 421 LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/478 (74%), Positives = 396/478 (82%)

Query: 1   MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60
           MK   IL IL A   LCMIIP+ + I  + E  +  R+ +A +GLGQ +  N H   Q V
Sbjct: 3   MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 62

Query: 61  AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXX 120
              ++ LPYRY+IVFNEDI+ + I+SH Q++QK    SV K+TE+D+F R +        
Sbjct: 63  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 122

Query: 121 QFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGL 180
           QFGGID  FDINGLFRGYTGYFTDE           KF+E E+TV+ISNSS QE+APWGL
Sbjct: 123 QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 182

Query: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240
           HR+SHRE+ KYGQDLEYLYEDAAG GVTSYVLDTGIDTEHEDFEGRA+WGAVIP NDEAS
Sbjct: 183 HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 242

Query: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300
           DLNGHGTHCAGIIGS+HFGVAKNT I+AVKVLRSNGEGTVSDVIKGIEYV K HI SSKK
Sbjct: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKK 302

Query: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360
           +  +FKGSTANLSLGSSKS AMEMAVNAAVD GVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 303 RGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 362

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420
           VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMA+PHVAGILSY 
Sbjct: 363 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 422

Query: 421 LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           LSLQPA DSEFF D  SPQ+LKEK+LKFST+GVLGD+ ++TPN+L+YNGGGKKLD FW
Sbjct: 423 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/478 (73%), Positives = 402/478 (84%), Gaps = 2/478 (0%)

Query: 1   MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60
           MK  T+L  L A C +CMIIP  D IV   E+I+  R+ +  EGLGQ + GNFH +   V
Sbjct: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60

Query: 61  AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXX 120
            +K E LPYRY+I F+ED S++ I+SH +++Q+  + SV KL ++DAF+  +        
Sbjct: 61  VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF--VSTSAPSDL 118

Query: 121 QFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGL 180
           QFGGID+FFDINGLFRGYTGYFT+E           KF+EQE+TVK++NS+ QEEAPWGL
Sbjct: 119 QFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGL 178

Query: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240
           HR+SHREK KYGQDLEYLYEDAAG+GVTSYVLDTGID  HEDFEGRA WGAVIP NDEAS
Sbjct: 179 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS 238

Query: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300
           DLNGHGTHCAGIIGS+HFGV KNT +VAVKVLRSNGEGTVSDVIKGIEYV K+HI+SSKK
Sbjct: 239 DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKK 298

Query: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360
              +FKGSTANLSLGSSKS AMEMAVNAAV+SGVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 299 GGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSIT 358

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420
           VGASTFSDDRAFFS+WGTCVDVFAPG+NI+STYIGSRNA+LSLSGTSMA+PHVAGILSYF
Sbjct: 359 VGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYF 418

Query: 421 LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           LSLQP+ DSEFF+   SPQ+LKEK++ FSTQGVLGD+G+DTPN+LIYNGGG+KLD FW
Sbjct: 419 LSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  508 bits (1309), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 256/501 (51%), Positives = 337/501 (67%), Gaps = 28/501 (5%)

Query: 1   MKFSTILPI-LWANCCLCMIIPDFDGIVRFIENIDGTRSVR-AGEGLGQHDPGNFHTEHQ 58
           MK  T LP+ + A     +++P+ +   +     D   +V      LG+    +F  E  
Sbjct: 1   MKLQTTLPVAMVAALASALVLPEVEEASK-----DALVAVEETAASLGESILSSFSKEVT 55

Query: 59  HVAHKT----------------EFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKL 102
             A ++                + +P+RY++VF + +  +++  HM+VV + H+ SVGKL
Sbjct: 56  KKAAESGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKL 115

Query: 103 TENDAFWRVIXXXXX---XXXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFV 159
             NDAF+              + GGI + FD+NG+ RGY GYFT E            FV
Sbjct: 116 DANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFV 175

Query: 160 EQETTVKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTE 219
           EQ++ V  +    Q  APWGL R+SHREK   G   +YLY+DAAGKGVTSYV+DTGI+ +
Sbjct: 176 EQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINID 235

Query: 220 HEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGT 279
           H+DFEGRA WG  +P ND   D NGHGTHCAG I SKH+GVAKN  +VAVKVLRSNG G+
Sbjct: 236 HKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGS 295

Query: 280 VSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIA 339
           +SDV+KG+E+  K H ++ KK  K FKGSTAN+SLG  KS A++MAVNAAV +G+HFA+A
Sbjct: 296 MSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVA 355

Query: 340 AGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNA 399
           AGNE++DAC SSPA AE +ITVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  A
Sbjct: 356 AGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETA 415

Query: 400 TLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAP--SPQELKEKVLKFSTQGVLGDI 457
           T +LSGTSMASPHVAG+L+YFLSLQP  DSE+F+ A   +P +LK+K++ +ST+  LGD+
Sbjct: 416 TATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDL 475

Query: 458 GDDTPNKLIYNGGGKKLDGFW 478
            +DT N LIYNGGG+ LD FW
Sbjct: 476 PEDTVNYLIYNGGGQDLDDFW 496

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  496 bits (1277), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 240/418 (57%), Positives = 307/418 (73%), Gaps = 3/418 (0%)

Query: 64  TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQFG 123
           T+ +P RY+IVF +D+  ++   H + VQ+    SV  L   DAF+           + G
Sbjct: 204 TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAG 263

Query: 124 GIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRV 183
           GI + F+I+ LF GY GYFT E            FVE+++ V+ ++   Q  APWGL RV
Sbjct: 264 GIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARV 323

Query: 184 SHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLN 243
           SHRE+   G   +YLY+D AG+GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 324 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGN 383

Query: 244 GHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNK 303
           GHGTHCAG I SKH+GVAKN  +VAVKVLRSNG GT+SDV+KG+EY  K H + +++K K
Sbjct: 384 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKK 443

Query: 304 EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 363
            FKGSTAN+SLG  KS A+++AVNAAV++G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 444 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503

Query: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423
           ST SDDRA+FSN+G CVDVFAPG+NI+STYIGS  AT +LSGTSMASPHVAG+L+YFLSL
Sbjct: 504 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 563

Query: 424 QPAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           QP  DSEFF    D+ +PQ+LK+K++ +ST+ +L DI DDTPN LIYNGGG+ L  FW
Sbjct: 564 QPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  491 bits (1264), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 234/418 (55%), Positives = 306/418 (73%), Gaps = 3/418 (0%)

Query: 64  TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQFG 123
           ++ +P RY++VF + +  +++  H + V +    SV  L+  DAF+           + G
Sbjct: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAG 208

Query: 124 GIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRV 183
           GI + F+I+ +F GY GYFT E            FVE+++ V+ +    Q  APWGL R+
Sbjct: 209 GIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARI 268

Query: 184 SHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLN 243
           SHRE+   G   +YLY+D AG+GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 269 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 328

Query: 244 GHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNK 303
           GHGTHCAG I SKH+GVAKN  +VAVKVLRSNG GT+SDV+KG+EY  K H + +++K K
Sbjct: 329 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKK 388

Query: 304 EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 363
            FKGSTAN+SLG  KS A+++AVNAAV++G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 389 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448

Query: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMASPHVAG+L+YFLSL
Sbjct: 449 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508

Query: 424 QPAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           QP  DSEFF    D+ +PQ+LK+K++ +ST+ +L DI +DTPN LIYNGGG+ L  FW
Sbjct: 509 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  488 bits (1257), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/419 (55%), Positives = 303/419 (72%), Gaps = 6/419 (1%)

Query: 66  FLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXX-----XXXX 120
            +P+RY+IVF +D + ++I  H +++ + H+ SV KL   D+F+                
Sbjct: 77  IIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKS 136

Query: 121 QFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGL 180
             GGI   FDI  +  GY GYFTDE           +F+E+++ V  S    Q  APWGL
Sbjct: 137 SEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGL 196

Query: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240
            R+SHRE+   G   +YLY+D AGKGVTSYV+DTGI+  H+DF GRA WG  +P NDE +
Sbjct: 197 SRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDA 256

Query: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300
           D NGHGTHCAG I S+H+GVAKN ++VA+KVLRSNG GT+SDV+KG+E+  + H E+SKK
Sbjct: 257 DGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKK 316

Query: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360
             K FKGSTAN+SLG  KS A+++AVNAAV +G+HFA+AAGNE++DAC +SPA AE +IT
Sbjct: 317 NKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAIT 376

Query: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420
           VGAST SDDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMASPHVAG+L+YF
Sbjct: 377 VGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYF 436

Query: 421 LSLQPAPDSEFFN-DAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           LSLQP  DSEFF     +P +LK+K++ +ST+ VL ++ +DTPN LIYNGGG+ L  FW
Sbjct: 437 LSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFW 495

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  491 bits (1265), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 238/418 (56%), Positives = 305/418 (72%), Gaps = 3/418 (0%)

Query: 64  TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQFG 123
           ++ +P RY+IVF      ++I  H + VQ+    SV  L+  DAF+           + G
Sbjct: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAG 235

Query: 124 GIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRV 183
           GI + F+I+ LF GY GYFT E            FVE+++ V+ +    Q  APWGL R+
Sbjct: 236 GIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARI 295

Query: 184 SHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLN 243
           SHRE+   G   +YLY+D AG+GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 296 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 355

Query: 244 GHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNK 303
           GHGTHCAG I SKH+GVAKN  +VAVKVLRSNG GT+SDV+KG+EY  K H + +++K K
Sbjct: 356 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKK 415

Query: 304 EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 363
            FKGSTAN+SLG  KS A+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 416 GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475

Query: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMASPHVAG+L+YFLSL
Sbjct: 476 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535

Query: 424 QPAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           QP  DSEFF    D+ +PQ+LK+K++ +ST+ +L DI +DTPN LIYNGGG+ L  FW
Sbjct: 536 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  488 bits (1256), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 238/427 (55%), Positives = 305/427 (71%), Gaps = 15/427 (3%)

Query: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKL-------------TENDAFWRVIX 113
           +P+RY++VF +++S +++  H Q+V + H  SV KL              E+  F     
Sbjct: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138

Query: 114 XXXXXXXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQ 173
                  + GGI + FD++GL  GY GYFTDE            FVEQ++ V       Q
Sbjct: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198

Query: 174 EEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVI 233
             APWGL R+SHREK   G   +YLY+D AGKGVTSYV+DTG++ +H+DFEGRA WG  I
Sbjct: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258

Query: 234 PANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKE 293
           P ND   D NGHGTHCAG I SKH+GVAKN  +VAVKVLRSNG G++SDV+KG+E+  K 
Sbjct: 259 PTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKS 318

Query: 294 HIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPA 353
           H ++ K+  K FKGSTAN+SLG  KS A++MAVNAAV +G+HFA+AAGNE++DAC SSPA
Sbjct: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378

Query: 354 GAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHV 413
            AE ++TVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMASPHV
Sbjct: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438

Query: 414 AGILSYFLSLQPAPDSEFFNDAP--SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGG 471
           AG+L+YFLSLQP  DSE+F+ A   +P +LK+K++ +ST+ VLGDI DDT N LI+NGGG
Sbjct: 439 AGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGG 498

Query: 472 KKLDGFW 478
           + LD FW
Sbjct: 499 EGLDDFW 505

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  489 bits (1260), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 232/417 (55%), Positives = 304/417 (72%), Gaps = 3/417 (0%)

Query: 65  EFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQFGG 124
           + +P RY+IVF + +  +    H + V +    SV  L+  DAF+           + GG
Sbjct: 150 KIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGG 209

Query: 125 IDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVS 184
           I + F+I+ +F GY GYFT E            FVE+++ V+ ++   Q  APWGL R+S
Sbjct: 210 IQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARIS 269

Query: 185 HREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNG 244
           HRE+   G   +YLY+D AG+GVTSYV+DTG++  H+DFE RA WG  IP NDE  D NG
Sbjct: 270 HRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 329

Query: 245 HGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKE 304
           HGTHCAG I SKH+GVAKN  +VAVKVLRSNG GT+SDV+KG+EY  + H + +++K K 
Sbjct: 330 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG 389

Query: 305 FKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGAS 364
           FKGSTAN+SLG  KS A+++AVNAAV++G+HFA+AAGNE++DAC +SPA A+K+ITVGAS
Sbjct: 390 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449

Query: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQ 424
           T SDDRA+FSNWG CVD+FAPG+NI+STYIGS +AT +LSGTSMASPHVAG+L+YFLSLQ
Sbjct: 450 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQ 509

Query: 425 PAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           P  DSEFF    D+ +PQ+LK K++ +ST+ +L D+ +DTPN LIYNGGG+ L  FW
Sbjct: 510 PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW 566

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  477 bits (1227), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 235/437 (53%), Positives = 306/437 (70%), Gaps = 20/437 (4%)

Query: 56  EHQHVAHKT-----------EFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTE 104
           EH+ + HK               P+RY++V     S ++I  HM+ + +    SVG+L +
Sbjct: 89  EHRGIVHKMGEGVAPLSIPPNAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQ 147

Query: 105 NDAFWRVIXXXXXXXXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETT 164
           +D F+             GGI + FD+ GL  GY GYFTD             FVE ++ 
Sbjct: 148 DDPFFSA-----QGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSP 202

Query: 165 VKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFE 224
           V  S    Q  APWGL R+SHRE+   G   +YL++D AGKGVTSYV+DTGI+ +H+DFE
Sbjct: 203 VHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFE 262

Query: 225 GRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVI 284
           GRA WG  IP NDE  D NGHGTHCAG I SKH+GVAK   +VAVKVLRSNG G++SDVI
Sbjct: 263 GRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVI 322

Query: 285 KGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNED 344
           KG+E+  + H ++ K K K FKGSTAN+SLG  KS A+++AVNAAV +G+HFA+AAGNE+
Sbjct: 323 KGVEFAAQSHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 382

Query: 345 EDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLS 404
           +DAC +SPA AE+++TVGAST SDDRA+FSN+G CVD+FAPG+NI+STYIGS +AT +LS
Sbjct: 383 QDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLS 442

Query: 405 GTSMASPHVAGILSYFLSLQPAPDSEFFN---DAPSPQELKEKVLKFSTQGVLGDIGDDT 461
           GTSMASPHVAG+L+YFLSLQP  DS+FF+      +P++LK+K++ +ST+ +L D+ +DT
Sbjct: 443 GTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDT 502

Query: 462 PNKLIYNGGGKKLDGFW 478
           PN LIYNGGG  L GFW
Sbjct: 503 PNALIYNGGGHGLKGFW 519

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  474 bits (1221), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 231/419 (55%), Positives = 303/419 (72%), Gaps = 7/419 (1%)

Query: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXX-----XXXXXQ 121
           +P RY+IVF +D S  +++ H ++V  +H+ ++G L +ND F+                 
Sbjct: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156

Query: 122 FGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLH 181
            GGI + FDI G   GY GYFT E           +FVE+++ V  ++ + Q  APWGL 
Sbjct: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216

Query: 182 RVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASD 241
           R+SHREK   G   +YLY+D AGKGVT+YV+DTG++  H+DF+GRA WG  IP +D   D
Sbjct: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276

Query: 242 LNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKK 301
            NGHGTHCAG IGS H+GVAKN  IVAVKVLRSNG GT+SDV+KG+EYV + H ++ +++
Sbjct: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336

Query: 302 NKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITV 361
            K FKGSTAN+SLG  KS A+++AVNAAV +GVHFA+AAGNE++DAC +SPA AE +ITV
Sbjct: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396

Query: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFL 421
           GAST SD+RA+FSNWG CVD+F PG+NI+STYIGS  AT +LSGTSMA+PHV G+L+YFL
Sbjct: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456

Query: 422 SLQPAPDSEFFNDAP--SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           SLQP  DSE+F+ A   +P +LK+K++ FST+ VL D+ +DT N LIYNGGG+ LD  W
Sbjct: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  468 bits (1204), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 224/420 (53%), Positives = 297/420 (70%), Gaps = 7/420 (1%)

Query: 62  HKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQ 121
           H    +P+RY+I F +D++ ++I  H Q + +    S+ +L  +  ++  +         
Sbjct: 120 HPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQP- 178

Query: 122 FGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLH 181
              I + F+IN L +GY GYFTD+           +FVEQ++TV I+    Q  APWGL 
Sbjct: 179 ---IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLA 235

Query: 182 RVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASD 241
           R+SHRE+   G   +YL++D AG+GVT+YV+DTG++ EH DFEGRA WG  IP NDE  D
Sbjct: 236 RISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLD 295

Query: 242 LNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKK 301
            NGHGTHCAG I SKH+GVAKN  +VAVKVLRSNG G++SDV+KG+EY T  H+   K K
Sbjct: 296 GNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNK 355

Query: 302 NKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITV 361
              FKGSTAN+SLG  KS ++++AVNAAV +G+HFA+AAGNE++DAC +SPA A+ +ITV
Sbjct: 356 KSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITV 415

Query: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFL 421
           GAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMASPHVAG+LSYFL
Sbjct: 416 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFL 475

Query: 422 SLQPAPDSEFFNDAP---SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           SLQP  DSEF        +P +LK++++ + T+ +L DI + TPN L++NG G+ L  FW
Sbjct: 476 SLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  470 bits (1210), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 226/414 (54%), Positives = 301/414 (72%), Gaps = 2/414 (0%)

Query: 66  FLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQFGGI 125
            +P RY++VF + I  +++  H +++ +    S  KL ++D F+           Q GGI
Sbjct: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQ-GGI 156

Query: 126 DNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVSH 185
              F+I+ L  GY GYFTDE           ++VE+++ V+ +    Q  APWGL R+SH
Sbjct: 157 LTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISH 216

Query: 186 REKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNGH 245
           RE+   G   +YLY+D AGKGVT YV+DTGI+TEH DF  RA WG  IP ND+  D NGH
Sbjct: 217 RERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGH 276

Query: 246 GTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEF 305
           GTHCAG I S H+GVAKN ++VAVKVLRSNG G++SDVIKG+E+  + HI+++K+K K F
Sbjct: 277 GTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGF 336

Query: 306 KGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 365
           KGSTAN+SLG  KS  +++AVNAAVD+G+HFA+AAGNE++DAC +SPA AE++ITVGAST
Sbjct: 337 KGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAST 396

Query: 366 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQP 425
            SDDRA+FSNWG CVD+FAPG+NI+STYIG  +AT +LSGTSMASPHVAG+L+YFLSLQP
Sbjct: 397 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQP 456

Query: 426 APDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
             DSEFF+    +P ++K+K++ +S++ VL D+ + TPNKLI+NG G  LD  W
Sbjct: 457 GSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  456 bits (1174), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/421 (53%), Positives = 296/421 (70%), Gaps = 6/421 (1%)

Query: 64  TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXX-----XX 118
           T  +P++Y++VF E +S ++   HM++V+  H+ SV +L E  AF+R             
Sbjct: 68  TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAA 127

Query: 119 XXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPW 178
               GGI+  F +    RGY GYFT++            FVE+++ V  S+ + Q  APW
Sbjct: 128 TRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPW 187

Query: 179 GLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDE 238
           GL RVSHREK   G   +YLY+D +G+GVTSYV+DTGI+ +H DFE RA WG  IP ND 
Sbjct: 188 GLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA 247

Query: 239 ASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESS 298
             D NGHGTHCAG I SK +GVAK   +VAVKVLRSNG G++SDV++G+EY  K H +++
Sbjct: 248 DYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAA 307

Query: 299 KKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKS 358
           +K +K FKGSTAN+SLG  +S A+++AV+AAVD+G+HFA+AAGNE++DAC +SPA ++K+
Sbjct: 308 EKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKA 367

Query: 359 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILS 418
           ITVGAST +DDRA+FSNWG CVD+FAPG+NI+STYIGS  A  +LSGTSMASPHVAG+L+
Sbjct: 368 ITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLT 427

Query: 419 YFLSLQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGF 477
           YFLSLQP  DSEF N    SP+ LK+KV+ F T+  L  +   T N LIYNGGG  L  F
Sbjct: 428 YFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDF 487

Query: 478 W 478
           W
Sbjct: 488 W 488

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  452 bits (1162), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 221/418 (52%), Positives = 299/418 (71%), Gaps = 9/418 (2%)

Query: 66  FLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQFGGI 125
            +P++Y++V  + +S + + + +  V   H+ ++  L +   F+  +          GGI
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57

Query: 126 DNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVSH 185
            + F+IN LF+G  GYF +            +FVE+++ V  SN   Q  APWGL R+SH
Sbjct: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117

Query: 186 REKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNGH 245
           R++   G   +YLY++A G+GVT+YV+DTGI+ +H +F+GRA+WG  IP ND   D NGH
Sbjct: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177

Query: 246 GTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEF 305
           GTHCAG I SKH+G+AK   +VAVKVL+S+G GT+SDVIKG+EY  + H++ S K NK+F
Sbjct: 178 GTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKES-KNNKKF 236

Query: 306 KGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 365
           KGSTAN+SLG  KS A++MAVNAAV +G+HFA+AAGNE++DAC +SPA AEK+ITVGAST
Sbjct: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296

Query: 366 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNA-TLSLSGTSMASPHVAGILSYFLSLQ 424
            SDDRA+FSNWG CVD+FAPG+NI+STYIG  N  T SLSGTSMASPHVAG+L+YFLSLQ
Sbjct: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356

Query: 425 PAPDSEFFNDAP---SPQELKEKVLKFSTQGVLGDIGD-DTPNKLIYNGGGKKLDGFW 478
           P  DSEF++ +    +P +LK+K++ +ST+ VL D+ D D+PN LIYNG G  L  FW
Sbjct: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  454 bits (1168), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 242/501 (48%), Positives = 319/501 (63%), Gaps = 23/501 (4%)

Query: 1   MKFS-TILPI-LWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGL--GQHDPGNFHTE 56
           MKF  +++P+   A     +IIP+  G   + +  + T  V  GE +     + G    E
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60

Query: 57  HQHVAHKT------EFLPY------------RYVIVFNEDISLQQIQSHMQVVQKDHSTS 98
               A K        F P             RY+I+F + ++ Q+I  H +++++ H   
Sbjct: 61  LAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQE 120

Query: 99  VGKLTENDAFWRVIXXXXXXXXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKF 158
           V +L E  +F+  I          GGID+ FDING+  GY+GYF  +           + 
Sbjct: 121 VSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEM 180

Query: 159 VEQETTVKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDT 218
           VEQ++ V    +  +  APWGL R+SHRE+   G   +YLY++  G GVTSYV+DTG++ 
Sbjct: 181 VEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNV 240

Query: 219 EHEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEG 278
            H  F GRA+WG  IPA D   D NGHGTHCAG IGS  +GVAK   IVAVKVLRSNG G
Sbjct: 241 HHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSG 300

Query: 279 TVSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAI 338
           ++SDV+KG+E+  ++H  + K+K   FKGSTAN+SLG  KS +++ AVNAAV +G++FA+
Sbjct: 301 SMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAV 360

Query: 339 AAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398
           AAGNED+DAC +SPA A   ITVGAST SDDRA+FSN+G CVDVFAPG+NI+STYIGS +
Sbjct: 361 AAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDS 420

Query: 399 ATLSLSGTSMASPHVAGILSYFLSLQPAPDSEF-FNDAPSPQELKEKVLKFSTQGVLGDI 457
           +T +LSGTSMASPHVAG+L+YFLSLQP  DSEF    + SP +LK+K+L FST+ VL DI
Sbjct: 421 STATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDI 480

Query: 458 GDDTPNKLIYNGGGKKLDGFW 478
              TPN LIYNGGG  L GFW
Sbjct: 481 PSGTPNLLIYNGGGGDLSGFW 501

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  446 bits (1148), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 218/417 (52%), Positives = 292/417 (70%), Gaps = 7/417 (1%)

Query: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQF---- 122
           +P+RY+++F + ++   +  H  +V   H  ++ +L    +F+                 
Sbjct: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168

Query: 123 GGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHR 182
           GGI+  F+I G  RGY GYFTD            K +EQ++ V  S+   Q  APWGL R
Sbjct: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228

Query: 183 VSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDL 242
           VSHRE+   G   +YLY+D AGKGVT+YV+DTGI+ +H +FEGRA+WG  IP+ND   D 
Sbjct: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288

Query: 243 NGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKN 302
           NGHGTHCAG I SK +GVAKN K+VAVKVLR+NG GT+SDV++G+EYV  EH ++S   N
Sbjct: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN 348

Query: 303 KEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVG 362
             FKGSTAN+SLG  KS A+E+AV+AAV +G+HFA+AAGNE++DAC +SPA ++K ITV 
Sbjct: 349 --FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVA 406

Query: 363 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLS 422
           AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMASPHVAG+L+YFLS
Sbjct: 407 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 466

Query: 423 LQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           LQP   SE++  +  SP+ LK+K++ + ++ +L ++   T N LI+NGGG  LD FW
Sbjct: 467 LQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  448 bits (1152), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 219/419 (52%), Positives = 294/419 (70%), Gaps = 6/419 (1%)

Query: 65  EFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQFGG 124
             LP +Y+IVF + I++ +I  H +++ +    S  +L  +  F+           + GG
Sbjct: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNGG 296

Query: 125 IDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVS 184
           I + F+IN +  GY+GYFT E           K+VE+++ V+ +  + Q  APWGL R+S
Sbjct: 297 IISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRIS 356

Query: 185 HREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNG 244
           HRE+   G   +YLY+D AGKGVT +V+DTGI+  H DF  RA WG  IP+ND+  D NG
Sbjct: 357 HRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNG 416

Query: 245 HGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKE 304
           HGTHCAG I S H+GVAKN ++VAVKVLRSNG G++SDVIKG+E+  + H+ + K K K+
Sbjct: 417 HGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKNK-KD 475

Query: 305 FKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGAS 364
           +KGSTAN+SLG  KS  +++AVNAAV++G+HF++AAGNE++DAC SSPA AE +ITVGAS
Sbjct: 476 YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGAS 535

Query: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMASPHVAGILSYFLSL 423
           T SDDRA+FSNWG CVDVFAPG+NI+STY+G  N  T +LSGTSMASPHVAG+L+YFLSL
Sbjct: 536 TLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSL 595

Query: 424 QPAPDSEFFNDAP----SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           QP   S FFN       +P++LK+K++ +ST  +L D+ D TPNKLIYNG G  +   W
Sbjct: 596 QPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  437 bits (1123), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 223/482 (46%), Positives = 306/482 (63%), Gaps = 15/482 (3%)

Query: 1   MKFSTILPILWANCCLCMIIPDF-DGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQH 59
           M+    L ++ +     ++IP   D I +F ++I G         L             H
Sbjct: 1   MQLLIHLLLVCSTLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAP----------VH 50

Query: 60  VAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTEN--DAFWRVIXXXXX 117
            A     +P+RY+IVF + +S +QIQ H +++   H       + +  +     I     
Sbjct: 51  NADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPES 110

Query: 118 XXXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAP 177
                GGI + FDI+ L  GY  Y +DE            F+E +T V  ++ + Q  AP
Sbjct: 111 MRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAP 170

Query: 178 WGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPAND 237
           WGL R+SHRE        +YLY+D AGK V +YV+DTG+D  H +F  RA WG  IP ND
Sbjct: 171 WGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230

Query: 238 EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIES 297
           +  D NGHGTH AG IGS+H+GVAK+  I+AVKVLRSNG G++SDV+KG+E+    H+E 
Sbjct: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLER 290

Query: 298 SKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEK 357
            K + K  KGS AN+SLG  KS A+++AVNAAV +G+HFA+AAGNE+++AC SSPA AE+
Sbjct: 291 MKNE-KNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349

Query: 358 SITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMASPHVAGI 416
           ++TVGAST SD+RA+FSNWG CVD+FAPG+NI+STYIG+  + T +LSGTSMASPHVAG+
Sbjct: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409

Query: 417 LSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDG 476
           L+Y+LSLQP   SEF   A S  +LK+K+++++T+ VL D+ + TPN LIYNGGG+ L  
Sbjct: 410 LAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSD 469

Query: 477 FW 478
           FW
Sbjct: 470 FW 471

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  439 bits (1130), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 214/424 (50%), Positives = 294/424 (69%), Gaps = 16/424 (3%)

Query: 58  QHVAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXX 117
           ++  ++   +P +Y+IVF +D+S++ +Q H  ++ +              F         
Sbjct: 223 ENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQ------------FQYASVSDET 270

Query: 118 XXXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAP 177
                GGI+  F++  LF GY G+F ++            FVEQ++ V  +    Q  AP
Sbjct: 271 SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAP 330

Query: 178 WGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPAND 237
           WGL R+SHR+    G   +YLY+D AG+GVT+YV+DTGI+ +H++F GRA WG  IP ND
Sbjct: 331 WGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPEND 390

Query: 238 EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIES 297
           +  D NGHGTHCAG I SK++GVAKN ++VAVKVLRS+G GT+SDV+KG+EY    H ++
Sbjct: 391 QDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKA 450

Query: 298 SKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEK 357
            ++K K FKGSTAN+SLG  KS ++++AV+AAV SG+HFA+AAGNE++DAC SSPA +E 
Sbjct: 451 LREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASEN 510

Query: 358 SITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGIL 417
           +ITVGAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMASPHVAG+L
Sbjct: 511 AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLL 570

Query: 418 SYFLSLQPAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKL 474
           SYFLS+QP  DSEFF   +++ SP +LK+K++ +ST+ +  D+ + TPN L+YN  G  +
Sbjct: 571 SYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNI 629

Query: 475 DGFW 478
             FW
Sbjct: 630 SDFW 633

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  431 bits (1108), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 225/503 (44%), Positives = 310/503 (61%), Gaps = 49/503 (9%)

Query: 8   PILWA----NCCLCMIIPDFDGIVRFIENIDGTRSVRAGE----GLGQHDPGNFHTEHQH 59
           P+LWA         +++P+        +   G R     E    G   H P +   EH+ 
Sbjct: 6   PVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEKDEHRP 65

Query: 60  VAH------KTEFLPY---------------RYVIVFNEDISLQQIQSHMQVVQKDHSTS 98
             H      + E  P                +Y+I+F E ++ +QI +H Q++Q+     
Sbjct: 66  CKHGKEAHDEEELAPLYTPGSALSASSSRSNKYIILFKEGVTAEQISAHKQLLQQ----- 120

Query: 99  VGKLTENDAFWRVIXXXXXXXXQ--FGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXX 156
                       V+        Q     + + FD+ G+  GY    +             
Sbjct: 121 ------------VLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFV 168

Query: 157 KFVEQETTVKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGI 216
           + VEQ++ V  +    Q  APWGL R+SHR+    G   +YLY+DAAG+GV SY++DTGI
Sbjct: 169 QLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGI 228

Query: 217 DTEHEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNG 276
           + +H++FEGRA+WG  IP ND   D NGHGTHCAG I SKH+GVAK   ++AVKVLRSNG
Sbjct: 229 NVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNG 288

Query: 277 EGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHF 336
            G++SDVI G+E+  K+H   +K  +K+FKGSTAN+SLG  KS +++  V+AAV  G+HF
Sbjct: 289 SGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHF 348

Query: 337 AIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGS 396
           ++AAGNE++DAC +SPA +E++ITVGAST SDDRA+FSNWG+CVD+FAPG+NI+STY GS
Sbjct: 349 SVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGS 408

Query: 397 RNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLG 455
            +AT +LSGTSMASPHVAG+L+YFLSLQP   S+F   A  +P++LK+K+L +ST+GVL 
Sbjct: 409 DDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLF 468

Query: 456 DIGDDTPNKLIYNGGGKKLDGFW 478
           D+ +DTPN LIYNGGG  L  FW
Sbjct: 469 DLPEDTPNALIYNGGGADLSDFW 491

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  427 bits (1097), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 283/424 (66%), Gaps = 7/424 (1%)

Query: 60  VAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRV-IXXXXXX 118
           +   +E +PY Y++VFNE ++  +I  H++ + +    SV  L  +  F+ +        
Sbjct: 28  ITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNS 87

Query: 119 XXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPW 178
               GG+ + F I     GYTG FTDE           KF+E+++ V  + ++ Q  APW
Sbjct: 88  NGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPW 147

Query: 179 GLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDE 238
           GL R+SHR +       +YLY+D  GKGV +YV+DTGI+  + DF GRA WG  IPA + 
Sbjct: 148 GLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEA 207

Query: 239 ASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESS 298
             D NGHGTH AG I S H+GVAK  K+ AVKVLRSNG G++SDV+KG+EYV   H    
Sbjct: 208 NVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAH--QR 265

Query: 299 KKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKS 358
                 FKGS AN+SLG  KS ++++AVNAAV +GVHFA+AAGNE++DAC +SPA AE++
Sbjct: 266 DVGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERA 325

Query: 359 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILS 418
           ITVGAST SD RA+FSNWG CV +FAPG+NI+STYIGS +AT +LSGTSMASPH+AG+++
Sbjct: 326 ITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVA 385

Query: 419 YFLSLQPAPDSEFFND----APSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKL 474
           YFLSLQPA  S+F++     A +P +LK+K++ F T+  L D+  +TPN + YNG GK L
Sbjct: 386 YFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSL 445

Query: 475 DGFW 478
           + FW
Sbjct: 446 EDFW 449

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  403 bits (1035), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 284/423 (67%), Gaps = 24/423 (5%)

Query: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSV-------GKLTE-NDAFWRVIXXXXXX 118
           +P RY+++F + ++ ++IQSH+  +++ +S+S+       GK T+ ND   R I      
Sbjct: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGI------ 127

Query: 119 XXQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPW 178
                G+ + F I     GY GYFT+            + VE ++ V+I+N  +QE  PW
Sbjct: 128 -----GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPW 182

Query: 179 GLHRVSHREK-PKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPAND 237
           GL R+S REK P  G+   Y Y+D  GK   ++V+DTGI  +HEDFEGRA WG  I  ND
Sbjct: 183 GLGRISQREKLPILGKRF-YHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVEND 241

Query: 238 EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIES 297
              DLNGHGTHCAG I SKH+G+AK  +++AVKVLRS+G G++SDVI+G+EY T E    
Sbjct: 242 NDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEY-TVEAYND 300

Query: 298 SKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEK 357
            KK     KG+  N+SLG+ KS A+  A++AA  +G+ FA+AAGNE +DAC SSPA A  
Sbjct: 301 LKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWS 360

Query: 358 SITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGIL 417
            ITVG ST SDD AFFSN+G CVD+FAPG+NIMSTYIGS+NAT SLSGTSM+SPHVAG+L
Sbjct: 361 PITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVL 420

Query: 418 SYFLSLQPAPDSEFFND--APSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLD 475
           +Y+LSLQP   S+F+++  A SP+ LK+KVL ++T G L  +  +T N L+YNGGGK L 
Sbjct: 421 AYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLS 480

Query: 476 GFW 478
            FW
Sbjct: 481 KFW 483

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  402 bits (1032), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 213/426 (50%), Positives = 283/426 (66%), Gaps = 33/426 (7%)

Query: 70  RYVIVFNEDISLQQIQSHMQVV---------QKDHSTSVGKLTENDAFWRVIXXXXXXXX 120
           RY+IVF + +  +Q+  H++++         ++  + + G     D F RV+        
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVM-------- 186

Query: 121 QFGGIDNFFDINGLFRGYTGYF-TDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWG 179
                 + F++ G F GY     + +            +VE+++ V  S    Q  APWG
Sbjct: 187 ------DTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH-SLDETQNNAPWG 239

Query: 180 LHRVSHREKPKYGQDLEYLY-EDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDE 238
           L R+SHRE    G   +YLY  ++AGKGVT+YV+DTGI   H +F  RA+WG  IP ND 
Sbjct: 240 LARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDY 299

Query: 239 ASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHI--- 295
             D NGHGTHCAG IGS+H+GVAK   +VAVKVLRS+G GT+SDV+KG+E+V  EH    
Sbjct: 300 DIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHL 359

Query: 296 -ESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAG 354
            ES K KN  +KG+TAN+SLG  KS A++ AVNAAV +GVHFA+AAGNE++DAC SSPA 
Sbjct: 360 EESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAA 419

Query: 355 AEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVA 414
           AE +ITVGAST SDDRA+FSN+G CVD+FAPG+NI+STYIG+ +AT +LSGTSMASPHVA
Sbjct: 420 AENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVA 479

Query: 415 GILSYFLSLQPAPDSEFF--NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGK 472
           G+L+Y LSLQP   SEF+  N   +P ++K+K++ ++T+  L D+  DTPNKLIYNGG  
Sbjct: 480 GLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFN 539

Query: 473 KLDGFW 478
             D FW
Sbjct: 540 STD-FW 544

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  382 bits (981), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 204/468 (43%), Positives = 280/468 (59%), Gaps = 35/468 (7%)

Query: 15  CLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHVAH----KTEFLPYR 70
           CL +++P+                 R  E + Q D  +  +  + + H    + + +  +
Sbjct: 17  CLSLLLPEI-------------FQCRGIETISQKDRDSTFSRTEVLEHLSAKQNDIIKDQ 63

Query: 71  YVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQFGGIDNFFD 130
           Y+++F     + + + H + ++    T   +  E D     +              N F 
Sbjct: 64  YIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNL--------------NIFK 109

Query: 131 INGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVSHREKPK 190
           I     GY      E           + +E ++ V      +QE+ PWGL R+S R + +
Sbjct: 110 IGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVR 169

Query: 191 YGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNGHGTHCA 250
            GQD  Y Y+DA    VT+YVLDTGI   HE F GRA WG  I  ND   D +GHGTH A
Sbjct: 170 IGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVA 229

Query: 251 GIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTA 310
           GII S  FGVAK  ++VAVKVLRSNGEG +SDV+KGIE+V  +H   SK KN   KGS  
Sbjct: 230 GIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---SKNKNYS-KGSVV 285

Query: 311 NLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR 370
           NLSLG+SKS A+ +A++AA+   +HFA+AAGNE+ DAC +SPA A ++ITVGAS FSD+R
Sbjct: 286 NLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDER 345

Query: 371 AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSE 430
           AFFSNWG CVDVFAPG+N+MSTYIGS NATLSLSGTS A+P+ AG+++Y+LSLQP  DS 
Sbjct: 346 AFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKDSG 405

Query: 431 FFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478
           +F    +P +LKEK++ F ++ VL ++ ++TPN +IYNG G+ L  FW
Sbjct: 406 YFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  376 bits (965), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 195/425 (45%), Positives = 270/425 (63%), Gaps = 27/425 (6%)

Query: 60  VAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXX 119
           + H    +P +Y+++F  D +  Q ++H+  +          L   D  + ++       
Sbjct: 46  IHHAASPIPNQYIVLFKSDTTDIQRETHLATLNS-------WLLNTDPQYTILHS----- 93

Query: 120 XQFGGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWG 179
                    F +    +GYT    ++           + +EQ++ V       Q ++PWG
Sbjct: 94  ---------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWG 144

Query: 180 LHRVSHREKPKYGQDLEYLYEDA-AGKGVTSYVLDTGIDTEHEDFEGRAEWGAVI-PAND 237
           L R+S RE+ K  QD  Y Y+D+ A      Y+LDTGI+  H +F+GRA+WGAV  P   
Sbjct: 145 LARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEP 204

Query: 238 EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIES 297
              D NGHGTHCAG+IGS  +GVAKNT ++AVKVL + G+G +S VI+GIEYVT++H + 
Sbjct: 205 NQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQD 264

Query: 298 SKKKNKE-FKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAE 356
            KK+++  FKGS  NLSLG+ KS A+   + AAV  GVHFA+AAGNED+DAC +SPA + 
Sbjct: 265 MKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSP 324

Query: 357 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMASPHVAG 415
            ++TVGAS+FSDDR FFSNWG CVDVFAPGINIMSTYIG   N T SLSGTSM++P V G
Sbjct: 325 HALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTG 384

Query: 416 ILSYFLSLQPAPDSEFFN--DAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKK 473
           +++YFLSLQP   S+F+    +P+P +LK K++ FST+GVL +I + TPN+++YNGGG  
Sbjct: 385 LIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHS 444

Query: 474 LDGFW 478
           L  FW
Sbjct: 445 LKDFW 449

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  349 bits (895), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 267/425 (62%), Gaps = 17/425 (4%)

Query: 63  KTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQF 122
           +  F+P +Y+++F  D +  QI    Q +         K   ND + +V+          
Sbjct: 59  QKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTK 118

Query: 123 GGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHR 182
           G I        +      +  D            K +E+++ V ++  + Q ++ WGL R
Sbjct: 119 GMI--------IRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSR 170

Query: 183 VSHREKPKYGQDLEYLYED-AAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEA-S 240
           +S R   K  QD  Y Y+D  +GKGV  Y+LDTGI++ H +FEGRA WG  +P  + +  
Sbjct: 171 ISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLE 230

Query: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEH------ 294
           D NGHGTHCAGIIGSK +GVAK T ++AVKVL   G+G++SDVI G+E+V   H      
Sbjct: 231 DSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNN 290

Query: 295 IESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAG 354
           I SS   + EFKGS  NLSLG+ KS ++++A+ +A   G+H  +AAGNEDEDAC++SPA 
Sbjct: 291 ISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPAD 350

Query: 355 AEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATLSLSGTSMASPHV 413
           +   ITVGAS+FSDDRAFFSNWG CVDVFAPGINI STYIG + N TLSLSG+SM+SP V
Sbjct: 351 SPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFV 410

Query: 414 AGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKK 473
           +G+ +Y+LSLQP   S+F +   +P +LK K++ FST G+L ++  DT NKL+YNGGGK 
Sbjct: 411 SGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKD 470

Query: 474 LDGFW 478
           L GFW
Sbjct: 471 LSGFW 475

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  339 bits (869), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 224/315 (71%), Gaps = 5/315 (1%)

Query: 157 KFVEQETTVKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLYED-AAGKGVTSYVLDTG 215
           + VE  + V   N ++QE+ PWGL R+S R++ + G +  Y Y+   + K V  Y+LDTG
Sbjct: 106 EMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVYILDTG 165

Query: 216 IDTEHEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSN 275
           I  +HE+FEGRA WG  I  ND   D NGHGTHCAGI+G   +GVAK   ++AVKVL + 
Sbjct: 166 IQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEANLIAVKVLHAT 225

Query: 276 GEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVH 335
           G+G +SDVI+GIE+   EH+    +   E +GS  NLSLG+ +S A++  V AA++ GVH
Sbjct: 226 GDGEMSDVIRGIEFAVNEHL---TRNQDEVRGSIINLSLGAGESPALQRVVTAALNKGVH 282

Query: 336 FAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG 395
           FA+AAGNED++AC SSPA  +  +TVG STFSDDRAFFSNWG C+DVFAPG+N+ S+Y+G
Sbjct: 283 FAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPGVNVKSSYVG 342

Query: 396 -SRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVL 454
            ++N TLSLSGTS ++PHVAG+++Y LSL+P   S+F     +P +LK+K++  +T+G L
Sbjct: 343 AAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSNPAQLKQKLVSLATEGKL 402

Query: 455 GDIGDDTPNKLIYNG 469
            ++ DDT N +I+NG
Sbjct: 403 FEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  264 bits (675), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 146/423 (34%), Positives = 225/423 (53%), Gaps = 13/423 (3%)

Query: 63  KTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVIXXXXXXXXQF 122
           +   +PYRY+++F       +I+ H+Q V K        L  ND F+           + 
Sbjct: 65  QNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEFSTEEL 124

Query: 123 GGIDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHR 182
           GG+   FDI   F GY GYFTDE            +VE ++ + I +      + W L R
Sbjct: 125 GGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLAR 184

Query: 183 VSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDL 242
           +SHR K       EY ++   G+ + +Y+LDTG+   H  +  R   G VI  N++  D+
Sbjct: 185 ISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERDM 244

Query: 243 NGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKN 302
           NGHGT  AG++G +  GVA+   ++ VKVL   G GTVS++IKG+ +V   H +  +K  
Sbjct: 245 NGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIEKNG 304

Query: 303 KEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVG 362
               G+    S+  +KS ++  A +  V SG+H  + AG +  +AC SSPA + K ITV 
Sbjct: 305 --VLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVA 362

Query: 363 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNA---TLSLSGTSMASPHVAGILS 418
             + +D+     NWG+CVD++ PG  + +TY    RN     +S++G+S A+  VAG+L+
Sbjct: 363 GMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLA 422

Query: 419 YFLSLQP---APDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLD 475
           YF SLQP    PD        +P+ELKE+++ F T+G L ++   +PN + +NG G  LD
Sbjct: 423 YFASLQPGLGTPDVIPL----TPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLD 478

Query: 476 GFW 478
            F+
Sbjct: 479 SFF 481

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  202 bits (514), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 180/316 (56%), Gaps = 39/316 (12%)

Query: 172 LQEEAPWGLHRVSHR--------EKPKYGQDLEYLYED-AAGKGVTSYVLDTGIDTEHED 222
           +Q  AP  L R+S R        +K  Y   L+Y Y+  + G  V +Y++D+GI  EHE+
Sbjct: 128 VQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLEHEE 187

Query: 223 FEGRAEWGAVIPANDEAS-DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVS 281
           F GRA  G  I    E S D NGHGTH AGI+GSK +GVAK  K++ +KVL   G+G+++
Sbjct: 188 FNGRAIPG--IDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLA 245

Query: 282 DVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAG 341
            V+ GIE+  K   E+SKK         ANLSLGS ++  +  A+ AA+D+G+   +AAG
Sbjct: 246 MVLGGIEFAVKHCQETSKKGR-----CVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAG 300

Query: 342 NEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSR 397
           N + +AC  SPA A ++ITVGA    DDR    A FSNWG C+D+FAPG+ I S  I   
Sbjct: 301 NNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKD 357

Query: 398 NATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD- 456
              ++ SGTSMASP VAG+ +  L           +   S +E+K+ +L+  T  V    
Sbjct: 358 KEDVTYSGTSMASPTVAGLAALTL-----------DQGVSAEEVKDYILEMGTDNVFHRR 406

Query: 457 ---IGDDTPNKLIYNG 469
                  TPNK+ +NG
Sbjct: 407 SLLFKPGTPNKICFNG 422

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  200 bits (509), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 128/324 (39%), Positives = 184/324 (56%), Gaps = 40/324 (12%)

Query: 172 LQEEAPWGLHRVSHR-EKP-------KYGQDLEYLYEDAA--GKGVTSYVLDTGIDTEHE 221
           +Q EAP  L R+S R + P       +Y    +Y Y DA   G  V +Y++DTGI  EH 
Sbjct: 114 IQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDY-YFDAKYQGSSVNAYIIDTGIYKEHP 172

Query: 222 DFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVS 281
           +FEGR ++ A+    +   D NGHGTH AGI+GSK FGVAK   I+ VK L   G+G +S
Sbjct: 173 EFEGRVKF-AIDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLS 231

Query: 282 DVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAG 341
            ++K +E+  +   ES  KK        ANLS G+ ++  ++ A+  A ++G+   +AAG
Sbjct: 232 TILKALEFTIRHCKESVDKK------CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAG 285

Query: 342 NEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSR 397
           N + DAC +SPA ++  ITVGA    DDR    A FSNWG+CVDVFAPG+ + S    + 
Sbjct: 286 NSNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHING 342

Query: 398 NATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD- 456
           +  L LSGTSMASP V+GI +  L           +   +P+ +K K+++ ST+ +    
Sbjct: 343 SDVLLLSGTSMASPSVSGIAAILL-----------DKGLNPKFVKSKIIESSTKNIFHQG 391

Query: 457 ---IGDDTPNKLIYNGGGKKLDGF 477
              I  +TPN +++NG  K  D F
Sbjct: 392 TIMIKPNTPNLIVFNGIEKMDDSF 415

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  199 bits (505), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 179/323 (55%), Gaps = 29/323 (8%)

Query: 169 NSSLQEEAPWGLHRVS-HREKP-------KYGQDLEYLYEDA-AGKGVTSYVLDTGIDTE 219
           N + Q +AP  L R+S H + P       +Y     Y YED   G+GV +Y++DTGI  E
Sbjct: 157 NVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAE 216

Query: 220 HEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGT 279
           H +FE R   G  +   +   D NGHGTH AG++GS+ FG AK   +V VKVL  +G G 
Sbjct: 217 HPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGE 275

Query: 280 VSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIA 339
            S+V+ G+E++ +   + S+ + K+     ANLSLGS +S  + MAV  A++ G+ F  A
Sbjct: 276 ASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 332

Query: 340 AGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398
           AGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I S    + N
Sbjct: 333 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNDN 392

Query: 399 ATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD-- 456
            +L LSGTSM++P V G+ +  LS               P+ + +++   ST+ V     
Sbjct: 393 ESLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPELIAQEIEYLSTRNVFHRRT 441

Query: 457 --IGDDTPNKLIYNGGGKKLDGF 477
                 TPN+++YNG  K  D +
Sbjct: 442 LFFKPSTPNQILYNGVDKLDDPY 464

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  197 bits (501), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 127/321 (39%), Positives = 180/321 (56%), Gaps = 37/321 (11%)

Query: 172 LQEEAPWGLHRVSHR------EKPKYGQDLEYLYEDA-AGKGVTSYVLDTGIDTEHEDFE 224
           +QE+AP  L R+S R      E+  + Q+  Y Y+    G  V +Y++DTGI  +H+D  
Sbjct: 110 VQEDAPRHLARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLG 169

Query: 225 GRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVI 284
           GRA +GA +   +   D NGHGTH AGI+GS+ FGVAK   +V VK L + G+G ++ VI
Sbjct: 170 GRAYFGADM-VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVI 228

Query: 285 KGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNED 344
             IE+ +  H + S           ANLSLGS ++  +  AV AAV+SG+   +AAGN +
Sbjct: 229 SSIEF-SVNHCKKSGML------CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSN 281

Query: 345 EDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNAT 400
            +AC +SPA A  +ITVGA    DDR    A FSNWG CVDVFA G+ +MS         
Sbjct: 282 VNACWNSPASAISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKP 338

Query: 401 LSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD---- 456
           ++ SGTSMASP VAG+ +  L           +    P ++K+K++  +T+ V       
Sbjct: 339 VAYSGTSMASPSVAGLAAVLL-----------DSGIDPPDIKQKIIDLATENVFQKRTLV 387

Query: 457 IGDDTPNKLIYNGGGKKLDGF 477
               TPN++ +NG  K+ D F
Sbjct: 388 FKPGTPNRIAFNGVRKEDDIF 408

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  196 bits (499), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 181/323 (56%), Gaps = 38/323 (11%)

Query: 172 LQEEAPWGLHRVSHREKPKYGQDLEYLYEDA---------AGKGVTSYVLDTGIDTEHED 222
           +Q EAP  L R+S R    Y  D E  YE++          G+ + +Y++DTGI  EH+D
Sbjct: 125 VQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKD 184

Query: 223 FEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSD 282
           F GRA +G      +   D NGHGTH AGI+GS +FGVAK   ++ VK L + G+G ++ 
Sbjct: 185 FCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTT 243

Query: 283 VIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGN 342
           VI  +E+    H +SS K     KG  ANLSLG+ ++  +  A+ AA ++G+   +AAGN
Sbjct: 244 VISAVEFAV-NHCKSSGK-----KGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGN 297

Query: 343 EDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRN 398
            + +AC +SPA A ++ITVGA    DDR    A FSNWG CVD+FA G+ + S      +
Sbjct: 298 SNINACWNSPASAPEAITVGA---FDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPH 354

Query: 399 ATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD-- 456
             ++ SGTSMASP V G+++  L           +    P+ +K K+++ +T  +L    
Sbjct: 355 KPIAFSGTSMASPSVTGLVAILL-----------DKGVEPENIKAKLVELATHDLLQRRT 403

Query: 457 --IGDDTPNKLIYNGGGKKLDGF 477
                 TPN++ +NG  ++ D +
Sbjct: 404 LFFKPGTPNRIAFNGMEREDDEY 426

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  196 bits (499), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 124/322 (38%), Positives = 178/322 (55%), Gaps = 39/322 (12%)

Query: 173 QEEAPWGLHRVSHREKPKY--------GQDLEYLYEDA-AGKGVTSYVLDTGIDTEHEDF 223
           Q++AP  L R+S R    Y          +  Y Y+D  +G  V +YV+DTGI  EH   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 224 EGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDV 283
           EGRA++GA +   +   D NGHGTH AG+IGS+ FGVAK+  ++ VK L + G+G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 284 IKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNE 343
           I  IE+ T  H   S+      +G  ANLSLGS ++  +  AV AA+++GV   +AAGN 
Sbjct: 254 ISAIEF-TVNHCRKSR------RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 344 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 399
           + +AC SSPA +  +ITVGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 400 TLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD--- 456
            ++ SGTSMASP V+G+++  L           +    P ++K +++  +T  V      
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL-----------DSGIHPFDIKTELIDLATDSVFHKRTL 412

Query: 457 -IGDDTPNKLIYNGGGKKLDGF 477
                TPN++ + G  K  D +
Sbjct: 413 LFKPGTPNRVAFTGIDKTDDVY 434

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  194 bits (492), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 177/323 (54%), Gaps = 29/323 (8%)

Query: 169 NSSLQEEAPWGLHRVSHR--------EKPKYGQDLEYLYE-DAAGKGVTSYVLDTGIDTE 219
           N + Q +AP  L R+S          +K +Y     Y YE D  G+ V +Y++DTGI  +
Sbjct: 121 NITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFAD 180

Query: 220 HEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGT 279
           H +FE R   G  +   +   D NGHGTH AG++GSK +G AK   +V VKVL  +G G 
Sbjct: 181 HPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGE 239

Query: 280 VSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIA 339
            S+V+ G+E++ +   + S+ + K+     ANLSLGS +S  + MAV  A++ G+ F  A
Sbjct: 240 ASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 296

Query: 340 AGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398
           AGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I S    + N
Sbjct: 297 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYN 356

Query: 399 ATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD-- 456
            TL LSGTSM++P V G+ +  LS               P+ + +++   ST+ V     
Sbjct: 357 DTLILSGTSMSTPIVTGVAAILLS-----------KGIEPEMIAQEIEYLSTRNVFHRRT 405

Query: 457 --IGDDTPNKLIYNGGGKKLDGF 477
                 TPN+++YNG  K  D +
Sbjct: 406 LFFKPSTPNQILYNGVDKLDDPY 428

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  194 bits (492), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 176/323 (54%), Gaps = 29/323 (8%)

Query: 169 NSSLQEEAPWGLHRVSH--------REKPKYGQDLEYLYED-AAGKGVTSYVLDTGIDTE 219
           N + Q +AP  L R+S          +K +Y     Y YED   G+ V +Y++DTGI  +
Sbjct: 121 NITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFAD 180

Query: 220 HEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGT 279
           H +FE R   G  +   +   D NGHGTH AG++GSK +G AK   +V VKVL  +G G 
Sbjct: 181 HPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGE 239

Query: 280 VSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIA 339
            S+V+ G+E++ +     S+ + K+     ANLSLGS +S  + MAV  A++ G+ F  A
Sbjct: 240 ASNVLSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 296

Query: 340 AGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398
           AGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I S    + N
Sbjct: 297 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFN 356

Query: 399 ATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD-- 456
            TL LSGTSM++P V G+ +  LS               P+ + +++   ST+ V     
Sbjct: 357 DTLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPEMIAQELEYLSTRNVFHRRT 405

Query: 457 --IGDDTPNKLIYNGGGKKLDGF 477
                 TPN+++YNG  K  D +
Sbjct: 406 LFFKPSTPNQILYNGVDKLDDRY 428

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  194 bits (492), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 180/318 (56%), Gaps = 37/318 (11%)

Query: 171 SLQEEAPWGLHRVSHR--------EKPKYGQDLEYLYEDA-AGKGVTSYVLDTGIDTEHE 221
           ++Q  AP  L R+S R         + ++ + + Y YED   G  + +Y+LDTGI  EH 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 222 DFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVS 281
           DFE R   GA +   +   D NGHGTH AGI+GSK FGVAKN  +V VKVL   G G ++
Sbjct: 212 DFENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 282 DVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAG 341
            V+ GI++   +H    ++   + K   AN+SLG+ ++  +  A++ A  +G+   +AAG
Sbjct: 271 TVLSGIQFAV-DHCRLMRE--TQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 342 NEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINI--MSTYIG 395
           N +  AC +SPA A+ +ITVGA    DDR    A+FSNWG CVD+FAPG+ I  +S    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 396 SRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLG 455
           S +  ++ SGTSMASP VAG+ +  L           +    P ++K+K+L  ST+ V  
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL-----------DKGVEPFDVKDKLLHLSTKDVFN 433

Query: 456 DI----GDDTPNKLIYNG 469
            +       TPNK+ YNG
Sbjct: 434 KLTLFFKYGTPNKIAYNG 451

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  189 bits (479), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 120/320 (37%), Positives = 173/320 (54%), Gaps = 33/320 (10%)

Query: 173 QEEAPWGLHRVSHR---------EKPKYGQDLEYLYEDA-AGKGVTSYVLDTGIDTEHED 222
           Q  AP  L R+S R         E   Y     Y Y++   G G+ +Y++DTGI  EH +
Sbjct: 114 QRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAE 173

Query: 223 FEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSD 282
           F GRA +G  +   +   D NGHGTH AGI+GS  +GVAK+  +V VK L + G+G ++ 
Sbjct: 174 FGGRAVFGEDL-TGEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTT 232

Query: 283 VIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGN 342
           VI  +E+    H  SS     E KG   NLSLG+ ++  +  AV AA ++G+   +AAGN
Sbjct: 233 VISAMEFAV-NHCRSS-----EGKGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGN 286

Query: 343 EDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATL 401
            + +ACL+SPA A ++ITVGA    +D  A FSNWG+CVD+FAPG+ + S         +
Sbjct: 287 SNINACLNSPASAPEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPI 346

Query: 402 SLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD----I 457
             SGTSMASP + G+ +  L           ++     ++K+ +LK +T  V        
Sbjct: 347 LFSGTSMASPSITGLAAILL-----------DEGVPYDKIKDYILKMATNDVFQRRTLVF 395

Query: 458 GDDTPNKLIYNGGGKKLDGF 477
              TPN++ +NG  K  D F
Sbjct: 396 KPGTPNRVAFNGVKKNDDKF 415

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  189 bits (480), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 172/322 (53%), Gaps = 38/322 (11%)

Query: 173 QEEAPWGLHRVSHR--------EKPKYGQDLEYLYED-AAGKGVTSYVLDTGIDTEHEDF 223
           Q  AP  L R+S R         K +Y     Y Y+  A G    +Y+LDTG+  +H++F
Sbjct: 111 QRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHKEF 170

Query: 224 EGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDV 283
           E R E+G       E  DLNGHGTH AG++GSK FGVAK+ ++V VK L + G GT+  +
Sbjct: 171 EDRVEFGTDCTGEGEG-DLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLVSI 229

Query: 284 IKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNE 343
           +  +E+  ++  E    +         N+SLGS KS  +  A+N     G+   +AAGN 
Sbjct: 230 LSALEFAVQDCQEHEDSQ------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNF 283

Query: 344 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 399
           + +AC +SP+ A  +ITVGA    DDR    A FSNWG CVD+FAPG+N+ S       +
Sbjct: 284 NMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPS 340

Query: 400 TLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD--- 456
            +  SGTSMASP V G+++  L           +D   P+++++ + + +T GV      
Sbjct: 341 FVKYSGTSMASPIVCGMVALLL-----------DDGVPPEDIRDYLQELATDGVFKKRTL 389

Query: 457 -IGDDTPNKLIYNGGGKKLDGF 477
                TPN ++YNG  K  D +
Sbjct: 390 VFKPGTPNSVLYNGNKKHDDEY 411

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  189 bits (479), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/336 (37%), Positives = 181/336 (53%), Gaps = 38/336 (11%)

Query: 159 VEQETTVKISNSSLQEEAPWGLHRVSHREK--------PKYGQDLEYLY-EDAAGKGVTS 209
           +  E T +  +  +Q EAP  L R+S R+K          Y +   Y Y ++  G  V +
Sbjct: 105 LNNEQTQEYVSHVVQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRA 164

Query: 210 YVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAV 269
           Y+LD+G+     DFEGR E+G     + E  D NGHGTH AG++GSK +GVAK   +V V
Sbjct: 165 YILDSGVSRNLTDFEGRVEFGFDFTGDGEG-DSNGHGTHVAGLVGSKTYGVAKGVTMVDV 223

Query: 270 KVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAA 329
           K L   G GT+  V+  IE+   +  E  +K+        ANLSLGS K+  +  A+ AA
Sbjct: 224 KCLDEIGFGTLITVLSAIEFAVNDCHEHPEKR------CVANLSLGSFKNAIINKAIQAA 277

Query: 330 VDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAP 385
            + GV   +AAGN + +AC +SPA AE++ITVGA    DDR    A FSNWG CVD++AP
Sbjct: 278 TEDGVVMVVAAGNFNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAP 334

Query: 386 GINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKV 445
           G+ + S         +S SGTSMASP V G ++  L      D    ND     ++K  +
Sbjct: 335 GVAVESLANFPMVKNISYSGTSMASPIVCGQVAILL------DKGIPND-----DIKSTL 383

Query: 446 LKFSTQGVLGD----IGDDTPNKLIYNGGGKKLDGF 477
           +K +T  V          +TPN++++NG  K+ D +
Sbjct: 384 IKMATDDVFQKRTLLFKPNTPNRVLFNGIEKEDDQY 419

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  192 bits (489), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 172/319 (53%), Gaps = 37/319 (11%)

Query: 168 SNSSLQEEAPWGLHRVSHREK--------PKYGQDLEYLYEDA-AGKGVTSYVLDTGIDT 218
           S   +Q  AP  L R+S R+K         ++ + L Y Y+D   G+GV +YV+DTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 219 EHEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEG 278
           EH+DFE R E+G  +   + A DLNGHGTH AG+IGSK +GV K  KI+ VK +   G  
Sbjct: 342 EHKDFEDRVEFGTDLTG-EGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 279 TVSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAI 338
            +S +I+ IEY   +      K     K    N+SLGS     +  AV +A+  GV F +
Sbjct: 401 QLSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAEGVVFVV 455

Query: 339 AAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYI 394
           AAGN + DAC SSP  ++ +ITVGA    DDR    A FSNWG CVD+FA G+ + S   
Sbjct: 456 AAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSS 512

Query: 395 GSRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVL 454
                 +  SGTSMASP V G +S  LS               P +++E+++K ST+G  
Sbjct: 513 QVPYKYIKYSGTSMASPIVCGFVSILLS-----------QGVKPNDVQEEMVKLSTKGDF 561

Query: 455 GD----IGDDTPNKLIYNG 469
                     T N++++NG
Sbjct: 562 TRRSLIFKPFTSNRILFNG 580

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  187 bits (476), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 175/321 (54%), Gaps = 25/321 (7%)

Query: 169 NSSLQEEAPWGLHRVSH--------REKPKYGQDLEYLYED-AAGKGVTSYVLDTGIDTE 219
           N + Q +AP  L R+S          +K +Y     Y YED   G+ V +Y++DTGI ++
Sbjct: 170 NITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSD 229

Query: 220 HEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGT 279
           H +FE R   G  +   +   D NGHGTH AG++GSK +G AK   +V VKVL  +G G 
Sbjct: 230 HPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGE 288

Query: 280 VSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIA 339
            S+V+ G+E++ +     S+ + K+     ANLSLGS +S  + MAV  A++ G+ F  A
Sbjct: 289 ASNVLSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 345

Query: 340 AGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 398
           AGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I S    +  
Sbjct: 346 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYE 405

Query: 399 ATLSLSGTSMASPHVAGILSYFLS--LQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD 456
            TL LSGTSM++P V G+ +  LS  ++PA  ++      +      + L F        
Sbjct: 406 DTLILSGTSMSTPIVTGVAAVLLSKGIEPALIAQEIEYLSTRNVFHRRTLFFKPS----- 460

Query: 457 IGDDTPNKLIYNGGGKKLDGF 477
               T N+++YNG  K  D +
Sbjct: 461 ----TANQILYNGVDKLDDPY 477

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  186 bits (472), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 134/322 (41%), Positives = 183/322 (56%), Gaps = 41/322 (12%)

Query: 173 QEEAPWGLHRVSHR------EKPKYGQDLEYLY-EDAAGKGVTSYVLDTGIDTEHEDFEG 225
           Q  AP  L R+S R      EK      L+Y Y E+  G+GV  YVLD+G++ +H DFEG
Sbjct: 154 QSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFEG 213

Query: 226 RAEWGAVIPANDEAS-DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVI 284
           RA  G  I    E S DL GHGTH AG+IGSK +GVAK   IV VKVL S G+GTV+++I
Sbjct: 214 RAMKG--IDTTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNII 271

Query: 285 KGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLA-MEMAVNAAVDSGVHFAIAAGNE 343
           +G+EYV  + I   +K          N+SLG+  + + ++ AV+A ++ GV   +A GN 
Sbjct: 272 EGLEYVVNQCIGKKRK-------CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNS 324

Query: 344 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 399
             +AC  SPA   K+ITV A    DDR    A FSNWG C+D++APG+N+ S     R  
Sbjct: 325 GLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLSNKGR-G 380

Query: 400 TLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD--- 456
           T  LSGTSMASP VAG  + +L           +    P E+++ + K +T+GV      
Sbjct: 381 TFVLSGTSMASPIVAGAAAIYL-----------DQGADPAEVRKILSKTATRGVFKKRAI 429

Query: 457 -IGDDTPNKLIYNGGGKKLDGF 477
            +   TPNK++Y G  ++ D F
Sbjct: 430 AVRPRTPNKVLYTGNNQEDDEF 451

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  183 bits (465), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/321 (39%), Positives = 173/321 (53%), Gaps = 34/321 (10%)

Query: 172 LQEEAPWGLHRVSHR--------EKPKYGQDLEYLYED-AAGKGVTSYVLDTGIDTEHED 222
           +Q  AP  L R+S R        +K  Y   L Y Y     G  V +Y++D+GID   E+
Sbjct: 128 VQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDINQEE 187

Query: 223 FEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSD 282
           FEGRA  G  +   +   D NGHGTH AG++GSK +GVAKN  +V VK L   G G++  
Sbjct: 188 FEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSGSLIT 246

Query: 283 VIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGN 342
           VI  +E+V     +S  KK        ANLSLG+     +  A+ A VDSGV   +AAGN
Sbjct: 247 VISALEFVVNHCGKSKSKK------CVANLSLGAFMMPLLNEAIKATVDSGVVVVVAAGN 300

Query: 343 EDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRN 398
            + DAC  SPA  + +ITVGA    DDR    A FSNWG+CVD+FAPG+ I S  I    
Sbjct: 301 GNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAPGVAISSLSIKDNQ 357

Query: 399 ATLSLSGTSMASPHVAGILSYFLS--LQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD 456
            ++  SGTSMASP VAGI+S  L   ++     ++  +  +    +++ L F  +     
Sbjct: 358 KSVEFSGTSMASPQVAGIVSILLDQGVENEDIRDYLFELATDDVFQKRTLLFKPR----- 412

Query: 457 IGDDTPNKLIYNGGGKKLDGF 477
               TPN++ +NG  KK + F
Sbjct: 413 ----TPNRITFNGISKKDEDF 429

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  183 bits (465), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 181/322 (56%), Gaps = 39/322 (12%)

Query: 173 QEEAPWGLHRVSHREKPKYG--------QDLEYLYEDA-AGKGVTSYVLDTGIDTEHEDF 223
           Q+ AP  L R+S R    Y          +  Y Y+D+  G  V +YV+DTGI  EH  F
Sbjct: 133 QKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQF 192

Query: 224 EGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDV 283
           +GRA++GA +   +   DLNGHGTH AG+IGS+ +GVAK+  ++ VK L + G+G ++ V
Sbjct: 193 QGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSV 251

Query: 284 IKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNE 343
           I  IE+ T  H   SK      +G  ANLSLGS ++  +  AV AA+++GV   +AAGN 
Sbjct: 252 ISAIEF-TVNHCRKSK------RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNS 304

Query: 344 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 399
           + +AC SSPA +  +I+VGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 305 NANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFK 361

Query: 400 TLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD--- 456
           +++ SGTSMASP V G+++  L           +    P ++KE+++  +T  V      
Sbjct: 362 SVAYSGTSMASPLVTGMVAVLL-----------DSGIHPFDIKEELINTATDSVFHKRAL 410

Query: 457 -IGDDTPNKLIYNGGGKKLDGF 477
                TPN++ + G  K+ D F
Sbjct: 411 LFKPGTPNRVAFTGVEKEDDIF 432

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  187 bits (476), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 178/320 (55%), Gaps = 32/320 (10%)

Query: 171 SLQEEAPWGLHRVSHREKPKYGQ--DLEYLY-----EDAAGKGVTSYVLDTGIDTEHEDF 223
           ++Q +AP  L R   R    +    D EY +     E+  G+GV  YVLD+GI   H +F
Sbjct: 426 AIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEF 485

Query: 224 EGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDV 283
           +GRA +G +    +   DLNGHGTH AG++GS+ FG+AK   I  +KV+  +G G+ S++
Sbjct: 486 DGRAHFG-IDTTKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNI 544

Query: 284 IKGIEYVTKEHIESSKKKNKEFKGSTANLSLG--SSKSLAMEMAVNAAVDSGVHFAIAAG 341
           I G+E+  K H + S K+        AN+SLG  S    A++ AV AA++ G+ F +AAG
Sbjct: 545 IAGVEFAVK-HCQQSGKR------CVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAG 597

Query: 342 NEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNAT 400
           N  E AC  SPA  + +ITVGA    SD  A FSN+G CVD+FAPG+ + S      N  
Sbjct: 598 NSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTM 657

Query: 401 LSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD---I 457
             L+GTSM++P  AG+++  L           +    P E+K+ +L  ST+G+      +
Sbjct: 658 RVLNGTSMSAPITAGVVAVLL-----------DQGIEPHEVKDHLLSISTKGLFHKRRLV 706

Query: 458 GDDTPNKLIYNGGGKKLDGF 477
              TP++ ++ G  ++ D F
Sbjct: 707 SSRTPDRALFTGVKREDDSF 726

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  182 bits (463), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 119/338 (35%), Positives = 170/338 (50%), Gaps = 45/338 (13%)

Query: 173 QEEAPWGLHRVSHREK--------PKYGQDLEYLYED-AAGKGVTSYVLDTGIDTEHEDF 223
           Q EAP  L R+S R +         +Y  D  Y Y     G+ V +YVLD+G+  +H DF
Sbjct: 160 QSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCDF 219

Query: 224 EGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDV 283
           EGRA +GA    +  + D NGHGTH AG+IGSK +GV+K   I+ VKVL S G GT+  V
Sbjct: 220 EGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDTV 279

Query: 284 IKGIEYVTKEH------------------IESSKKKNKEFKGSTANLSLGSSKSLAMEMA 325
           + G+E+V+                      E S   + E K    NLSLG+ +S  +  A
Sbjct: 280 MSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINEA 339

Query: 326 VNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVD 381
           +   +  G+   +AAGN + +AC +SPA     ITVGA    DDR    A FSNWG CVD
Sbjct: 340 IEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCVD 396

Query: 382 VFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLS--LQPAPDSEFFNDAPSPQ 439
           +FAPG+ + S         +  +GTSMA+P V G+++  L   ++P    +  N+  +  
Sbjct: 397 IFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLDSGIKPTQIKKRLNELATDN 456

Query: 440 ELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGF 477
               + L F            TPN++ +NG  +  D +
Sbjct: 457 IFPRRTLLFKP---------GTPNRIAFNGVKRDDDDY 485

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  184 bits (467), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 179/320 (55%), Gaps = 32/320 (10%)

Query: 171 SLQEEAPWGLHRVSHREKPKY----GQDLEY-LYEDAA--GKGVTSYVLDTGIDTEHEDF 223
           ++Q  AP  L R   R    +     +D E+  Y DA   G+ V  Y+LD+GI   H +F
Sbjct: 268 AMQSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEF 327

Query: 224 EGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDV 283
           EGRA +G +   N+   DLNGHGTH AG++GSK +G AK   I  VKV+  +G G+ S++
Sbjct: 328 EGRAVFG-IDTTNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNI 386

Query: 284 IKGIEYVTKEHIESSKKKNKEFKGSTANLSLG--SSKSLAMEMAVNAAVDSGVHFAIAAG 341
           I G+E+  K H + S KK        AN+SLG  S    A++ AV AA++ G+ F +AAG
Sbjct: 387 IAGVEFAVK-HCQQSGKK------CVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAG 439

Query: 342 NEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNAT 400
           N  E AC  SPA  + +ITVGA    SD  A FSN+G CVD+FAPG+ + S      N  
Sbjct: 440 NSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTV 499

Query: 401 LSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGD---I 457
             L+GTSM++P  AG+++  L           +     +++KE+++  ST+GV      +
Sbjct: 500 RVLNGTSMSAPITAGVVAVLL-----------DQGVKHEDVKERLIDLSTKGVFHRRRLV 548

Query: 458 GDDTPNKLIYNGGGKKLDGF 477
              TP++ ++NG  ++ D F
Sbjct: 549 SSRTPDRTLFNGVPQEDDVF 568

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  169 bits (428), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 169/316 (53%), Gaps = 37/316 (11%)

Query: 172 LQEEAPWGLHRVSHREKPKYG-------QDLEYLYEDAAGKGVTS--YVLDTGIDTEHED 222
           +Q  AP  L ++S R +  Y        ++  + Y D   +G  S  Y++DTG+  EH++
Sbjct: 149 IQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKE 208

Query: 223 FEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSD 282
           F  R  +G       +  D NGHGTH AG+IGSK FGVAKN  +  VKVL   G G ++ 
Sbjct: 209 FGNRVHFGGDFIGEGKG-DYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTS 267

Query: 283 VIKGIEYVTKEHIESSKKKNKEF-KGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAG 341
           V++GIE+     + + K K +   K    N+SLG+ ++  +  A+  A  SG+   +AAG
Sbjct: 268 VLEGIEFA----VNNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 342 NEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSR 397
           N +  AC +SPA +  +ITVGA    DDR    A FSNWG CVD+FAPG+ I S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 398 NATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDI 457
              +  SGTSMASP VAG+++  +      D           E+K+K++  S++ +   +
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILMEKGYKCD-----------EIKQKLIDDSSKSIFSKL 429

Query: 458 ----GDDTPNKLIYNG 469
                  TPN++IYNG
Sbjct: 430 TLFFKYGTPNRVIYNG 445

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  151 bits (382), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 97/260 (37%), Positives = 139/260 (53%), Gaps = 19/260 (7%)

Query: 171 SLQEEAPWGLHRVSHREKPKYGQDLEYLY---EDAAGKGVTSYVLDTGIDTEHEDFEGRA 227
           S Q  AP  L R S   K     +  Y Y    D  G  VT YVLD+GI  +H +FEGR 
Sbjct: 143 STQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR- 201

Query: 228 EWGAVIPAND----EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDV 283
               ++ A D       D  GHGT  AGIIGSK +GVAKN  ++ +KVL + G+G V  +
Sbjct: 202 ----ILEAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSI 257

Query: 284 IKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNE 343
           ++G++++TK H E +   N        N SLG+     +  A     ++G+    AAGN 
Sbjct: 258 LQGLQFITK-HCEENTNGN-----CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNN 311

Query: 344 DEDACLSSPAGAEKSITVGASTFSDDR-AFFSNWGTCVDVFAPGINIMSTYIGSRNATLS 402
             +AC  +PAG++   TVG+    DD  A FSNWG CVD+ APG+ + +    ++  +  
Sbjct: 312 AVNACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRE 371

Query: 403 LSGTSMASPHVAGILSYFLS 422
            SGTS+++P V G+ +  LS
Sbjct: 372 SSGTSVSTPIVTGLAAILLS 391

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  147 bits (371), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/256 (35%), Positives = 142/256 (55%), Gaps = 12/256 (4%)

Query: 172 LQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGA 231
           +QE AP  L R+S +   + G D  Y+Y    G GV  Y+LDTGID  H + EGR +  A
Sbjct: 92  VQEHAPAHLARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIA 150

Query: 232 VIPANDEA-SDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYV 290
            + +N  +  D +GHGT  AG+IGS  FG AK   +  V+V  S G  T+  VI+ +E+ 
Sbjct: 151 DLTSNPVSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEH- 209

Query: 291 TKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAV-DSGVHFAIAAGNEDEDACL 349
                 +SK  +   + S   +     K++ +  A+ A + D  +   +A GN +++AC 
Sbjct: 210 ------ASKLASVTQRPSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACD 263

Query: 350 SSPAGAEKSITVGA--STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTS 407
           SSPA A  ++T+G+   T  D  A F+N+G C+D FA G+NI S   G   +    SGTS
Sbjct: 264 SSPASAYGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTS 323

Query: 408 MASPHVAGILSYFLSL 423
           +++   +G+++Y++SL
Sbjct: 324 ISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  137 bits (344), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/296 (31%), Positives = 156/296 (52%), Gaps = 15/296 (5%)

Query: 135 FRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVSHREKPKYGQD 194
           FR   G F  +             +  +  + ++   +Q+ AP  L R+S +   + G  
Sbjct: 55  FRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNG 114

Query: 195 LE---YLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS-DLNGHGTHCA 250
            +   Y+Y   AG GV  Y+LDTGID  H  FEGR +  A   ++  A+ D +GHGT  A
Sbjct: 115 SDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVA 174

Query: 251 GIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTA 310
           G+IGS  FGVAK   +  V+V  S G  ++  V++ +E+ +K  + +  K+      S  
Sbjct: 175 GVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASK--LAAVTKRP-----SLI 227

Query: 311 NLSLGSSKSLAMEMAVNAAV-DSGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFS-- 367
            + L   ++  +  AV A V D  +   +AAGNE+  AC  SPAGA  ++T+G+   +  
Sbjct: 228 TIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARN 287

Query: 368 DDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423
           D  A F+N+  CVD+F  G+++ +  +   ++   LSGTS+++   +G+++Y++S+
Sbjct: 288 DALAPFTNFAECVDLFTAGVDVATLGL-DHSSEHHLSGTSISAGVASGLVAYYMSI 342

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 104/344 (30%), Positives = 162/344 (47%), Gaps = 33/344 (9%)

Query: 99  VGKLTENDAFWRVIXXXXXXXXQFGG-IDNFFDINGLFRGYTGYFTDEXXXXXXXXXXXK 157
           V +L +  A   V+        Q G  I + F++ G FR +TG F+              
Sbjct: 18  VVQLQDKTALNAVLNSYALSSDQQGPEITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVL 76

Query: 158 FVEQETTVKISNSSLQEEAP---WGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDT 214
            + ++ ++K+    LQ  AP    GL  +S    P   Q   ++Y    G GV  Y+LDT
Sbjct: 77  AISRDGSLKLQEIVLQNNAPSHLVGLSSIS----PLSHQ--PFIYRSNGGNGVDVYLLDT 130

Query: 215 GIDTEHEDFEG----RAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVK 270
           GID +H +       R       P   + +D  GHGT  AGII S+ FGV K   +V V+
Sbjct: 131 GIDIKHPNLSKLNILRMADLTQSPV-PQGTDPQGHGTAMAGIIASETFGVLKKCNLVDVR 189

Query: 271 VLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAV 330
           V  SNG+  +S +++ +  +T+ HIE +K+ +         L +    +  +  A+ A+ 
Sbjct: 190 VADSNGDVKLSTILQALT-LTQRHIEGTKRPSV----VVIPLEVEDGNNPILTEAI-ASF 243

Query: 331 DSGVHFAIAAGNEDEDACLSSPAGAEKS----ITVGASTFSDDRAFFSNWGTCVDVFAPG 386
           D  V   I AGN  +DA   SPA         I VG+   +++   F+N+G+ VDVF  G
Sbjct: 244 DQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVG 303

Query: 387 ---INIMSTYIGSRNATLSL----SGTSMASPHVAGILSYFLSL 423
                + ST + S+  + SL    SGTS +S   AG++ Y++SL
Sbjct: 304 EQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  114 bits (286), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 154/312 (49%), Gaps = 27/312 (8%)

Query: 129 FDINGLFRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVSHREK 188
            +I   F  ++G  + E             +  E  +++     Q +AP  L R++ ++ 
Sbjct: 53  IEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDS 111

Query: 189 PKYGQ----DLEYLYEDAAGKGVTSYVLDTGIDTEHEDF--EGRAEWGAVIPANDEASDL 242
            K  Q    + +Y++ D +G GV  Y++DTGID +H  +      +   +  +   + D 
Sbjct: 112 IKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSGDF 171

Query: 243 NGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGE-GTVSDVIKGIEYVTKEHIESSKKK 301
           NGHGT  AGII S  FGV K+  +V V+V+ +N +  T+S V+  +  + K        +
Sbjct: 172 NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSLIEKH-------E 224

Query: 302 NKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEK---S 358
            K  + S   L   + K+  +E A+   +   +   I AGN+ ++AC  SP G +K    
Sbjct: 225 QKTMRPSIIVLPFQTEKNTILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLSNV 283

Query: 359 ITVGASTFSD-----DRAFFSNWGTCVDVFAPGINIMSTYI---GSRNATLSLSGTSMAS 410
           + VG+  +S+     D A FSN+G+CVD++  G++I +      G +    +++GTS + 
Sbjct: 284 LVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSYSC 343

Query: 411 PHVAGILSYFLS 422
             VAG++ Y++S
Sbjct: 344 GIVAGVVGYYMS 355

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  110 bits (276), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 143/304 (47%), Gaps = 24/304 (7%)

Query: 135 FRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVSH---REKPKY 191
           F G++G F DE             +  +  + +     Q +AP  L R+S+     +   
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 192 GQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDE---ASDLNGHGTH 248
             +  +++   AG GV  Y++D+GID++H  F  R     +I   D      D +GHGT 
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHGHGTA 179

Query: 249 CAGIIGSKHFGVAKNTKIVAVKVLRSNGEGT-VSDVIKGIEYVTKEHIESSKKKNKEFKG 307
            AG++ S  FGV K   +  V+V+ +   G  +S ++K +E++               + 
Sbjct: 180 IAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIENH-------SRATMRP 232

Query: 308 STANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKS---ITVGAS 364
           S A L    SK+  +  A+ +  +S +   + AGN+   AC  SPA A  S   ++VG+ 
Sbjct: 233 SVAVLPFSMSKNAILNSAIESMPNS-IAIVVPAGNQHHMACNFSPASARNSQSILSVGSL 291

Query: 365 TF--SDDRAFFSNWGTCVDVFAPGIN---IMSTYIGSRNATLSLSGTSMASPHVAGILSY 419
            +  S + A FSN+G CVDVF  G+    + +T     N    +SGTSM+    AG + Y
Sbjct: 292 DYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGY 351

Query: 420 FLSL 423
           ++SL
Sbjct: 352 YMSL 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 141/282 (50%), Gaps = 45/282 (15%)

Query: 172 LQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGID--------TEHEDF 223
           +Q++AP  L ++   E      D E++Y+  AG GV  Y+ DTGI         +   D 
Sbjct: 96  VQKDAPRHLTKLLETE----AGDNEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDM 151

Query: 224 EGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDV 283
            G        P  D+  ++  HGT  +G+IGS  FGV K   ++ V V   NG+  +S V
Sbjct: 152 PGMPGP----PIRDQ--EILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKV 205

Query: 284 IKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDS---GVHFAIAA 340
           +KG+  V ++H++ + +       S  N S  + K+  +    N+A D+    V  A+AA
Sbjct: 206 LKGLNLV-QQHVKHTNRP------SVINFSYCTLKNAIL----NSAFDNFPRDVPIAVAA 254

Query: 341 GNEDEDACLSSPAGAEKS---ITVGASTFSDD---RAFFSNWGTCVDVFAPGINIMSTYI 394
           GN  +  C  SP G +++   +  G+   +DD    + FSN+G+CV  +APG  +++  I
Sbjct: 255 GNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGI 314

Query: 395 ------GSRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSE 430
                  SR+  + +SGTS +S   AG++ Y+++ Q  P  E
Sbjct: 315 PDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA-QGIPGEE 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 93.6 bits (231), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 136/298 (45%), Gaps = 27/298 (9%)

Query: 135 FRGYTGYFTDEXXXXXXXXXXXKFVEQETTVKISNSSLQEEAPWGLHRVSHREKPKYGQD 194
           F+   G F+ E             + ++  +K+    +Q  +P  L ++S          
Sbjct: 53  FKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSGG------- 105

Query: 195 LEYLYEDAAGKGVTSYVLDTGIDTEHEDFEG-----RAEW-GAVIPANDEASDLNGHGTH 248
             + ++  +G  V  YV DTGID +H   +       A++  + +P     +D +GHGT 
Sbjct: 106 -SFTFDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTM 161

Query: 249 CAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGS 308
            AG+I S+ FGV K+  +V V+V   +GE  +S ++KGI   +  H   +K+       S
Sbjct: 162 MAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRP------S 214

Query: 309 TANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSD 368
              L +   K   +      A+   +   + AGN+  DAC  SP      + +G+    +
Sbjct: 215 VFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDN 274

Query: 369 DRAFFSNWGTCVDVFAPGINIM---STYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423
             A FSN+G CVDV+  G +I+   ST  G+     S +GTS +    AGI+ Y +S+
Sbjct: 275 RLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 108/276 (39%), Gaps = 38/276 (13%)

Query: 180 LHRVSHREKPKY-GQDLEYL---YEDAAGKGVTSYVLDTGIDTEHED----FEGRAEWGA 231
             R  H   P + G D+  L   Y +  G GV + ++D G+D E+ED    F     W  
Sbjct: 138 FERQWHLVNPSFPGSDINVLDVWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDF 197

Query: 232 VIPANDEASDL--NGHGTHCAGIIGSKH------FGVAKNTKIVAVKVLRSNGEGTVSDV 283
               N     L  + HGT CAG I +K        GV  N KI  +++L  +GE T  D 
Sbjct: 198 NDNTNLPKPRLLDDYHGTRCAGEIAAKKGNNFCGIGVGYNAKISGIRIL--SGELTTEDE 255

Query: 284 IKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVD----SGVHFAIA 339
              + Y     ++++   +  +  +     L     L  +  V    +     G  +  A
Sbjct: 256 AASLIY----GLDTNDIYSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFA 311

Query: 340 AGN---EDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFA------PGINIM 390
           +GN     ++        +  SIT+GA    D    +S    C  V A       G  I 
Sbjct: 312 SGNGGAHGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIH 369

Query: 391 STYIGSRNATLSLSGTSMASPHVAGILSYFLSLQPA 426
           S+ I  R +  S  GTS A+P  AG+ +  L   P+
Sbjct: 370 SSDINGRCSN-SHGGTSAAAPLAAGVYTLLLEANPS 404

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 98/250 (39%), Gaps = 30/250 (12%)

Query: 199 YEDAAGKGVTSYVLDTGIDTEHED----FEGRAEW----GAVIPANDEASDLNGHGTHCA 250
           YE+  G+G+   ++D G+D E+ D    F     W       +P    A D   HGT CA
Sbjct: 175 YENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDY--HGTRCA 232

Query: 251 GIIGSKH------FGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKE 304
           G I +         GVA N K+  +++L  +GE T  D    + +    +   S     +
Sbjct: 233 GEIAATKDNGFCGIGVAYNAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSWGPK 290

Query: 305 FKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDE--DAC-LSSPAGAEKSITV 361
             G+         K   +    +     G  +  A+GN     D C       +  SIT+
Sbjct: 291 DDGTHLQGPTDLVKKAMIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYDGYTNSIYSITI 350

Query: 362 GASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMASPHVAG 415
           GA         +S   +C  V A       G  I ST IG++  +    GTS A+P  AG
Sbjct: 351 GALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIGNK-CSDHHGGTSAAAPLAAG 407

Query: 416 ILSYFLSLQP 425
           I S  L + P
Sbjct: 408 IFSLVLQVNP 417

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 112/278 (40%), Gaps = 42/278 (15%)

Query: 180 LHRVSHREKPKY-GQDL---EYLYEDAAGKGVTSYVLDTGIDTEHED----FEGRAEW-- 229
             R  H   P + G D+   +  Y +  G GV + ++D G+D E+ED    F     W  
Sbjct: 138 FERQWHLINPSFPGSDINVVDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDF 197

Query: 230 --GAVIPANDEASDLNGHGTHCAGIIGSKH------FGVAKNTKIVAVKVLRSNGEGTVS 281
                +P    + D   HGT CAG I +K        GV  N KI  +++L  +GE T  
Sbjct: 198 NDNTNLPKPRLSDDY--HGTRCAGEIAAKKGNDFCGVGVGYNAKISGIRIL--SGEITTE 253

Query: 282 DVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSL---AMEMAVNAAVDS-GVHFA 337
           D    + Y     ++++   +  +  +     L     L   A+   V    DS G  + 
Sbjct: 254 DEAASLIY----GLDTNDIYSCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYV 309

Query: 338 IAAGN---EDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFA------PGIN 388
            A+GN     ++        +  SIT+GA    D    +S   +C  V A       G  
Sbjct: 310 FASGNGGARGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEY 367

Query: 389 IMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQPA 426
           I S+ I  +  + S  GTS A+P  AG+ +  L   P+
Sbjct: 368 IHSSDINGK-CSDSHGGTSAAAPLAAGVYTLLLEANPS 404

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 100/251 (39%), Gaps = 33/251 (13%)

Query: 199 YEDAAGKGVTSYVLDTGIDTEHED----FEGRAEW----GAVIPANDEASDLNGHGTHCA 250
           YE+  G  V   V+D G+D E ED    F     W       +P    + D   HGT CA
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDY--HGTRCA 213

Query: 251 GII--GSKHF---GVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEF 305
           G I  G   F   GVA N K+  +++L  + E T  D    + +     ++ +   +  +
Sbjct: 214 GEIAAGKNQFCGVGVAYNAKVAGLRIL--SAEVTSEDEAASLIHA----LDVNDIYSCSW 267

Query: 306 KGSTANLSLGSSKSLAMEMAVNAAV----DSGVHFAIAAGNE---DEDACLSSPAGAEKS 358
             S    SL     L  +  V   +    + G  +  A+GN    D++        +  S
Sbjct: 268 GPSDDGRSLQGPDDLVKKALVTGVLKGRDEKGALYVFASGNGGMFDDNCNYDGYTNSIYS 327

Query: 359 ITVGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMASPHVA 414
           ITVGA         +S   + V V       G +I ST I  R  + +  GTS A+P  A
Sbjct: 328 ITVGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGR-CSDTHGGTSAAAPLAA 386

Query: 415 GILSYFLSLQP 425
           G+ S  L   P
Sbjct: 387 GVYSLVLEANP 397

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 106/276 (38%), Gaps = 40/276 (14%)

Query: 180 LHRVSHREKPKY-GQDLEYL---YEDAAGKGVTSYVLDTGIDTEHED----FEGRAEW-- 229
             R  H   P + G D+  L   Y +  G GV + ++D G+D E+ED    F     W  
Sbjct: 138 FERQWHLVNPSFPGSDINVLDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDF 197

Query: 230 --GAVIPANDEASDLNGHGTHCAGIIGSKH------FGVAKNTKIVAVKVLRSN--GEGT 279
                +P    + D   HGT CAG I +K        GV  N KI  +++L  +   E  
Sbjct: 198 NDNTNLPKPRLSDDY--HGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDE 255

Query: 280 VSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDS-GVHFAI 338
            + +I G++             +       ++L        A+   V    DS G  +  
Sbjct: 256 AASLIYGLDVNDIYSCSWGPADDGRHLQGPSDLV-----KKALVKGVTEGRDSKGAIYVF 310

Query: 339 AAGN---EDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFA------PGINI 389
           A+GN     ++        +  SIT+GA    D    +S    C  V A       G  I
Sbjct: 311 ASGNGGTRGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYI 368

Query: 390 MSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQP 425
            S+ I  R +  S  GTS A+P  AG+ +  L   P
Sbjct: 369 HSSDINGRCSN-SHGGTSAAAPLAAGVYTLLLEANP 403

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 111/278 (39%), Gaps = 42/278 (15%)

Query: 180 LHRVSHREKPKY-GQDLEYL---YEDAAGKGVTSYVLDTGIDTEHED----FEGRAEW-- 229
             R  H   P + G D+  L   Y +  G GV + ++D G+D E+ED    F     W  
Sbjct: 138 FERQWHLVNPSFPGNDMNVLKLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDF 197

Query: 230 --GAVIPANDEASDLNGHGTHCAGIIGSKH------FGVAKNTKIVAVKVLRSNGEGTVS 281
                +P    + D   HGT CAG I +K        GV  N KI  +++L  +G+ T  
Sbjct: 198 NDNTNLPKPRLSDDY--HGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTE 253

Query: 282 DVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSL---AMEMAVNAAVDS-GVHFA 337
           D    + Y     ++++   +  +  +     L     L   A+   V    DS G  + 
Sbjct: 254 DEAASLIY----GLDTNDIYSCSWGPADDGRHLQGPNDLVKKALVKGVTQGRDSKGAIYV 309

Query: 338 IAAGN---EDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDV--FAPGINIMST 392
            A+GN     ++        +  SIT+GA    D    +S   + V V  ++ G      
Sbjct: 310 FASGNGGARGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSG---SGE 366

Query: 393 YIGSRNATLSLS----GTSMASPHVAGILSYFLSLQPA 426
           YI S +     S    GTS A+P  AG+ +  L   P+
Sbjct: 367 YIHSSDINGGCSNTHGGTSAAAPLAAGVYTLLLEANPS 404

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 98/253 (38%), Gaps = 37/253 (14%)

Query: 199 YEDAAGKGVTSYVLDTGIDTEHEDF------EGRAEWGAVIPANDEASDLNGHGTHCAGI 252
           YE+  G GV + ++D G+D E+ D       EG  ++    P        + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 253 IGSKH-----FGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKG 307
           I +        GVA N K+  +++L  +GE T  D    + Y            N  +  
Sbjct: 245 IAAVKNDACGVGVAYNAKVAGIRIL--SGEITSEDEAASLVY--------GLGVNDIYSC 294

Query: 308 STANLSLGSSKSLAMEMAVNAAV--------DSGVHFAIAAGN---EDEDACLSSPAGAE 356
           S      G       E+   A V        + G  +  A+GN    D++        + 
Sbjct: 295 SWGPADDGRQMQAPDELVKKAIVKGVLEGRDEKGALYVFASGNGGLYDDNCNYDGYTNSI 354

Query: 357 KSITVGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMASPH 412
            SITVGA         ++   + V V       G +I ST + ++  +    GTS A+P 
Sbjct: 355 YSITVGAIDHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTDVNNQ-CSHRHGGTSAAAPL 413

Query: 413 VAGILSYFLSLQP 425
            AGI S  L   P
Sbjct: 414 AAGIYSLVLEANP 426

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 100/248 (40%), Gaps = 26/248 (10%)

Query: 199 YEDAAGKGVTSYVLDTGIDTEHEDF------EGRAEWGA--VIPANDEASDLNGHGTHCA 250
           Y++  GKGV + V+D G+D E+ D       EG  ++ A   +P    A D   HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDY--HGTRCA 209

Query: 251 GIIGSKH------FGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKE 304
           G I +         GVA + K+  +++L  +GE T  D    +      +   S     +
Sbjct: 210 GEIAAVKNNGICGIGVAYDAKVAGIRIL--SGEITAEDEAAALINALDINDIYSCSWGPQ 267

Query: 305 FKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDE--DAC-LSSPAGAEKSITV 361
             G+         K   ++   +   + G  +  A+GN     D C       +  SITV
Sbjct: 268 DDGTHLQGPSDLVKKALIKGVNDGRKNKGAIYVFASGNGGSFGDNCNYDGYTNSIYSITV 327

Query: 362 GASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMASPHVAGIL 417
           GA    D    +S   + V V       G  I +T I ++       GTS A+P  AGI 
Sbjct: 328 GAIDHKDLHPPYSESCSAVMVVTYSSGSGEYIHTTDINNK-CNDRHGGTSAAAPLAAGIY 386

Query: 418 SYFLSLQP 425
           +  L   P
Sbjct: 387 TLLLQANP 394

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 97/257 (37%), Gaps = 45/257 (17%)

Query: 199 YEDAAGKGVTSYVLDTGIDTEHED----FEGRAEW----GAVIPANDEASDLNGHGTHCA 250
           YE+  G  V   V+D G+D E ED    F     W       +P    + D   HGT CA
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDY--HGTRCA 212

Query: 251 GIIGSKH-----FGVAKNTKIVAVKVLRS--NGEGTVSDVIKGIEYVTKEHIESSKKKNK 303
           G I +        GVA N K+  +++L +    E   + +I  ++             N 
Sbjct: 213 GEIAAVKNKACGIGVAYNAKVAGIRILSAEVTAEDEAASLIHALDV------------ND 260

Query: 304 EFKGSTANLSLGSSKSLAMEMAVNAAV--------DSGVHFAIAAGN---EDEDACLSSP 352
            +  S   L  G       ++   A V        + G  +  A+GN    D++      
Sbjct: 261 IYSCSWGPLDDGRVLQGPDDLVRKALVTGVTKGRNEKGALYVFASGNGGMYDDNCNYDGY 320

Query: 353 AGAEKSITVGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSM 408
             +  SITVGA         +S   + V V       G +I ST I  +  + +  GTS 
Sbjct: 321 TNSIYSITVGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGK-CSDTHGGTSA 379

Query: 409 ASPHVAGILSYFLSLQP 425
           A+P  AG+ S  L   P
Sbjct: 380 AAPLAAGVYSLVLEANP 396

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 97/243 (39%), Gaps = 19/243 (7%)

Query: 200 EDAAGKGVTSYVLDTGIDTEHEDF------EGRAEWGAVIPANDEASDLNGHGTHCAGII 253
           E+  G GV + ++D G+D E+ED       EG  ++    P        + HGT CAG I
Sbjct: 151 ENITGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCAGEI 210

Query: 254 GSKH-----FGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGS 308
            +        GVA N+K+  +++L  +G+ T  D    + Y    +   S        G 
Sbjct: 211 AAFRNDICGVGVAYNSKVSGIRIL--SGQITAEDEAASLIYGLDVNDIYSCSWGPSDDGK 268

Query: 309 TANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDE--DAC-LSSPAGAEKSITVGAST 365
           T        K   ++         G  +  A+GN     D+C       +  SITVGA  
Sbjct: 269 TMQAPDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSITVGAID 328

Query: 366 FSDDRAFFSNWGTCVDV--FAPGI-NIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLS 422
           +      +S   + V V  ++ G  N + T       + +  GTS A+P  AGI +  L 
Sbjct: 329 WKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGIYTLVLE 388

Query: 423 LQP 425
             P
Sbjct: 389 ANP 391

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 192 GQDL---EYLYEDAAGKGVTSYVLDTGIDTEHEDF------EGRAEWGAVIPANDEASDL 242
           G DL   E  Y +  G GV + ++D G+D E ED       EG  ++ A           
Sbjct: 144 GNDLNITELWYNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGD 203

Query: 243 NGHGTHCAGIIGSKH-----FGVAKNTKIVAVKVLRSN 275
           + HGT CAG I +        GVA N K+  +++L ++
Sbjct: 204 DNHGTRCAGEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 101/252 (40%), Gaps = 24/252 (9%)

Query: 196 EYLYEDAAGKGVTSYVLDTGIDTEHEDF------EGRAEWGAVIPANDEASDLNGHGTHC 249
           +  YE+  G G+ + ++D G+D ++++       EG  ++    P        + HGT C
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRC 242

Query: 250 AG-IIGSKH-----FGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNK 303
           AG I  SK+      GVA + K+  +++L  +GE T  D    + +    +   S     
Sbjct: 243 AGEIAASKNNGICGVGVAYDAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSWGP 300

Query: 304 EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDE--DAC-LSSPAGAEKSIT 360
              G+         K   +          G  +  A+GN     D C       +  SIT
Sbjct: 301 RDDGTHLQGPTDLVKKAMIRGVTEGRDQKGALYVFASGNGGAYGDNCNYDGYTNSIYSIT 360

Query: 361 VGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMASPHVAGI 416
           VGA         +S   + V V       G  I +T IG + +  +  GTS A+P  AG+
Sbjct: 361 VGAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIGDKCSN-THGGTSAAAPLAAGV 419

Query: 417 LSYFLSLQPAPD 428
             Y L LQ  P+
Sbjct: 420 --YTLVLQANPE 429

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 96/244 (39%), Gaps = 27/244 (11%)

Query: 203 AGKGVTSYVLDTGIDTEHED------FEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSK 256
            GK VT  ++D G+D E+ED      FEG  ++             + HGT CAG I + 
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 257 H-----FGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTAN 311
                  GVA +  I  +++L  +GE TV D    + Y  K +   S        G    
Sbjct: 226 RNDYCGVGVAFDAHISGLRIL--SGELTVEDEAAALIYGLKYNDIFSCSWGPPDDGQHLQ 283

Query: 312 LSLGSSKSLAMEMAVNAAVDSGVHFAIAAGN---EDEDACLSSPAGAEKSITVGASTFSD 368
                 K   ++   +   + G  +  A+GN     ++        +  SIT+GA    D
Sbjct: 284 GPYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSITIGA---ID 340

Query: 369 DRAFFSNWG-TCVDVFA------PGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFL 421
            R     +  +C  V A       G  I +T I  + +T    GTS A+P  AG+ +  L
Sbjct: 341 HRGLHPAYSESCSAVMAVTYSSGSGKFIETTDINGKCST-HHGGTSAAAPLAAGVYALLL 399

Query: 422 SLQP 425
              P
Sbjct: 400 EANP 403

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 13/103 (12%)

Query: 199 YEDAAGKGVTSYVLDTGIDTEHEDF------EGRAEWGAVIPANDEASDLNGHGTHCAGI 252
           YE+  G GV + ++D G+D E ED       EG  ++           D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 253 IGSK-----HFGVAKNTKIVAVKVLRS--NGEGTVSDVIKGIE 288
           I +        GVA N K+  +++L      E   + +I G++
Sbjct: 214 IAAVPNDFCAVGVAFNAKLSGIRILSGEITAEQEAASLIYGLD 256

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 16/88 (18%)

Query: 199 YEDAAGKGVTSYVLDTGIDTEHED----FEGRAEW----GAVIPANDEASDLNGHGTHCA 250
           Y +  G GV   ++D G+D E+ D    F     W       +P    A D   HGT CA
Sbjct: 165 YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRCA 222

Query: 251 G-IIGSKH-----FGVAKNTKIVAVKVL 272
           G I  SK+      GVA N+K+  +++L
Sbjct: 223 GEIAASKNNGFCGIGVAYNSKVSGLRIL 250

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 45/102 (44%), Gaps = 13/102 (12%)

Query: 199 YEDAAGKGVTSYVLDTGIDTEHED----FEGRAEWGAVIPANDEASDL--NGHGTHCAGI 252
           YE   GKGV   ++D G+D E ED    F     W      N     L  + HGT CAG 
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPKPLLYDDYHGTRCAGE 216

Query: 253 IGSKH-----FGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEY 289
           I +        GVA  +K+  +++L  +G+ T  D    + Y
Sbjct: 217 IAAAKNEYCGLGVAYGSKVSGIRIL--SGQITAEDEAASLVY 256

>ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL238W (KEX2)
          Length = 768

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 189 PKYGQDLEYLYE-DAAGKGVTSYVLDTGIDTEHED----FEGRAEW----GAVIPANDEA 239
           PK   ++  L++ +  G G+   V+D G+D E ED    F     W       +P    +
Sbjct: 140 PKNDMNVTGLWQKNITGHGIVVAVVDDGLDYESEDLKDNFCAEGSWDFNSNTALPKPMLS 199

Query: 240 SDLNGHGTHCAGIIGSKH-----FGVAKNTKIVAVKVL 272
            D   HGT CAG I +        GVA N+K+  +++L
Sbjct: 200 DDT--HGTRCAGEIAAAKNQFCGLGVAFNSKVSGIRIL 235

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 17/99 (17%)

Query: 204 GKGVTSYVLDTGIDTEHED----FEGRAEW----GAVIPANDEASDLNGHGTHCAGIIGS 255
           GKGV + ++D G+D   ED    F     W       +P      D   HGT CAG I +
Sbjct: 163 GKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDY--HGTRCAGEIAA 220

Query: 256 KH-----FGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEY 289
                   GVA   K+  +++L  +G+ T  D    + Y
Sbjct: 221 VKNEYCGLGVAYGAKVAGIRIL--SGQITAEDEAASLMY 257

>TPHA0M00970 Chr13 complement(186308..189322) [3015 bp, 1004 aa]
           {ON} Anc_3.257 YDR027C
          Length = 1004

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 48/117 (41%), Gaps = 9/117 (7%)

Query: 331 DSGVHFAIAAGNEDEDACL--SSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGIN 388
           + GV    A  N D +  +    P G  KS+ VG  TF    +  +  G   ++    I+
Sbjct: 808 NDGVKVTKAHSNSDNNGVVIPKKPVGHRKSVVVGDKTFVASESLITIIGKIKEIMILSID 867

Query: 389 IMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAPSPQELKEKV 445
           + S Y+ +    +S    ++     A IL  F S   A   +  N  P+P +LK  V
Sbjct: 868 LPSVYLPNFERNIS----NLLEAFNANILRIF-SEDKANSIQAQN--PNPDQLKPSV 917

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 16/87 (18%)

Query: 200 EDAAGKGVTSYVLDTGIDTEHED----FEGRAEW----GAVIPANDEASDLNGHGTHCAG 251
           ++  GKGV + ++D G+D    D    F     W       +P    + D   HGT CAG
Sbjct: 166 QNITGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMPLLSDD--NHGTRCAG 223

Query: 252 IIGSKH------FGVAKNTKIVAVKVL 272
            I +         GVA + K+  +++L
Sbjct: 224 EIAAIRNNNYCGVGVAYDAKVSGIRIL 250

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,381,848
Number of extensions: 2185610
Number of successful extensions: 5921
Number of sequences better than 10.0: 92
Number of HSP's gapped: 5887
Number of HSP's successfully gapped: 92
Length of query: 478
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 365
Effective length of database: 40,524,141
Effective search space: 14791311465
Effective search space used: 14791311465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)