Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR002W (ALG6)6.22ON54454427020.0
Smik_15.1716.22ON54454426510.0
Suva_15.1776.22ON54454426140.0
Skud_15.1636.22ON54454426040.0
Kpol_1037.276.22ON54654620370.0
KAFR0A050706.22ON56453820310.0
TBLA0G009706.22ON55954319680.0
CAGL0E02629g6.22ON54853619630.0
KLLA0D01221g6.22ON56653019520.0
TDEL0G044706.22ON54254419430.0
NCAS0D021606.22ON56353419400.0
ZYRO0C07744g6.22ON54754019320.0
NDAI0C026306.22ON58055019240.0
TPHA0J003506.22ON55953119060.0
KNAG0F028906.22ON56353318820.0
SAKL0E01364g6.22ON54154318780.0
KLTH0C11176g6.22ON53653118570.0
Kwal_56.224376.22ON53654018410.0
Ecym_30276.22ON54953218220.0
ACR004W6.22ON56353618040.0
KLLA0F16621g5.669ON5613182721e-24
TPHA0J013805.669ON5753312722e-24
TBLA0A093105.669ON5462592702e-24
ZYRO0A11506g5.669ON5562602623e-23
KLTH0F17666g5.669ON5552862595e-23
Skud_15.2345.669ON5771912596e-23
YOR067C (ALG8)5.669ON5772602597e-23
Suva_8.1185.669ON5762662552e-22
Smik_15.2475.669ON5772662552e-22
Kwal_55.217425.669ON5552662524e-22
Kpol_1018.735.669ON6212612516e-22
CAGL0L10450g5.669ON5502672481e-21
TDEL0B025405.669ON5692602481e-21
NDAI0F005105.669ON5702632481e-21
NCAS0G004505.669ON5702962463e-21
SAKL0G00836g5.669ON5612932436e-21
KNAG0L019205.669ON5682642411e-20
ADR210C5.669ON5722632383e-20
KAFR0D024405.669ON5752932374e-20
Ecym_40515.669ON6042662285e-19
ZYRO0D01914g7.500ON27569722.3
TDEL0E014304.229ON45466705.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR002W
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...  1045   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...  1025   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...  1011   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...  1007   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   789   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   786   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   762   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   760   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   756   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   753   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   751   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   748   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   745   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   738   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   729   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   728   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   719   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   713   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   706   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   699   0.0  
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   109   1e-24
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   109   2e-24
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   108   2e-24
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   105   3e-23
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   104   5e-23
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   104   6e-23
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   104   7e-23
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   102   2e-22
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   102   2e-22
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   101   4e-22
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   101   6e-22
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   100   1e-21
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   100   1e-21
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   100   1e-21
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...    99   3e-21
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...    98   6e-21
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...    97   1e-20
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...    96   3e-20
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...    96   4e-20
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    92   5e-19
ZYRO0D01914g Chr4 complement(154320..155147) [828 bp, 275 aa] {O...    32   2.3  
TDEL0E01430 Chr5 complement(286064..287428) [1365 bp, 454 aa] {O...    32   5.3  

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score = 1045 bits (2702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/544 (94%), Positives = 515/544 (94%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60
           MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60

Query: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120
           KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP
Sbjct: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120

Query: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA
Sbjct: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA
Sbjct: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240

Query: 241 PIFFAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPF 300
           PIFFAYLLSRSLLFPKFNIAR                 PLYFLGGGLKNIHQCIHRIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPF 300

Query: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360
           ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           YVLIACSMSFFLFSFQVHEK            YSSTDWNVLSLVSWINNVALFTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK
Sbjct: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540
           SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS
Sbjct: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540

Query: 541 MKDL 544
           MKDL
Sbjct: 541 MKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/544 (91%), Positives = 511/544 (93%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60
           MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVI+RCTIGLGPYSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSG 60

Query: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120
           KGSPPL+GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP
Sbjct: 61  KGSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120

Query: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           SWFAL+KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAA+CFVLSICFKQMALYYA
Sbjct: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYA 240

Query: 241 PIFFAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPF 300
           PIFFAYLLSRSLLFPKFNIAR                 PLYFLGGGLKNI+QCIHRIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPF 300

Query: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360
           ARGIFEDKVANFWCVTNVFVKYKERF++QQLQLYSL+ATVIGFLPAM+MTLLHPKKHLLP
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLP 360

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           YVLIACSMSFFLFSFQVHEK            YSSTDWNVLSLVSWINNVALFTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           +DGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK
Sbjct: 421 RDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540
           SFIIGTYIAMG YHFLD FVAPPSKYPDLWVLLNC VGF CFSIFW+WSYYKIFTSGSKS
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKS 540

Query: 541 MKDL 544
           MKDL
Sbjct: 541 MKDL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/544 (89%), Positives = 508/544 (93%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60
           MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVI+RC IGLGPYSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60

Query: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120
           K +PPL+GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIG+FFNP
Sbjct: 61  KATPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNP 120

Query: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           SWFAL+KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           +AILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAA+CFVLSICFKQMALYYA
Sbjct: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYA 240

Query: 241 PIFFAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPF 300
           PIFFAYLLSRSL FPKFNIAR                 PLYFLGGGL+NI+QCIHR+FPF
Sbjct: 241 PIFFAYLLSRSLFFPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPF 300

Query: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360
           ARGIFEDKVANFWCV+N+FVKYKERF+IQQLQLYSL+ATV+GFLPAM+MTLLHPKKHLLP
Sbjct: 301 ARGIFEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLP 360

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           YVLIACSMSFFLFSFQVHEK            YSSTDWNVLSLVSWINNVALFTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGLHLQY VSFLL+NWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK
Sbjct: 421 KDGLHLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540
           SFIIGTYIAMG YHFLD FVAPP KYPDLWVLLNCAVGFICFSIFW+WSYYKIFTSG+KS
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKS 540

Query: 541 MKDL 544
           MKDL
Sbjct: 541 MKDL 544

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score = 1007 bits (2604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/544 (90%), Positives = 505/544 (92%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60
           MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVI+RC IGLGPYSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60

Query: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120
           K SPPL+GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHS L GLIG+FFNP
Sbjct: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120

Query: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           SWFAL+KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           +AILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA
Sbjct: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240

Query: 241 PIFFAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPF 300
           PIFFAYLLSRSLLFPKFNIAR                 PLYFLGGGL+NIHQCI+RIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300

Query: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360
           +RGIFEDKVANFWCVTN+FVKYK+RFTIQQLQLYSL+ATVIGFLPAMIMTLLHPKKHLLP
Sbjct: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           YVLIACSMSFFLFSFQVHEK            YSSTDWNVLSLVSWINNVALFTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGLHLQY VSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK
Sbjct: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540
           SFIIGTYIAMG YH LD FV PPSKYPDLWVLLNCAVGF CFSIFW+WSYYKIFTSG+KS
Sbjct: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540

Query: 541 MKDL 544
           +KDL
Sbjct: 541 VKDL 544

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/546 (69%), Positives = 442/546 (80%), Gaps = 2/546 (0%)

Query: 1   MAIGKRL-LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYS 59
           MA  K++  +NKP EESF+ASP+YDFL PFRPV NQWL EYII + A+I+RC IGLG YS
Sbjct: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60

Query: 60  GKGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFN 119
           G G+PP++GDFEAQRHWMEITQHLP+SKWY++DL+YWGLDYPPLTA+HSY+LG+IGSF N
Sbjct: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120

Query: 120 PSWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIA 179
            SWFAL  SRG+ES +N LKTYMR+TVIIS+I+FY P VIYFTKW+GR+R QS IGQ IA
Sbjct: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180

Query: 180 ASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYY 239
           A+AILFQPSLMLIDHGHFQYNSVMLGLT YAINNLLDE+YA AA+CFVLSICFKQMALYY
Sbjct: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240

Query: 240 APIFFAYLLSRSLLFPK-FNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIF 298
           APIFF YLL RSL   K FNI+R                 PLY  GGGL+N+ Q +HRIF
Sbjct: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300

Query: 299 PFARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHL 358
           PFARG+FEDKVANFWCVTN+F+KYK  +T ++LQLYSLIATV+GFLPA++  L +PKKHL
Sbjct: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360

Query: 359 LPYVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPL 418
           LPY L ACSMSF+LFSFQVHEK            Y+STDWNVLS VSW+NNV LFTLWPL
Sbjct: 361 LPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPL 420

Query: 419 LKKDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVV 478
           LKKDGL LQY V F LSNWLIGNFSFITP+FLPK LTPGP + +    Y RRSLLP+N++
Sbjct: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480

Query: 479 WKSFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGS 538
           WK  I+ +YI M   H  + FV+PP +YPD+WVL+NC +GF CF +FWLW+YYKIFT  +
Sbjct: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540

Query: 539 KSMKDL 544
           K+++ L
Sbjct: 541 KTLQYL 546

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/538 (68%), Positives = 438/538 (81%), Gaps = 3/538 (0%)

Query: 8   LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLY 67
           L N+  EE FYASP+YDFLYPFRP GNQWL +YII   A+I+RC IGLG YSG G  P++
Sbjct: 29  LNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMF 88

Query: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEK 127
           GDFEAQRHWMEITQHLP+SKWYW+DLQYWGLDYPPLTA+HSY+LG IGSF  P WF L  
Sbjct: 89  GDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLND 148

Query: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQP 187
           SRG E    G+K+YMR+TV+IS+ +FYFPA+IYF+KW G++RNQSPIGQ IAA+AILFQP
Sbjct: 149 SRGIEM--EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQP 206

Query: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYL 247
           SLMLIDHGHFQYNSVMLGLT YAINNLLD++Y++A+VCFVLSICFKQM+LYYAPIFF YL
Sbjct: 207 SLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYL 266

Query: 248 LSRSLLFPK-FNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFE 306
           LS+SL FP+ FNI R                 PLY  GGGL+N+ Q +HRIFPFARGIFE
Sbjct: 267 LSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFE 326

Query: 307 DKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIAC 366
           DKVANFWCVTN+ +KYK +FT  QLQLYSL ATV+GFLPA+++ +L+PKKHLLPY L AC
Sbjct: 327 DKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAAC 386

Query: 367 SMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHL 426
           SMSFFLFSFQVHEK            Y+STDWNVLS+V WINNVALFTLWPLLKKDGL L
Sbjct: 387 SMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLIL 446

Query: 427 QYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGT 486
           QYAV F LSNWL+GNFSF+TP+FLPK LTPGPSIS+I+ +Y RRSLLP+N++WK  I+ +
Sbjct: 447 QYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSS 506

Query: 487 YIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
           Y++M  +H+LD FV PP+ YPD+W+ LNC +GF  F  FW+W+YY +FT  +K++ DL
Sbjct: 507 YLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/543 (68%), Positives = 431/543 (79%), Gaps = 12/543 (2%)

Query: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQ 73
           EE+FYASP++DFLYPFRPVG+QWL EY+I + A+I+RC I LG YSGKG+PP++GDFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFES 133
           RHWMEITQHLP+SKWYW+DLQYWGLDYPP TA+HSY  G +GSFFNP WFAL  SRG+ES
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193
            DNGLKTYMR TVI+S+ +FY PAV+YFTKWLG++RNQSPIGQ IAA+AILFQPSLMLID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253
           HGHFQYNSVMLGLT YAINNLLDE+Y  AA+CFVLS+CFKQMALYY+PIFF YLLS+SL+
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 254 FPKFNIARXXXXXXXXXXXXXXXXXPLYFLG------------GGLKNIHQCIHRIFPFA 301
            P  NI+R                 P+Y  G             GL N+ QCI RIFPFA
Sbjct: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316

Query: 302 RGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPY 361
           RGIFEDKVANFWCVTNV +KY+E FT +QLQ YSL+AT+IGFLP+MI   L+P+K L+PY
Sbjct: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376

Query: 362 VLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKK 421
            L ACSMSFFLFSFQVHEK            Y+STDWNVLSLV WINNVALFTLWPLL+K
Sbjct: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436

Query: 422 DGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKS 481
           DGL LQY V + LSNWLIGNFSFITP+FLP  LTPGPSIS+I+ DYRR SLLP+N++WK 
Sbjct: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKI 496

Query: 482 FIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSM 541
            II +YI MG    LD F  PP+ YPDLW++LNC VGF CF +FWLW+ YKI    +K++
Sbjct: 497 IIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556

Query: 542 KDL 544
            DL
Sbjct: 557 NDL 559

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/536 (67%), Positives = 430/536 (80%), Gaps = 4/536 (0%)

Query: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGD 69
           ++  EESFYASP+YDFL+PFRP G+QWL E+II + A+I+RC IGLGPYSG    P++GD
Sbjct: 16  SEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGD 75

Query: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSR 129
           FEAQRHWMEITQHLP+SKWY+YDL+YWGLDYPPLTAFHSYLLG +G+F NP WFAL+ SR
Sbjct: 76  FEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSR 135

Query: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSL 189
           G E+   GLK YMR TV++S+ +FY PAV+YFTKWLGR RNQSPIGQ IAA+AILFQPSL
Sbjct: 136 GIET--QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193

Query: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLS 249
           MLIDHGHFQYNS+MLG T YAINNLLDE+YA AA+CFVLSICFKQM+LYYAPIFFAYLL 
Sbjct: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253

Query: 250 RSLLFPK-FNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFEDK 308
           RS+ FPK FNI R                 P Y  GG L  + Q + RIFPFARGIFEDK
Sbjct: 254 RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGG-LDGLAQTVRRIFPFARGIFEDK 312

Query: 309 VANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSM 368
           VANFWCV N  VK+K  FT  QL++YSLI TV+GF PAMI+ +L+P+KHLLPY L ACSM
Sbjct: 313 VANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSM 372

Query: 369 SFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428
           SF+LFSFQVHEK            ++S DWNVLS+VSWINNVALFTLWPLLK++GL+LQY
Sbjct: 373 SFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQY 432

Query: 429 AVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488
            V F LSNWLIGNFSFITPRFLPK +TPGPSISS++ +YRRRSLLP+++ WK  I+ +YI
Sbjct: 433 FVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYI 492

Query: 489 AMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
            M  YHFLD F+  P ++PDLWV+LNC +GF+ FS+FWLW+YYK  T   K+++DL
Sbjct: 493 GMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/530 (67%), Positives = 426/530 (80%), Gaps = 3/530 (0%)

Query: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQR 74
           E+F+ASPMYDFL PFRPVGNQW  +Y+I + A+I+RC +GLG YSG  +PP++GDFEAQR
Sbjct: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99

Query: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFESP 134
           HWMEITQHLP+ +WYWYDLQYWGLDYPPLTA+HSYLLG +GSFF   WF LE SRG+ES 
Sbjct: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159

Query: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDH 194
           +  LK+YMR TVIIS++L Y PAVIYFTKW+G+YR+QSPIGQ IAA+AILFQP+L+L+DH
Sbjct: 160 N--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDH 217

Query: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254
           GHFQYN VMLG+T Y +NNLLD +YAM A+CFVLS+CFKQMALYY+PIFFAYLLS+S   
Sbjct: 218 GHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYS 277

Query: 255 PKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVANFWC 314
           P  N+ R                 P+Y  GG  KN+ Q +HRIFPFARGIFEDKVANFWC
Sbjct: 278 PGINLPRLFAISVSTALAFIGSFGPIYIFGG-YKNLVQSMHRIFPFARGIFEDKVANFWC 336

Query: 315 VTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLFS 374
           V+N+F+KY+  FT + LQLYSL+ATVIG LP+ I+T L+PK+HLLPY L ACSMSFFLFS
Sbjct: 337 VSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFS 396

Query: 375 FQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFLL 434
           FQVHEK            Y+S DWNVLSLV WINNVALFTLWPLLKKD L LQY V F+ 
Sbjct: 397 FQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMF 456

Query: 435 SNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFYH 494
           SNWLIGNFSF+TPRFLPK LTPGPSIS I+ DYRR SLLP +++W+  I+G+YIAMG  H
Sbjct: 457 SNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIH 516

Query: 495 FLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
           FLD +V+PPSKYPDLWVL NC++GF CF  FW+W+ YK+F   + +++DL
Sbjct: 517 FLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/544 (65%), Positives = 429/544 (78%), Gaps = 2/544 (0%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60
           MA   +       EESFYASP+YDFLYPFRP G+QWL EY+I + A+I+ C +G G YSG
Sbjct: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60

Query: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120
           + SPP++GDFEAQRHWMEITQHL  S+WYW+DL+YWGLDYPPLTA+HSY+LG IGSF  P
Sbjct: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120

Query: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
            WF L +SRG E+PD  LKT+MR TV++S+ LFY PAV+YFTKWLG++R +SPIGQ I+A
Sbjct: 121 EWFELNESRGIETPD--LKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISA 178

Query: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           +AILFQPSLMLIDHGHFQYN VMLGLT YAIN+L +E+YA+AA+CFVLSICFKQMALYYA
Sbjct: 179 AAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYA 238

Query: 241 PIFFAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPF 300
           PIFFAYLLS+SL  P+FN  R                 PLY  GGGL N+ Q +HRIFPF
Sbjct: 239 PIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPF 298

Query: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360
           ARGIFEDKVANFWCVTNVF KYK  F  +QLQLYSLIAT++GFLPA+I+  L+PKKH++ 
Sbjct: 299 ARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           Y L  CSMSF+LFSFQVHEK            Y+S++W+VLS+ +WINNV LFTL+PLLK
Sbjct: 359 YALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLK 418

Query: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGL LQY V F LSNWL+GNFSF+TP+FLPK LTPGPS+SS++ +YRRRS LP NV+WK
Sbjct: 419 KDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWK 478

Query: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540
             I+ +Y AMG  H +D  + PP  YPDLWVLLNCA+GF CF++FWLWSYY +FT   K+
Sbjct: 479 IIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKT 538

Query: 541 MKDL 544
           ++ L
Sbjct: 539 LQQL 542

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/534 (68%), Positives = 423/534 (79%), Gaps = 5/534 (0%)

Query: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQ 73
           EESFYASP+YD LYPFRP G+QW+ EY I + ++I+RC +GLGP+SG G PP++GDFEAQ
Sbjct: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91

Query: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFES 133
           RHWMEITQHLP+ KWYW+DL+YWGLDYPPLTA+HSY+ G IGSFFNP+WFAL+ SRG+E+
Sbjct: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151

Query: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193
            D  LKT+MR TV++S+ LFY P V+YF KWLG++R QSPIGQ IAA+AIL QPSL+LID
Sbjct: 152 QD--LKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209

Query: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253
           HGHFQYNSV LGLT YAINNLLDE+YAMAAVCFVLSICFKQM LYY+PIFFAYLLS+SL 
Sbjct: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269

Query: 254 FPK-FNIARXXXXXXXXXXXXXXXXXPLYFLGG--GLKNIHQCIHRIFPFARGIFEDKVA 310
            PK FNI R                 PLY  GG  GL N+ Q IHRIFPFARGIFEDKVA
Sbjct: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVA 329

Query: 311 NFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSF 370
           NFWCVTNV  KYK  FT Q+LQLYSL+ TV+GFLPAM++ L +PKK+LLPY L ACSM+F
Sbjct: 330 NFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAF 389

Query: 371 FLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAV 430
           +LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLKKDGL LQY V
Sbjct: 390 YLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWV 449

Query: 431 SFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAM 490
             LLSNWLIGNFSFITP FLPK LTPGPS+S I  +Y  RSLLP N+ WK  I+ +YIAM
Sbjct: 450 CLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAM 509

Query: 491 GFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
           G  H LD FV PP  YPDLWV+LNC +GF CF +FW+W+YYK+F+   KS+  L
Sbjct: 510 GAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/540 (67%), Positives = 434/540 (80%), Gaps = 2/540 (0%)

Query: 5   KRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSP 64
           ++   +  AEESFYASP+YDFLYPF+PVG+QWLPEYII + AVI+RC IGLGPYSG+   
Sbjct: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69

Query: 65  PLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFA 124
           P++GDFEAQRHW+EITQHLP+S+WY++DL+YWGLDYPPLTA+HSY+LG +GS  NP WFA
Sbjct: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129

Query: 125 LEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAIL 184
           L  SRG ES  N LKTYMR TVI+S+++FY PAV+YFTKW+GR+R  SP+GQ IAA+AIL
Sbjct: 130 LNVSRGLES--NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAIL 187

Query: 185 FQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFF 244
           FQP+LMLIDHGHFQYN VMLG T YAIN+L+DE+YA AA CFVLSICFKQMALYY+PIFF
Sbjct: 188 FQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFF 247

Query: 245 AYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGI 304
           AYLL R +        R                 PLY +G G +N+ Q +HRIFPFARGI
Sbjct: 248 AYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGI 307

Query: 305 FEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLI 364
           FEDKVANFWCVTN+FVKYK+ FT QQLQLYSL+AT +GFLPA+++ LL+PKKHL+P+ L 
Sbjct: 308 FEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALA 367

Query: 365 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGL 424
           ACSMSFFLFSFQVHEK            Y+ST+W+VLSLVSWINNV LFTLWPLLKKDGL
Sbjct: 368 ACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGL 427

Query: 425 HLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFII 484
            LQY V F   NWLIGNFSF+TP FLPK LTPGPS+SS++S+YRRRSLLP +++WK  I+
Sbjct: 428 ALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIV 487

Query: 485 GTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
           G+YI+MG  H LD FVAPP  YPDLWV+LNC +GF CF +FWLW+YYK+F+   +S++ L
Sbjct: 488 GSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/550 (66%), Positives = 429/550 (78%), Gaps = 11/550 (2%)

Query: 4   GKRLLVNKPAE-----ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPY 58
            K++  N+P E     ESFYASP+YDFLYPFRP G+QW+ EYII + A+I+RC +GLGPY
Sbjct: 33  SKKMNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPY 92

Query: 59  SGKGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFF 118
           SG  +PP++GDFEAQRHWMEITQ+LP+S+WYW+DLQYWGLDYPPLTAFHSYL G IGSFF
Sbjct: 93  SGFNTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFF 152

Query: 119 NPSWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSI 178
            P+WF L  SRG+E  D  LKT+MR TV+ S+ L Y PAV+YFTKWLG+ RNQSPIGQ I
Sbjct: 153 QPNWFTLGDSRGYEGQD--LKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFI 210

Query: 179 AASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALY 238
           A +AILFQPSL+LIDHGHFQ+NSVMLGLT Y +NNLLDE+YA AAVCFVLSICFKQMALY
Sbjct: 211 AVAAILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALY 270

Query: 239 YAPIFFAYLLSRSLLFPK-FNIARXXXXXXXXXXXXXXXXXPLYFLGG---GLKNIHQCI 294
           Y+PIFFAYLLS+SL  P+ FNI R                 P+YF GG   G+ N+ Q I
Sbjct: 271 YSPIFFAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSI 330

Query: 295 HRIFPFARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHP 354
            RIFPFARGIFEDKVANFWCVTNV  KYK  FT +QLQLYSLI T+I FLPAM++ LL+P
Sbjct: 331 KRIFPFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYP 390

Query: 355 KKHLLPYVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFT 414
           +K+LL Y L ACSMSF+LFSFQVHEK            Y+STD NVLS VSW+NN+ LFT
Sbjct: 391 RKYLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFT 450

Query: 415 LWPLLKKDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLP 474
           LWPLLKKDGL LQY V  +LSNWLIGNFSFITPRFLPK LTPGPSI  +  +YRR +LLP
Sbjct: 451 LWPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLP 510

Query: 475 YNVVWKSFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIF 534
            N +WK  I+ +Y+ MG  HF+D F+ PPS YPDLWV+LNC +GF CF +FWLW+YYK+F
Sbjct: 511 SNWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLF 570

Query: 535 TSGSKSMKDL 544
           +   K++  L
Sbjct: 571 SMTKKNIHQL 580

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/531 (67%), Positives = 417/531 (78%), Gaps = 3/531 (0%)

Query: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQR 74
           E FYASP+Y FL PF+   NQWL  YII + A+I+RC IGLGPYSG    P++GDFEAQR
Sbjct: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90

Query: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFESP 134
           HWMEITQHLP+S+WY+YDLQYWGLDYPPLTA+HSY+ GLIG FFNP+WF LE SRG E  
Sbjct: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150

Query: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDH 194
           +  LKT+MR T I+S+++FY PA+IYFT W+G+ R QSP+GQ IAA+AILFQP LMLIDH
Sbjct: 151 E--LKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDH 208

Query: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254
           GHFQYNSVMLGLT YAINNLLD+ YA AA+ FV+SICFKQM+LYYAPIFFAYLL RSL  
Sbjct: 209 GHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFK 268

Query: 255 PKF-NIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVANFW 313
            +F N++R                 PLY  GGG +NI Q +HRIFPFARGIFEDKVANFW
Sbjct: 269 KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFW 328

Query: 314 CVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373
           CVTNV +KYK  +T  +LQLYSLI TV+GFLPAM+  L  PKKHLLPY L AC+MSFFLF
Sbjct: 329 CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF 388

Query: 374 SFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFL 433
           SFQVHEK            Y+STDWNVLSLVSWINNVALFTLWPLLKKDG+ LQY V F+
Sbjct: 389 SFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI 448

Query: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFY 493
           LSNWLIGNFSF TPRFLPK LTPGP I ++N+ YRRRSLLP N++WK  I+ +YI M   
Sbjct: 449 LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI 508

Query: 494 HFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
             L+ FV PP +YPD++VLLNC +GF CF+ FWLW+YYK+FT  SK+++ L
Sbjct: 509 QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/533 (65%), Positives = 421/533 (78%), Gaps = 4/533 (0%)

Query: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEA 72
            EE FYASP+YDFLYPFR  G+QW+ EYII V  +I++  IGLG YSG  +PP++GDFEA
Sbjct: 34  VEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEA 93

Query: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFE 132
           QRHWMEITQHLP+S+WYW+DLQYWGLDYPP TA+HSYLLG IG+F  P WF L+ SRG E
Sbjct: 94  QRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGME 153

Query: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLI 192
           +  +G+K+YMR TV++S+ +FY PA++YFTKW+GR + QSPIGQ +AA+AILFQP+LMLI
Sbjct: 154 T--DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLI 211

Query: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSL 252
           DHGHFQYN VMLGLT YAINNLLD +YAMAAVCFVLSICFKQMALYYAPIFFA LLS+SL
Sbjct: 212 DHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSL 271

Query: 253 LFPK-FNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVAN 311
            FP+ FNI R                 PLY  GG + N+ Q IHRIFPFARGIFEDKVAN
Sbjct: 272 FFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGG-VGNVLQSIHRIFPFARGIFEDKVAN 330

Query: 312 FWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFF 371
           FWCVTNVF KYK  FT  +LQ YSL+ATV+GF PA ++ + +PKK L+PY L ACSM+FF
Sbjct: 331 FWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFF 390

Query: 372 LFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVS 431
           LFSFQVHEK            ++ST+WN LS+V W+NNVALFTLWPLLKKDGL LQY V 
Sbjct: 391 LFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVC 450

Query: 432 FLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMG 491
            ++ NWL+GNFSFITPRFLPK LTPGPSIS+I  +YRRRSLLP+N++WK  I+ +Y+ M 
Sbjct: 451 LVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCML 510

Query: 492 FYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
             H L+  +A PS+YPDLWV LNC VGF CF +FW+W+YYK+ T  +K++++L
Sbjct: 511 MIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/543 (65%), Positives = 428/543 (78%), Gaps = 3/543 (0%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60
           M+  ++    K  +ESF+ASP++DFL PFRPV NQW  +YII + A+I+RC +GLG +SG
Sbjct: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60

Query: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120
              PP++GDFEAQRHWME+T +LPLS+WYWYDL YWGLDYPPLTA+HSY+LG +G  F+P
Sbjct: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120

Query: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           +WF L  SRG ES D  LK+YMR TV++S++L Y P VIYF KW+G++R Q+PIGQ IAA
Sbjct: 121 TWFQLGVSRGQESMD--LKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAA 178

Query: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           +AILFQPSL+LIDHGHFQYNSVMLGLT YAINNLLDEYYA AA+CFVLS+CFKQMALYYA
Sbjct: 179 AAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYA 238

Query: 241 PIFFAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPF 300
           PIFF+YLLS+SL  P FN+ R                 PLY + GG++N+ Q IHRIFPF
Sbjct: 239 PIFFSYLLSKSLFSPLFNLPRLLAVAAATLISFAAMFFPLY-MWGGIRNVLQSIHRIFPF 297

Query: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360
           +RGIFEDKVANFWC +N+F+KYK  +T  QLQ+YSL AT +GFLPA I+   +PKKHL+P
Sbjct: 298 SRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIP 357

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           Y L ACSMSFFLFSFQVHEK            Y+STDWNVLS+VSWINN+A FTLWPLLK
Sbjct: 358 YALTACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLK 417

Query: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGL LQYA   LLSNWLIGNFSF+TPRFLPK LTPGPS S ++ +YRRRSLLP N+ WK
Sbjct: 418 KDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWK 477

Query: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540
             I+ +YI+MG  H LD +V PP+KYPDLWVLLNC++GF  F +FW+W+YYK+FT  +K+
Sbjct: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKT 537

Query: 541 MKD 543
           + D
Sbjct: 538 LYD 540

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/531 (64%), Positives = 410/531 (77%), Gaps = 3/531 (0%)

Query: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQ 73
           +ESF+ASP+YDFL PFRPV NQ+  EY+I + A+++RC +GLG +SG+ + P++GDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFES 133
           RHWME+T +LPLS+WYW+DLQYWGLDYPPLTA+HSY LG +GS  NP WFAL  SRG E+
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128

Query: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193
           P+  LK YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAA+AILFQPSL+LID
Sbjct: 129 PE--LKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186

Query: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253
           HGHFQYNSVMLGLT YAINNLLD ++  AA+CF+LS+CFKQMAL+Y+PIFFAYLLSRSL 
Sbjct: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246

Query: 254 FPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVANFW 313
            P F  +R                 PLY  GG +KN+ Q IHRIFPF+RGIFEDKVANFW
Sbjct: 247 SPSFKFSRFMSVALSTVITFCLMFSPLYVFGG-MKNVLQSIHRIFPFSRGIFEDKVANFW 305

Query: 314 CVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373
           CV+NV VKY + FT  QLQ  S  AT  GFLP+  + +L+PKKH++PY L ACSM+FFLF
Sbjct: 306 CVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLF 365

Query: 374 SFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFL 433
            FQVHEK            + STDWNVL++VSWINNVALFTLWPLLKKD L LQY +  L
Sbjct: 366 GFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMML 425

Query: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFY 493
           LSNWLIGNFSF+TPRFLP  +TPGPS+S++   YRRRS LP N+VWK  II +YI M   
Sbjct: 426 LSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVI 485

Query: 494 HFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
           H LD FV PP+K PDLWVL+NCA+GF CFS+FWLW+ YK+FT  +KS+ DL
Sbjct: 486 HILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/540 (63%), Positives = 411/540 (76%), Gaps = 7/540 (1%)

Query: 4   GKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGS 63
           GK++  N+P    F+ASP+YDFL PFRPV NQ+  EY+I + A+++RC +GLG +SG+ S
Sbjct: 3   GKKVSKNEP----FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENS 58

Query: 64  PPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWF 123
            P++GDFEAQRHWME+T HLPLS+WYWYDLQYWGLDYPPLTA+HSY+LG +GS  N  WF
Sbjct: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWF 118

Query: 124 ALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAI 183
           AL  SRG E+PD  +K YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAA+AI
Sbjct: 119 ALLSSRGIENPD--IKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAI 176

Query: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIF 243
           LFQPSL+LIDHGHFQYNSVMLGLT Y+INNLLD YY  AA+CFVLS+CFKQMALYY+P+F
Sbjct: 177 LFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVF 236

Query: 244 FAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARG 303
           FAYLLS  L+ P  N+ R                 PLY  GG  KN+ Q IHRIFPF+RG
Sbjct: 237 FAYLLSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRG 295

Query: 304 IFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVL 363
           IFEDKVANFWCV+NV  KY + +T Q+LQ +S+IAT  GFLP+ ++ L +PKKH++P+ L
Sbjct: 296 IFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFAL 355

Query: 364 IACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDG 423
            ACSM+FFLFSFQVHEK            Y STDWNVLS+VSWINNVALFTLWPLLKKD 
Sbjct: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415

Query: 424 LHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483
           L LQY +  LLSNWLIGNFSF+TPRFLPK +TPGPSIS ++  YRRRS LP N  WK  I
Sbjct: 416 LTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLII 475

Query: 484 IGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKD 543
           + +Y+ M   H LD FV  P   PDLWVLLNCA+GF CF+IFWLW +YK+FT  + +++D
Sbjct: 476 VASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/532 (62%), Positives = 409/532 (76%), Gaps = 3/532 (0%)

Query: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEA 72
            EESF+ASP+YDFLYP RPV NQW  +YII + A+I+R  +GLG YSGKG  PL+GDFEA
Sbjct: 21  VEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGDFEA 80

Query: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFE 132
           QRHWMEIT  LP+S+WY+YDL+YWGLDYPPLTA+HSY+LG +GSF N +WF L  SRGFE
Sbjct: 81  QRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFE 140

Query: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLI 192
           S D  LK++MR TV++S+++ Y PAV+YFT+W+GR+RNQSPIGQ +A +AILFQPSL+LI
Sbjct: 141 SID--LKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILI 198

Query: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSL 252
           DHGHFQYN VMLGL  Y INNLLDE+Y  AA+CFVLS+ FKQMALYY+P+ FAYL SRS 
Sbjct: 199 DHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSA 258

Query: 253 LFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVANF 312
            +P+FN  R                 PL  L G  +NI Q ++R+FPF+RGIFEDKVANF
Sbjct: 259 YYPRFNFPRFAGIAIATLLTFGALYAPLC-LFGDFRNIIQSVYRVFPFSRGIFEDKVANF 317

Query: 313 WCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFL 372
           WCVTNV +KY+E +T +QLQ Y L+ T I   PA I+  L+PKK LLPY L ACSM+FFL
Sbjct: 318 WCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAFFL 377

Query: 373 FSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSF 432
           FSFQVHEK            + ST+W+VLS+V+WINNVALFTLWPLLKKDGL LQYA+ F
Sbjct: 378 FSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAIMF 437

Query: 433 LLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGF 492
           LLSNWL+GNFSF+TP FLPK LTPGPS+S +  DYRRRSLLP N+ W+  I+ +Y+ M F
Sbjct: 438 LLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAF 497

Query: 493 YHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
            H LD +V PP  YPD+WVL  CA+GF CF+ FWLW+YY+++   + S+ +L
Sbjct: 498 IHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/536 (61%), Positives = 409/536 (76%), Gaps = 4/536 (0%)

Query: 10  NKPA-EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYG 68
            KP  +E+F+ASP+YDFLYP RPV NQW  +YII + A+I+R  +GLG YSG G PP++G
Sbjct: 31  KKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFG 90

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DFEAQRHWME+TQH+P+SKWY++ LQYWGLDYPPLTA+HSYLLG +GS+ +P WF+L  S
Sbjct: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150

Query: 129 RGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPS 188
           RG+ES D  LK+YMR TVI+S++ FY PAV+YFT+W+GR R QSPIGQ IA +AILFQP+
Sbjct: 151 RGYESED--LKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPA 208

Query: 189 LMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLL 248
           L+LIDHGHFQYN VMLGLT  AINNLLD+YYA+AAV FV S+ FKQMALYYAP+ F YLL
Sbjct: 209 LILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLL 268

Query: 249 SRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFEDK 308
           SRS+ +P+ NI R                 PLY LG  +  I Q IHR+FPF RG+FEDK
Sbjct: 269 SRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIFQSIHRVFPFERGLFEDK 327

Query: 309 VANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSM 368
           VANFWCVTNV VKYK ++T  QL+ +SL+ T    LP++I+T L+PKK +LPY L ACSM
Sbjct: 328 VANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSM 387

Query: 369 SFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428
           SFFLF FQVHEK            Y+STDWNVLS+V+WINN+ALFTLWPLLKKDGL LQY
Sbjct: 388 SFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQY 447

Query: 429 AVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488
           A+ FLLSNWLIGNFSFITP FLPK LTPGPS+S +   YRRRSLLP N++W+  I+ +YI
Sbjct: 448 AIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYI 507

Query: 489 AMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544
            +G  H  + +  P  + PD+WVL NC VG   F++FW+W+ YK+F   + ++ DL
Sbjct: 508 CVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  109 bits (272), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/318 (28%), Positives = 144/318 (45%), Gaps = 37/318 (11%)

Query: 44  VCAVILRCTIGLGPYSGKGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPL 103
           +CA +L+  +  G YS         DF+  R+W+ IT  LPL+KWY      W LDYPP 
Sbjct: 35  ICATVLKVLLFPGYYST--------DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPF 86

Query: 104 TAFHSYLLGLIGSFFNPSWFALEKSRGFESPDN-GLKT--YMRSTVIISDILFYFPAVIY 160
            A+  + L    S F P   A +         + GL T  + R TVI+S+++ Y      
Sbjct: 87  FAYFEWFL----SQFVPKSVAEDGCLDIVKVGSFGLPTIIFQRITVILSELVLYAA---- 138

Query: 161 FTKWLGRYRNQSPIGQS----IAASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLD 216
               L  + N S I +     + AS+I+  P L+++DH HFQYN  + G+   +I    +
Sbjct: 139 ----LQVFINTSDISEKSANFVVASSIVLSPGLLIVDHIHFQYNGFLFGILISSIVAAKN 194

Query: 217 EYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL-FPKFN-------IARXXXXXXX 268
           + Y + A  F +++CFK + LY AP +F +LL   +L F  F        I+        
Sbjct: 195 KRYILCAAFFSIALCFKHIFLYLAPAYFVFLLRAYVLDFSSFKFRSYKDLISIVQWSNLL 254

Query: 269 XXXXXXXXXXPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVA-NFWCVTNVFVKYKERFT 327
                      L FL   +    Q + R+FPF+RG+     A N W V +   K      
Sbjct: 255 KLASVVMGIFSLAFL-PFITTWQQLLARLFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLV 313

Query: 328 IQQLQLYSLIATVIGFLP 345
           ++   L  +++ V+  +P
Sbjct: 314 LKLPYLQKILSIVLTSMP 331

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/331 (28%), Positives = 148/331 (44%), Gaps = 50/331 (15%)

Query: 5   KRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSP 64
           K ++V    + S   + +YD       V ++    +  ++ ++ L+  +  G YS     
Sbjct: 13  KSVVVESEDDISVMETDVYD-----EKVQDRRFSLWNFWISSLFLKLLLIPGYYST---- 63

Query: 65  PLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFA 124
               DF+  R+W+ IT +LP+SKWY+ +   W LDYPP  A+  ++L    S F P    
Sbjct: 64  ----DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVL----SRFAPE--- 112

Query: 125 LEKSRG----FESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSI 178
           + K+ G     E    GL T  + R TVIIS+IL +     Y      + R Q      +
Sbjct: 113 IVKNDGCLDIVEVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FV 168

Query: 179 AASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALY 238
            AS+I+  P  ++IDH HFQYN  +  +   +I     + Y   AV + +S+CFK + LY
Sbjct: 169 VASSIVLSPGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLY 228

Query: 239 YAPIFFAYLLSRSLL-FPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIH------ 291
            AP +F +LL   +L F  F                      L+ L G +  I       
Sbjct: 229 LAPCYFVFLLRAYVLNFENFKFKSYMDLQSVIQWKR------LFKLAGIVSGIFTICFAP 282

Query: 292 ------QCIHRIFPFARGIFEDKVA-NFWCV 315
                 Q + R+FPF+RG+     A NFW +
Sbjct: 283 FIFQLPQVLSRLFPFSRGLTHAYWAPNFWAM 313

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 121/259 (46%), Gaps = 21/259 (8%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LPL +WY+ +   W LDYPP  A+  + L    S F P  F  E  
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFL----SQFVPK-FVKEDG 97

Query: 129 RGFESPDNGLK----TYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAIL 184
                P+         + R TVIIS+IL +    ++        + QS     + AS+I+
Sbjct: 98  CLDILPEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSII 153

Query: 185 FQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFF 244
             P  ++IDH HFQYN  + G+   +I    ++ Y +  + + +++CFK + LY AP +F
Sbjct: 154 LSPGFLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYF 213

Query: 245 AYLLSRSLL-FPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGL------KNIHQCIHRI 297
            +LL   +L F  F                      +     G+      ++++Q + R+
Sbjct: 214 VFLLRAYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQLLSRL 273

Query: 298 FPFARGIFEDKVA-NFWCV 315
           FPF+RG+     A NFW +
Sbjct: 274 FPFSRGLTHAYWAPNFWAI 292

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 119/260 (45%), Gaps = 23/260 (8%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT +LPL +WY+     W LDYPP  A+  + L    S F P    +++ 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFL----SQFVPG--TVKQD 98

Query: 129 RGFESPDNG-----LKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAI 183
              E  D G        + RSTVI+S+IL +    ++        R QS     + AS+I
Sbjct: 99  GCLEIVDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSI 154

Query: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIF 243
           +  P+ +++DH HFQYN  +  +   +I       Y   A  + +++CFK + LY AP +
Sbjct: 155 VLSPAFLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCY 214

Query: 244 FAYLLSRSLL-FPKFNIARXXXXXXXXXXXXXXXXXPLYF------LGGGLKNIHQCIHR 296
           F +LL    L F  F                      +         G  +K++ Q + R
Sbjct: 215 FVFLLRAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPFVKDLPQVLTR 274

Query: 297 IFPFARGIFEDKVA-NFWCV 315
           +FPF+RG+     A NFW +
Sbjct: 275 LFPFSRGLTHAYWAPNFWAL 294

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  104 bits (259), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 130/286 (45%), Gaps = 21/286 (7%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LPL KWY+     W LDYPP  A+  +LL    S F P     +  
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLL----SQFVPQRVQDDGC 99

Query: 129 RGFESPDN-GLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILF 185
               +    GL T  + R TVI+S+IL +    +Y  K      ++S     + AS+I+ 
Sbjct: 100 LDIVAVGQFGLPTIVFQRVTVIVSEILLFVVLQVYINK--SHISDRS--ANFVVASSIVL 155

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I     + Y +    F  ++CFK + LY AP FFA
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 246 YLLSRSLL------FPKFN--IARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIHRI 297
           +LL   +L      F  +N  I+                   + F    +  + Q + R+
Sbjct: 216 FLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCF-APFIYQLPQLMSRL 274

Query: 298 FPFARGIFEDKVA-NFWCVTNVFVKYKERFTIQQLQLYSLIATVIG 342
           FPF+RG+     A NFW + +   K    F ++   ++  +  V+ 
Sbjct: 275 FPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVS 320

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  104 bits (259), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 96/191 (50%), Gaps = 17/191 (8%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LP+SKWY+     W LDYPP  A+  + L    S F P    + + 
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFL----SQFVPK---VVRD 118

Query: 129 RG----FESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASA 182
            G     E    GL T  + R TVI SDIL +    +Y        R+QS     + AS+
Sbjct: 119 DGCLDIVEVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASS 174

Query: 183 ILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPI 242
           I+  P   +IDH HFQYN  +  +   +I     + Y + A+ +  +ICFK + LY AP 
Sbjct: 175 IVLSPGFFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPC 234

Query: 243 FFAYLLSRSLL 253
           +F +LL   +L
Sbjct: 235 YFVFLLRAYVL 245

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  104 bits (259), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 119/260 (45%), Gaps = 23/260 (8%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  A+  + L    S F P     +  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFL----SQFVPKSVRDDGC 121

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILF 185
               E    GL T  + R TVI S+IL +    IY        R+QS     + AS+I+ 
Sbjct: 122 LDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVL 177

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I    ++ Y + AV +  +ICFK + LY AP +F 
Sbjct: 178 SPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFV 237

Query: 246 YLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIH---------QCIHR 296
           +LL   +L    N  +                  L  +  G+  I          Q + R
Sbjct: 238 FLLRAYVL--NVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPFAHQMPQVLSR 295

Query: 297 IFPFARGIFEDKVA-NFWCV 315
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 121/266 (45%), Gaps = 35/266 (13%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  A+  + L    S F P    + + 
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFL----SQFVPK---VVRD 118

Query: 129 RG----FESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASA 182
            G     E    GL T  + R TVI S+IL +    IY        R+QS     + AS+
Sbjct: 119 DGCLDIVEVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASS 174

Query: 183 ILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPI 242
           I+  P  ++IDH HFQYN  +  +   +I    ++ Y   AV +  SICFK + LY AP 
Sbjct: 175 IVLSPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPC 234

Query: 243 FFAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIH----------- 291
           +F +LL   +L    N+                    L+ LG  +  I            
Sbjct: 235 YFVFLLRAYVL----NVNNFKFKSYKDFLFLIRWTN-LFKLGSIVIGIFTICFLPFAHQM 289

Query: 292 -QCIHRIFPFARGIFEDKVA-NFWCV 315
            Q + R+FPF+RG+     A NFW +
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWAL 315

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 121/266 (45%), Gaps = 35/266 (13%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  A+  + L    S F P    + + 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFL----SQFVPK---VVRD 118

Query: 129 RG----FESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASA 182
            G     E    GL T  + R TVI S+IL Y    IY        R+QS     + AS+
Sbjct: 119 DGCLDIVEVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASS 174

Query: 183 ILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPI 242
           I+  P  ++IDH HFQYN  +  +   +I    ++ Y + A  +  +ICFK + LY AP 
Sbjct: 175 IVLSPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPC 234

Query: 243 FFAYLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIH----------- 291
           +F +LL   +L    N+                    L+ LG  +  I            
Sbjct: 235 YFVFLLRAYVL----NVNNFKFKSYKDFLFLIRWAN-LFKLGSIVIGIFTICFVPFAHQM 289

Query: 292 -QCIHRIFPFARGIFEDKVA-NFWCV 315
            Q + R+FPF+RG+     A NFW +
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWAL 315

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  101 bits (252), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/266 (28%), Positives = 118/266 (44%), Gaps = 17/266 (6%)

Query: 66  LYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLI--GSFFNPSWF 123
           L  DF+  R+W+ IT  LPL +WY+ +   W LDYPP  A+  + L  +           
Sbjct: 41  LSTDFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCL 100

Query: 124 ALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAI 183
            + K   F  P      + R TVI S+IL +    +Y  K     R+       + AS+I
Sbjct: 101 DIVKVGQFGMPT---IVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSI 153

Query: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIF 243
           +  P  ++IDH HFQYN  +  +   +I    ++ Y +  + F ++ICFK + LY AP F
Sbjct: 154 VLSPGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSF 213

Query: 244 FAYLLSRSLL-FPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGG------LKNIHQCIHR 296
           F +LL   +L F  F+                     +     G      +    Q + R
Sbjct: 214 FVFLLRVYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPFISQWPQLLSR 273

Query: 297 IFPFARGIFEDKVA-NFWCVTNVFVK 321
           +FPF+RG+     A NFW + ++  K
Sbjct: 274 LFPFSRGLTHAYWAPNFWAMYSLLDK 299

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  101 bits (251), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 118/261 (45%), Gaps = 25/261 (9%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+WM IT  LP+SKWY+ +   W LDYPP  A+  + L    S F P    + + 
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFL----SQFVPK---IVRD 161

Query: 129 RG----FESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASA 182
            G     E    G  T  + R TVIIS+I  +     Y        R QS     + AS+
Sbjct: 162 DGCLDIVEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASS 217

Query: 183 ILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPI 242
           I+  P  +++DH HFQYN+ +  +   +I     + Y   AV + +++CFK + LY AP 
Sbjct: 218 IVLSPGFLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPC 277

Query: 243 FFAYLLSRSLL-FPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLK------NIHQCIH 295
           +F +LL   +L F  F                      +     G+        + Q + 
Sbjct: 278 YFVFLLRAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPFIFQMPQVLS 337

Query: 296 RIFPFARGIFEDKVA-NFWCV 315
           R+FPF+RG+     A NFW +
Sbjct: 338 RLFPFSRGLTHAYWAPNFWAI 358

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 121/267 (45%), Gaps = 25/267 (9%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LPL +WY+     W LDYPP  A+  + L    S F PS+    KS
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFL----SQFVPSYV---KS 88

Query: 129 RG----FESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASA 182
            G     E    G+ T  + R TVI S+IL +    +Y        R QS     + AS+
Sbjct: 89  DGCLDIVEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASS 144

Query: 183 ILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPI 242
           I   P  ++IDH HFQYN  +  +   +I    ++ Y      + +++CFK + LY AP 
Sbjct: 145 IAISPGFLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPC 204

Query: 243 FFAYLLSRSLLFP---KFNIARXXXXXXXXXXXXXXXXXPL----YFLGGGLKNIHQCIH 295
           +F +LL   +L     KF   R                  +       G  + ++ Q + 
Sbjct: 205 YFVFLLRAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGPFIFDLPQLLT 264

Query: 296 RIFPFARGIFEDKVA-NFWCVTNVFVK 321
           R+FPF+RG+     A NFW + +   K
Sbjct: 265 RLFPFSRGLTHAYWAPNFWAIYSTIDK 291

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 119/260 (45%), Gaps = 23/260 (8%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LPL +WY+     W LDYPP  A+  +LL    S F P    +++ 
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLL----SQFVPK--IVKED 108

Query: 129 RGFESPDNG-----LKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAI 183
              +  + G        + R TVI S++L +    ++        + +S     + AS+I
Sbjct: 109 GALDIVEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSI 164

Query: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIF 243
           +  P  ++IDH HFQYN  +      +I     + Y   A  + +++CFK + LY AP +
Sbjct: 165 VLSPGFLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCY 224

Query: 244 FAYLLSRSLL-FPKFNIARXXXXXXXX----XXXXXXXXXPLYFLGGG--LKNIHQCIHR 296
           F +LL   +L F  F                          ++F+  G  L ++ Q + R
Sbjct: 225 FVFLLRAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLYDLPQVMTR 284

Query: 297 IFPFARGIFEDKVA-NFWCV 315
           +FPF+RG+     A NFW +
Sbjct: 285 LFPFSRGLTHAYWAPNFWAI 304

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 116/263 (44%), Gaps = 29/263 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LPL +WY+     W LDYPP  A+  + +    S F P     +  
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFM----SQFVPKVVRDDGC 109

Query: 129 RGFESPDN---GLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILF 185
                          + R++VIIS+IL +     +  K     R QS     I A++I+ 
Sbjct: 110 LDIVPVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIIL 165

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I     E Y +  + + +++CFK + LY AP +F 
Sbjct: 166 SPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFV 225

Query: 246 YLLSRSLLFPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIH------------QC 293
           +LL   +L    N+ +                  L+ LGG + +I             Q 
Sbjct: 226 FLLRAYVL----NV-KNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPFIYHLPQV 280

Query: 294 IHRIFPFARGIFEDKVA-NFWCV 315
             R+FPF RG+     A NFW +
Sbjct: 281 FTRLFPFGRGLTHAYWAPNFWAI 303

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 129/296 (43%), Gaps = 27/296 (9%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFF-----NPSWF 123
           DF+  R+W+ +T  LPL +WY+     W LDYPP   F +Y   +I  F      +    
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPP---FFAYFEWIISQFVPQVVRDDGCL 112

Query: 124 ALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQS-IAASA 182
            + +   F  P      + R +VI S+IL +        +W     N     QS I A++
Sbjct: 113 DIVEIGKFGEPT---VIFQRLSVITSEILLFV-----VLQWFINTSNVKERTQSFIVATS 164

Query: 183 ILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPI 242
           I+  P  +++DH HFQYN  +  +   +I     + Y + AV +  ++CFK + LY AP 
Sbjct: 165 IILSPGFLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPC 224

Query: 243 FFAYLLSRSLLFPK-------FNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQCIH 295
           +F +LL   +L  K        ++ R                      G  + ++ Q + 
Sbjct: 225 YFVFLLRAYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGVCFGPFIFDMPQLLT 284

Query: 296 RIFPFARGIFEDKVA-NFWCVTNVFVKYKERFTIQQLQLYSLIATVIG--FLPAMI 348
           R+FPF+RG+     A NFW + +   K      ++   +++L    I   F PA I
Sbjct: 285 RLFPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPATI 340

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score = 98.2 bits (243), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 129/293 (44%), Gaps = 35/293 (11%)

Query: 44  VCAVILRCTIGLGPYSGKGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPL 103
           VC+  L+  +  G +S         DF+  R+W+ IT  LPL +WY      W LDYPP 
Sbjct: 31  VCSTCLKLLLIPGYFST--------DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPF 82

Query: 104 TAFHSYLLGLIGSFFNPSWFALEKSRG----FESPDNGLKT--YMRSTVIISDILFYFPA 157
            A+  + L    S F P    + +  G     E  + G+ T  + R TVI+S++L +   
Sbjct: 83  FAYFEWFL----SQFVPK---IVRDDGCLDIVEVGNFGMPTIIFQRITVIVSEVLLFVVL 135

Query: 158 VIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDE 217
            I+  K     ++       I AS+I+  P  +++DH HFQYN  +  +   AI      
Sbjct: 136 QIFINKSATNEKS----ANFIVASSIVLSPGFLIVDHIHFQYNGFLFAILIAAIVAAKHH 191

Query: 218 YYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL-FPKFNIARXXXXXXXXXXXXXXX 276
            Y +    F  ++CFK + LY AP FF +LL   +L F  F   +               
Sbjct: 192 RYLLCGAFFATALCFKHIFLYLAPSFFVFLLRAYILDFTNFKF-KSYKDLVSIVKWQRAL 250

Query: 277 XXPLYFLG-------GGLKNIHQCIHRIFPFARGIFEDKVA-NFWCVTNVFVK 321
              L  LG         +  + Q + R+FPF+RG+     A NFW + ++  K
Sbjct: 251 KLGLVVLGIFAVCFAPFISEMPQLLERLFPFSRGLTHAYWAPNFWALYSLLDK 303

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 120/264 (45%), Gaps = 31/264 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  LPL +WY+     W LDYPP  A+  ++L    S F P+  A+   
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVL----SQFVPA--AVRAD 106

Query: 129 RGFESPDNGL-----KTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQS----IA 179
              +    G+       + R TVI S++L +    +Y         N SP  +     + 
Sbjct: 107 GCLDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYI--------NTSPPAEKTQSFVV 158

Query: 180 ASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYY 239
           AS+I+  P L+++DH HFQYN  +  +   +I       + + A  +  ++CFK + LY 
Sbjct: 159 ASSIVLSPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYL 218

Query: 240 APIFFAYLLSRSLL-FPKF------NIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIHQ 292
           AP +F +LL   +L F  F      ++ R                  +       +++ Q
Sbjct: 219 APCYFMFLLRTYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPFARDMPQ 278

Query: 293 CIHRIFPFARGIFEDKVA-NFWCV 315
            + R+FPF+RG+     A NFW +
Sbjct: 279 LLSRLFPFSRGLTHAYWAPNFWAL 302

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 113/263 (42%), Gaps = 29/263 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLI--GSFFNPSWFALE 126
           DFE  R+W+ +T  LPL KWY      W +DYPPL A+  + L  +  G+        L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 127 KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQ 186
               +  P      + R TVI S++L Y    +Y +    + R  +     +  +++   
Sbjct: 119 AEGRYGWPT---VVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALS 171

Query: 187 PSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAY 246
           P+ +L+DH HFQYN  +  +   +I    +  Y +    F +++C K + LY AP +F +
Sbjct: 172 PAFLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVF 231

Query: 247 LLSRSLL-FPKFNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNIH------------QC 293
           LL   +L   +F                      L  LGG +  I             Q 
Sbjct: 232 LLRAYVLDLGEFRF------RSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAPFAGVMPQL 285

Query: 294 IHRIFPFARGIFEDKVA-NFWCV 315
           + R+FPF+RG+     A NFW +
Sbjct: 286 MARLFPFSRGLTHAYWAPNFWAI 308

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score = 95.9 bits (237), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 129/293 (44%), Gaps = 21/293 (7%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKS 128
           DF+  R+W+ IT  + L  WY+     W LDYPP  A+  + +    S   PS+   +  
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFI----SHLVPSFVRRDGC 119

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILF 185
               E    G  T  + R TVI S+ L +    IY        R QS     I AS+I+ 
Sbjct: 120 LDIVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVL 175

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  +++DH HFQYN  +  +   +I    ++ Y + A+ + +++CFK + LY AP +F 
Sbjct: 176 SPGFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFV 235

Query: 246 YLLSRSLL-FPKFNIARXXXXXXXXXXXXXXXXXPLYF------LGGGLKNIHQCIHRIF 298
           +LL   +L F  F                      +         G  + ++ Q + R+F
Sbjct: 236 FLLRVYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGPFIFDMPQLLSRLF 295

Query: 299 PFARGIFEDKVA-NFWCVTNVFVKYKERFTIQQLQLYSLIATVIG--FLPAMI 348
           PF+RG+     A NFW + +   K    F ++   +++  A  I    LP+ I
Sbjct: 296 PFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSI 348

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 109/266 (40%), Gaps = 35/266 (13%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLG--LIGSFFNPSWFALE 126
           D E  R+W+ +T  LPL  WY      W LDYPP  A+  ++L   +     +     + 
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 127 KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQ 186
           K   F  P      ++R TVI ++IL +    +    ++            I AS+I   
Sbjct: 153 KEGKFGWPT---VVFLRLTVIGTEILLF----VVLQVFINTSDESERTVNFIIASSIALS 205

Query: 187 PSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAY 246
           P  +++DH HFQYN  +  +   +I     E Y +    F   +CFK + LY AP +F +
Sbjct: 206 PGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTF 265

Query: 247 LLS--------------RSLLFPK--FNIARXXXXXXXXXXXXXXXXXPLYFLGGGLKNI 290
           LL               R L+F    FN+ +                 P+         +
Sbjct: 266 LLRAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV---------L 316

Query: 291 HQCIHRIFPFARGIFEDKVA-NFWCV 315
            Q I R+FPF+RG+     A NFW V
Sbjct: 317 PQLISRLFPFSRGLTHAYWAPNFWAV 342

>ZYRO0D01914g Chr4 complement(154320..155147) [828 bp, 275 aa] {ON}
           similar to uniprot|P47153 Saccharomyces cerevisiae
           YJR116W Hypothetical ORF
          Length = 275

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 117 FFNPSWFALEKSRGFESPD--------NGLKTYMRSTVIISDILFYFPAVIYFTKWLGRY 168
           F N +WF  + SRG   P         NGL   + +   I  IL+ F A++   + + + 
Sbjct: 170 FVNNNWFITQLSRGASKPPVPFWFNVLNGL--LLMAVFFIVRILWGFAAIVLLVQQMWKV 227

Query: 169 RNQSPIGQS 177
           R+Q PI Q+
Sbjct: 228 RDQLPIFQT 236

>TDEL0E01430 Chr5 complement(286064..287428) [1365 bp, 454 aa] {ON}
           Anc_4.229 YDL054C
          Length = 454

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%)

Query: 300 FARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLL 359
            A G  E  VAN   ++N+      + + Q L +Y+L +T    L  ++  +L  KK   
Sbjct: 261 LALGPLEMFVANMGSLSNLISNDSAQLSNQMLSIYALSSTAARILTGLLTDVLSAKKISA 320

Query: 360 PYVLIA 365
            ++LIA
Sbjct: 321 KWILIA 326

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.143    0.476 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,380,684
Number of extensions: 2381830
Number of successful extensions: 6249
Number of sequences better than 10.0: 44
Number of HSP's gapped: 6274
Number of HSP's successfully gapped: 44
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)