Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR001W (RRP6)6.25ON73373336210.0
Smik_15.1706.25ON77373328880.0
Skud_15.1626.25ON73473428270.0
Suva_15.1766.25ON74573327760.0
NCAS0H008606.25ON75576319400.0
KAFR0G026606.25ON73574319090.0
SAKL0E01452g6.25ON73774518870.0
KNAG0M012306.25ON73874517880.0
Kpol_1037.296.25ON74671717600.0
ZYRO0C07678g6.25ON74161217540.0
TBLA0A071706.25ON77172417520.0
NDAI0D008506.25ON79071717500.0
TPHA0J003706.25ON74375517420.0
KLLA0D01309g6.25ON74475717380.0
CAGL0E02585g6.25ON73774117220.0
TDEL0G044406.25ON73568917090.0
ACL001C6.25ON74575217040.0
Ecym_30306.25ON74772516660.0
Kwal_56.224476.25ON73550116090.0
KLTH0C11066g6.25ON73550915460.0
KAFR0G004208.860ON37451715.3
TPHA0I027701.290ON129173725.5
KLTH0D11616g8.691ON302120715.5
TBLA0H008308.403ON679115709.1
SAKL0H14652g8.362ON69691709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR001W
         (733 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...  1399   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...  1117   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...  1093   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...  1073   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   751   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   739   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   731   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   693   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   682   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   680   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   679   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   678   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   675   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   674   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   667   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   662   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   660   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   646   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   624   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   600   0.0  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     32   5.3  
TPHA0I02770 Chr9 (610421..614296) [3876 bp, 1291 aa] {ON} Anc_1....    32   5.5  
KLTH0D11616g Chr4 complement(951182..952090) [909 bp, 302 aa] {O...    32   5.5  
TBLA0H00830 Chr8 complement(184669..186708) [2040 bp, 679 aa] {O...    32   9.1  
SAKL0H14652g Chr8 (1272436..1274526) [2091 bp, 696 aa] {ON} weak...    32   9.7  

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score = 1399 bits (3621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/733 (94%), Positives = 691/733 (94%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGF             MANEIILSI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
           KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
           HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540
           IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540

Query: 541 QIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIR 600
           QIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIR
Sbjct: 541 QIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIR 600

Query: 601 IRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLXXX 660
           IRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVL   
Sbjct: 601 IRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLKKK 660

Query: 661 XXXXXXXXXXXGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNXXXXXXXX 720
                      GVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSN        
Sbjct: 661 NIQKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNGPRAAKKR 720

Query: 721 XXXXXXXNLSFKR 733
                  NLSFKR
Sbjct: 721 RPAAKGKNLSFKR 733

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/733 (73%), Positives = 615/733 (83%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M S+NPDVLLS+V+NV+RAASSLA QDVDFYKNLDR F             MANEIILSI
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           DEHHESFELK+EDIS LWN+FGNIMDNLLEMSDHSLDKLN A+ SK  G+DLQYLG+FS 
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
           KN SP KRVEKPQLKFK+PIDNSESHPFIPLLKEKPNALKPLS+SLRL+++D+N PSHYP
Sbjct: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
           HPYEYEIDHQEY   ILQIR+EIPSKSW+DS PIW+DT  +LESMLE+LKN +EIAVDLE
Sbjct: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQISTRE+DYLVDTL+LRE LHILNEVFT+PSIVKVFHGAFMDIIWL
Sbjct: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPM A
Sbjct: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRP  PSSEVYSPIE
Sbjct: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           KE+PW++LMYQYNI  E+E LV++LYQWRD+IARRDDESPRFVMPNQLLAALVAYTP DV
Sbjct: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540
           IGV+SLTNG+TEHVRQNAK+L NLI+++LR+IK+T +E +P+  SE+  + + LE I++P
Sbjct: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIP 580

Query: 541 QIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIR 600
           QIRD+MERFSVL NSN+S  RAK     SILLG+ILP EE+DIAY  +GLPN+VK EDIR
Sbjct: 581 QIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIR 640

Query: 601 IRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLXXX 660
            RAQ+F SAL+NLED + E+EKP ++P  +++I+ ++    P HS  I+N DD+VVL   
Sbjct: 641 ARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSATIENPDDIVVLKKK 700

Query: 661 XXXXXXXXXXXGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNXXXXXXXX 720
                          + A+DYSKIPN+LS+K  QN RQQKKRR DP  +DS+        
Sbjct: 701 NIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPRAAKKK 760

Query: 721 XXXXXXXNLSFKR 733
                  N+SFKR
Sbjct: 761 RPATRGRNVSFKR 773

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/734 (73%), Positives = 606/734 (82%), Gaps = 1/734 (0%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M SENPDVL S+++ VVRAASSLASQDVDFYKNL+R F             M NEIILSI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           DEHHESFELKE++IS LW +FGNIMDNLLEMSDHSLDKLN   NSK  G++LQYLG+FSG
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
           K+   TKR+EKPQLKFK  IDNSESHPFIPLLKEKPNALKPLSESLRL + +ENNPSHY 
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
           HPY YEIDHQEYS ++LQI++EIPSKSWDDS PIW+DT T+L  MLEDLKN  EIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+STRERDYLVDT++LR+ LHILNEVFT+P IVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWR RPLSKPMTA
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSK+RP TPSSEVYSPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           KE+PW++LMYQYNI  E+E LV++LY WRD IARRDDESPRFVMPNQLLAALVAY P DV
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540
           IGVVSLTNGVTEHVRQNAK+LANLI +AL NIK+TN++ T I SSE+K DGI LE I++ 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVITIS 540

Query: 541 QIRDVMERFSVLCNSNISKSRAKPV-TNSSILLGKILPREEHDIAYSKDGLPNKVKTEDI 599
           QIRD+MERFS+L NS +  +R K   + SSILLGK LP EE  I+Y K G PNKVK EDI
Sbjct: 541 QIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDI 600

Query: 600 RIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLXX 659
           + RAQ F SALA LE+I+FE+EKP+ VP  +E+ + V+  SAP    + ++ DD++VL  
Sbjct: 601 KARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVLKK 660

Query: 660 XXXXXXXXXXXXGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNXXXXXXX 719
                        +T K+AVDYSK+P++LS+KPGQN +QQ+KRRFDPSS+DS        
Sbjct: 661 KKMHKKQPAKGKDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGPRAAKK 720

Query: 720 XXXXXXXXNLSFKR 733
                   N+SFKR
Sbjct: 721 KRPAPRGKNMSFKR 734

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score = 1073 bits (2776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/733 (71%), Positives = 605/733 (82%), Gaps = 6/733 (0%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M SEN DVLLS+V+NV+RAASSLA+QDVDFY+NLDR F             M N I+LSI
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           DEHH+S ELKEE+ISDLW +FGNIMDNLLE SDHSLD LN   NS +  +DLQYLG+FSG
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
           K+  PTKRVEKPQLKFK+PIDNSESHPFIPLLKEKPNALKPLS+SLR+++ +EN+P HYP
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
           HPYEYEIDHQEY+P ILQI+ EIPSK WD S PIW+++   L+SMLEDLKN  EIAVDLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHDYRSYYG+VCLMQ+STRERDYLVDTL+LRE+LHILNEVFTNPSIVKVFHGAFMDIIWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRP+TPSS+VYSP E
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           KE+PW++LMYQYNI PERE LV++LY+WRD+IARRDDESPRF+MPNQLLAALVAYTP DV
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540
           IGVVSL+NGVT+HVRQNAK+LANLI+ ALR++K+T++E+  I SS+ K+    LE I+V 
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSAS--LEAITVS 556

Query: 541 QIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIR 600
           QIRD+M+RFSV  ++++++ R+   T SSIL GKILP EE DI Y   GLP+KVK ED+R
Sbjct: 557 QIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDMR 616

Query: 601 IRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLXXX 660
            RAQ F SAL  LEDI FE+EK    PV +E+ + V   + P    +I++ D++VVL   
Sbjct: 617 DRAQRFNSALVGLEDIKFEVEK----PVNVEKSEMVKIETTPEPPTKIEDPDEVVVLKKK 672

Query: 661 XXXXXXXXXXXGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNXXXXXXXX 720
                       V  ++AVDYSKIPN+LS+KPGQNN+QQ+KRRFDPS +DS         
Sbjct: 673 RIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDSEGPRAPKKK 732

Query: 721 XXXXXXXNLSFKR 733
                  N+SFKR
Sbjct: 733 RPTTRGKNVSFKR 745

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/763 (51%), Positives = 516/763 (67%), Gaps = 43/763 (5%)

Query: 2   TSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSID 61
           + E    LL +V+N VRAAS+LA+QDVDFY+++D+               M N ++LSID
Sbjct: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64

Query: 62  EHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGK 121
           E+ E  +  +E++ D+W +FGN+MDNL E SD S+D +       +  S +QY+ EFSG+
Sbjct: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124

Query: 122 NFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPH 181
           + +P K++ KPQLKF +PIDN+ESHPFIPLLKEKP ALKPL ES++++ +DE +P HYP 
Sbjct: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184

Query: 182 PYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEH 241
           PYEYEIDHQEY+  ILQ ++ IPS SW D+ PIWVDT ++L+S++ DL+ + EIAVDLEH
Sbjct: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244

Query: 242 HDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQ 301
           HDYR+YYGI CLMQISTR+ DYL+DTL LRE+L ILN VF NP I KVFHGAFMDIIWLQ
Sbjct: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304

Query: 302 RDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAY 361
           RDLGLYVVGLFDT+HAS+A+GLP+HSLAYLLE FA FKTSKKYQLADWRIRPLSK M AY
Sbjct: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364

Query: 362 ARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRP--LTPSSEVYSPI 419
           ARADTHFLLNI+DQ+RN LIE NKLAGVL ESRNVAKRRFEYS +RP  L  +  VYSPI
Sbjct: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424

Query: 420 EKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTD 479
           EK+ PWK +M+QYNIPP++E L++ELYQWRD IARRDDESPRFVMPNQLL +LVAYTP D
Sbjct: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484

Query: 480 VIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIK-------NTNEEATPIPSSETKADGI 532
             GVVS++N VT++VR N+K+LANLI++ L  +K       N  EE   +   ET  D  
Sbjct: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISV-VPETGHD-- 541

Query: 533 LLETISVPQIRDVMERFSVLCNSNISKSRAKPVTNSSI-LLGKILPREEHDIAYSKDGLP 591
           L + +++ Q++++  +F +L +   +  + +   +  + L   I   ++  I Y  DG  
Sbjct: 542 LSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADG-- 599

Query: 592 NKVKT--EDIRIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAP------N 643
            K++T  E  + R++ F  A+  LE++ +       +PV  E  +T D  + P      N
Sbjct: 600 -KIQTTAEQYKERSEQFDDAMKQLEEVEY------CIPVIEENKQTQDQDNIPPITVATN 652

Query: 644 HSPEI-------DNLDDLVVLXXXXXXXXXXXXXXGVTEK--DAVDYSKIPNILSN---- 690
              ++       ++LD+++VL                 E   + +DY K   +L+N    
Sbjct: 653 AEGQVNEMIEKPEDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNS 712

Query: 691 KPGQNNRQQKKRRFDPSSSDSNXXXXXXXXXXXXXXXNLSFKR 733
           + G+NN   K++RFDP S+ +                N+SFKR
Sbjct: 713 RGGRNNNGNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/743 (51%), Positives = 493/743 (66%), Gaps = 19/743 (2%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M  E    LLS V+N VRA+S+LA+QDVDFY++LD                M N IILSI
Sbjct: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           DE++E+ +  +E++++ W +  NI+DNL E SD SLD L      K      +Y    + 
Sbjct: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
               P KR+ KPQLKF  PIDNSESHPFIPLLKEKPNALK + ES +L++ DEN P HY 
Sbjct: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
           HPYEYEID+Q Y+  ILQ+RE IPSKSW ++  +WVD    L  ML D+K   EIA+DLE
Sbjct: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHDYR+YYGIVCLMQISTRE DYLVDT+ LR +L +LNEVFT+PS+VKV HGAFMDIIWL
Sbjct: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLY+V LFDT+HAS+A+G PRHSLAYLLE FANFKTSKKYQLADWR+RPLSK MTA
Sbjct: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRN+L+E+NKL GVL ESRNVAKRRFEYSK+RP  PS  VYS +E
Sbjct: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           KE PW+ LM+QYNIP ERE L++ L++WRD+IARRDDESPR++MPNQL+  LVAYTPTD 
Sbjct: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540
            GV+S +  VT++VR N+K++ANLI++AL   K+ N +   +  + T+      + ++V 
Sbjct: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540

Query: 541 QIRDVMERFSVL------CNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKV 594
           QI++    F  +      CN++  +S++   +N    L K L     DI   K+G  + V
Sbjct: 541 QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKL-----DIIEYKNGEKHSV 595

Query: 595 KTEDIRIRAQNFKSALANLEDIIFEI----EKPLVVPVKLEEIKTVDPASAPNHSPEIDN 650
           K + +  R   +   +  L ++ +E+    E P +    +EE+K    A +    PEID 
Sbjct: 596 KQQQLVSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEID- 654

Query: 651 LDDLVVLXXXXXXXXXXXXXXGVTEK-DAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSS 709
           LD++VVL                 EK D +DYSK   IL     +  R+ KKR+FDP ++
Sbjct: 655 LDEVVVLKKVNRQPNKTKLEEN--EKIDFIDYSKSEKILKGDKQRKKRESKKRQFDPFAA 712

Query: 710 DSNXXXXXXXXXXXXXXXNLSFK 732
            +                NLS+K
Sbjct: 713 SNEGPKAARKRKSGTRGRNLSYK 735

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/745 (51%), Positives = 511/745 (68%), Gaps = 22/745 (2%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M+S+ PD LLS ++  VRAAS+L++QD+DF+K+LD G              + NE++LSI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRG-SDLQYLGEFS 119
           DE++++ E  +++  + W + G+IMDNL E SDH+ D L    NS ++G S++QYL + S
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKR--NSINQGNSNVQYLDDSS 118

Query: 120 GKNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHY 179
             N +P+KR+EKPQL FK+PIDN+ESHPF PLL+ KP+AL+PLSE L+   + EN PSHY
Sbjct: 119 RSNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHY 178

Query: 180 PHPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDL 239
           PHPY YEID QEY+  ILQIR+ IPS+ W+D+ P+WVDT   L+ +L +L++ KEIAVDL
Sbjct: 179 PHPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDL 238

Query: 240 EHHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIW 299
           EHHDYRSYYGIVCLMQISTRERD+LVDT+ LRE LH+LNE+FT+PS++KVFHGAFMDIIW
Sbjct: 239 EHHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIW 298

Query: 300 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 359
           LQRDLG+YVV LFDTYHAS+++GLPRHSLAYLLE FA FKTSKKYQLADWRIRPL+KPM 
Sbjct: 299 LQRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMR 358

Query: 360 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPI 419
           AYARADTHFLLNIYDQLRN LIE NKLA VL++SRNVAKRRFEY+ +RP   S++V+SPI
Sbjct: 359 AYARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPI 418

Query: 420 EKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTD 479
           EK+ PW+ LMYQYNIP  RE L+R+LY+WRD IARRDDESPR+VMPNQLL +LVA  PTD
Sbjct: 419 EKDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTD 478

Query: 480 VIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISV 539
             GV+S++N +T++VR N+K+L+NLI+  L ++KN +       SS+ +    L + +S+
Sbjct: 479 PAGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKD-LSQVLSI 537

Query: 540 PQIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDI 599
            QI+++  +F+ L       S+ K   +++  + K+    + D  +S D      K   I
Sbjct: 538 SQIQNMCLQFNSLA------SKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKI 591

Query: 600 RIRAQNFKSALANLEDIIFEIEKP---LVVPVKLEEI----KTVDPASAPNHSPEID--- 649
            I     +     + + + E+++P   L V V  +E     K V      N + E D   
Sbjct: 592 VIDENQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLE 651

Query: 650 -NLDDLVVLXXXXXXXXXXXXXXG-VTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPS 707
            N D+++VL              G  T+ + +DY     +L N    + ++  KRRFDP 
Sbjct: 652 TNKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPY 711

Query: 708 SSDSNXXXXXXXXXXXXXXXNLSFK 732
           +S++                N+SFK
Sbjct: 712 TSENVGPQSAKKRKKPTPGKNMSFK 736

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/745 (49%), Positives = 487/745 (65%), Gaps = 19/745 (2%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M SE    LLS+ +  VRA+SSL  QDV F+ NLD                M N+I+ SI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSR-GSDLQYLGEFS 119
           DE+ + F    E + + W +F N+ DNL E SD S+D +        + GS++QYL +  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 120 GKNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHY 179
           G + S  KR+ KPQL F  P+DNSES PF PLL EKPNALKPL ESL++V   EN PSHY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 180 PHPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDL 239
           P+PY+YEI +QEY+ +IL+ R  IPS  W +S P+WVD++  L+S+L+DLK  KE+A+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 240 EHHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIW 299
           EHHDYRSYYGIVCLMQISTR+ DYLVDT+ LR+ LHILN+VFT+P + KVFHGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 300 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 359
           LQRDLGLY+V LFDT+HASKA+G P+HSLAYLLE  ANFKTSKKYQLADWRIRPLSKPM+
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 360 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPI 419
            YARADTHFLLNI+DQ+RN+LI+ NKLAGVL ESR VAKRRFEYSK+RP     +V++PI
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 420 EKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTD 479
           EKESPW+ LM+QYN+ PE+E LV+ LY+WRD IARRDDESPR++MPNQLL +L AYTPTD
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 480 VIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISV 539
            + +VS+ + VT+ VR N+K+LANLI+  + + K    +++  P++E  +   +L   ++
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSK-LGPQSSYTPNTENTSTPFVL---TL 536

Query: 540 PQIRDVMERFSVLCNSNISKSRAK--PVTNSSILLGKILPREEHDIAYSKDGLPNKVKTE 597
            QI+D+  RF+ L  +  S S  K  P+  SS      L + +  ++Y+ D     V   
Sbjct: 537 SQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD--LSKGKVTVSYN-DAKTTPVSQS 593

Query: 598 DIRIRAQNFKSALANLEDIIFEIE---KPLV---VPVKLEEIKTVDPASAPNHSPEI-DN 650
            +  R++ F   +    DI ++I    +P++   +P      ++ D  +       I ++
Sbjct: 594 VLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKED 653

Query: 651 LDDLVVLXXXXXXXXXXXXXXGVTEKDAVDYSKIPNILSNKP--GQNNRQQKKRRFDPSS 708
           +D++VVL                 E++ VDYSK   +L  +    +      K+RFDP S
Sbjct: 654 MDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFS 713

Query: 709 SDSNXXXXXXXXXXXXXXXNLSFKR 733
           + S                N SFKR
Sbjct: 714 AISEGPKAPKKRKAVTKGKNASFKR 738

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/717 (49%), Positives = 484/717 (67%), Gaps = 27/717 (3%)

Query: 9   LLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSIDEHHESFE 68
           LLS V++ VRAASSLA+QDVDFY+NLD+               M N ++LSI+E++E  E
Sbjct: 9   LLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELE 68

Query: 69  LKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPTKR 128
             +E +   W +F N+MDNL E SD SLD +  +  S    S+ QYL + +  + +P+KR
Sbjct: 69  SGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKR 128

Query: 129 VEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEID 188
           V KPQL+F  P+DNSES PF+PLL +KP+++K  ++SL ++ + E  PSHY HPYE EID
Sbjct: 129 VTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEID 188

Query: 189 HQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYY 248
            QEY+  +LQ+ E + S+ W+ S   WVDTS  L+SML+ LK   EIAVDLEHHDYRSYY
Sbjct: 189 KQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYY 247

Query: 249 GIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYV 308
           GIVCLMQISTR+ D+LVDTL LR+ LHILNEVF +P+I+KV HGAFMDIIWLQRDLGLYV
Sbjct: 248 GIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYV 307

Query: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHF 368
           V LFDTYHAS+A+G PRHSLAYLLE +ANFKTSKKYQLADWR+RPLSKPM AYARADTHF
Sbjct: 308 VSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHF 367

Query: 369 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPWKIL 428
           LLNIYDQ+RN+LI  NKLA VL+ESRNVAKRRFEYS++RP  PS  V++PIEKE PW+ L
Sbjct: 368 LLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTL 427

Query: 429 MYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTN 488
           +YQYN+P  +  L++ +++WRD+IARRDDESPR++MPNQL+ +LV YTP D  GV+S++N
Sbjct: 428 VYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSN 487

Query: 489 GVTEHVRQNAKLLANLIRDALRNIKNTNEEA-TPIPSSETK-ADGILLETISVPQIRDVM 546
            +T+HVR N+K++ANLI+ +L ++K+    A T   + + K       + +++ QI+++ 
Sbjct: 488 VMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMT 547

Query: 547 ERFSVLCN--SNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIRIRAQ 604
             F  + +  S I K  +K +    IL   I   +   + Y  D   + V  E +  RA+
Sbjct: 548 ALFKEIASNPSIIEKDVSKKI--DPILFSNIFLSKNEIVLYDHDKR-HVVTNEQLAGRAE 604

Query: 605 NFKSAL--ANLEDIIFEIEKPLVVPVKLEE-----------IKTVDPASAPNHSPEIDNL 651
             +  +  AN   +   IE    + V+  E           I  V+ AS+ N +   +++
Sbjct: 605 EVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSN-TDGFEDM 663

Query: 652 DDLVVLXXXXXXXXXX--XXXXGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDP 706
           +D++VL                G+  K+ +DYSK+  ILS +  +N+   KKR+ DP
Sbjct: 664 NDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSKEKRENS---KKRKGDP 717

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/612 (56%), Positives = 437/612 (71%), Gaps = 5/612 (0%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M  E+ + LL +V+  VRAA++LA+QDVDFY++LD+G              M N  +L I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           D++    E  +E + D   +F N+MDNL E SD SLD L      + +G+ L YL + + 
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDR-KGAALMYLDDAAR 119

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
            +  P KR+ KPQ++F+ PIDN+E+HPF PLL+ KP+AL+PLS+ +RLV  DE+ P HYP
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
            PYEYEI++QEY+  IL+I E IPSK WD S P+WVD    L+SML+DLK + EIAVDLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+STR+ DYLVDTL LR++L +LNEVF NP IVKVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSKKYQLADWR+RPLSK M+A
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLI  NKLAGVL ESRNVAKR F+YSKYRP  P+S VYSP++
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           +   WK+LM QYNIP E+E+LV+ LY+WRD IARRDDESPR+VMPNQLLA LV YTP D 
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540
            GV+S++  VT+HVR NAK LANLI  +L+ I +   +   + S + K    L + ++V 
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSD-IKVESVQHKDQHDLSQVLTVG 538

Query: 541 QIRDVMERFSVLCNS--NISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTED 598
           QI   + +F  L  +   +S+      ++SSI+ G IL      + Y +  L   V  + 
Sbjct: 539 QIESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGR-SLKKPVTDKQ 597

Query: 599 IRIRAQNFKSAL 610
           I  R      AL
Sbjct: 598 IEKRKLELSEAL 609

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/724 (49%), Positives = 480/724 (66%), Gaps = 14/724 (1%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M+ +N + LL  ++ VVRA+++LA+QDVDFYK+LD+               +AN ++LSI
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           DE+    E  ++ I D WN F NIMDNL+E SDH +D L+   N   + ++  +L   S 
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
            N +P+KR+EKPQL F  P+DN++S PF PLL EKPNALKPL +SL LV +    P+HY 
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
            PYEYEID+QEY+ E+++IR+  P K W+ +  IW+DT   L  +L DL+   EIAVDLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHD RSYYGI CLMQISTRE+DY+VDT+ LR++L +LNE+FTNP+I KVFHGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLY+V LFDT+HASKA+GL RHSLAYLLEN+A+FKTSKKYQLADWR RPL+  M A
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YAR+DTHFLLNI+DQLRN LI+ NKLAGVL+ESRNVAKRRFEY K+RP  P   +Y+ IE
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           KE+PWK L+ QYNI  E+E+LV++L++WRD+IARRDDESPR++MP Q+L +L++YTPTD 
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNT-NEEATPIPSSETKADGILLETISV 539
            GV+S++N VTEHVR N+  LANLI+ AL + K+  N   +    + ++ D  +   IS+
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISI 565

Query: 540 PQIRDVMERFSVLC-NSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTED 598
            +I ++  +F+ L  + N SK     +  SS+L   I+        YSKD   +  K+ED
Sbjct: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTS-FKSED 624

Query: 599 IRIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDP-------ASAPNHSPEI--D 649
           +  R       L  L      I +P V  +K  EI T +P       ++    + EI  D
Sbjct: 625 MIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINED 684

Query: 650 NLDDLVVLXXXXXXXXXXXXXXGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRR-FDPSS 708
           N ++++VL                     VDYSK   I   K    N   KKR+ FDP +
Sbjct: 685 N-EEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDPYN 743

Query: 709 SDSN 712
           +D +
Sbjct: 744 NDGD 747

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/717 (50%), Positives = 487/717 (67%), Gaps = 33/717 (4%)

Query: 7   DVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSIDEHHES 66
           D LL +V+  VRA+ +LA+QDVDFY+++D+               M N ++L++DE+ E+
Sbjct: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85

Query: 67  FELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPT 126
            +  +E++ D W +F N+MDNLLE SD S+D L  + N+ +  S++QYL E+SG++ + +
Sbjct: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145

Query: 127 KR--VEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYE 184
           KR  + KPQL+F  P+DN+E+HPFIPLLK KPNALK L ES++L+  DEN P HY  PYE
Sbjct: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 185 YEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDY 244
           YEID+Q Y+ +ILQ+ + IPS+ W ++  IWVDT   L+SM++DL N  E AVDLEHHDY
Sbjct: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 245 RSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDL 304
           R+YYGIVCLMQISTR +DY+VDTLKLR +L  LNE FTNP I KV HGAFMDIIWLQRDL
Sbjct: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 305 GLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARA 364
           GLY+V LFDT+HAS+A+G P++SLAYLLE F+NFKTSKKYQ+ADWRIRPLSK M +YAR+
Sbjct: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 365 DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESP 424
           DTHFLLNI+DQ+RNKL++  KLAGVL ESRNVAKRRFEY KYRPL  SS VYSPIEK  P
Sbjct: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 425 WKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVV 484
           WK LMYQYNIP  +E+L++ELYQWRD IARRDDESPR++MPNQLL +LVAY P +  GVV
Sbjct: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 485 SLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPI-------PSSETKADGI-LLET 536
           S++N VT+HVR N+K+LANLI++ L  IK+T +  + I       P + T    + L E 
Sbjct: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565

Query: 537 ISVPQIRDVMERF-SVLCNSN-----ISKSRAKPVTNSSILLGKILPREEHD----IAYS 586
           +S+ Q+  +  +F S+    N      + +R     NS +L    +   + D    I YS
Sbjct: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625

Query: 587 -KDGLPNKVKTEDIRIRAQNFKSALANLEDIIFEIEKP--LVVPVKLEEIKTVDPASAPN 643
                 +K+ TE++  R + F  A+  L+ + + I  P   +V V+ E+ +   PA+   
Sbjct: 626 VSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAANAE 685

Query: 644 HSPEI-----DNLDDLVVLXXXXXXXXXXXXXXGVTEKD-----AVDYSKIPNILSN 690
            +  +     ++LD+++VL                 + D      +DYSK+  +L N
Sbjct: 686 ITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLDN 742

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/755 (47%), Positives = 486/755 (64%), Gaps = 39/755 (5%)

Query: 5   NPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSIDEHH 64
           N D LL  V++ VRAAS+LA+QDVDFY++LD+               M N II S+DE+ 
Sbjct: 2   NADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENS 61

Query: 65  ESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGE---FSGK 121
           E     +E++ + W + GN++D+L E++DHS+D L+ A    S    ++YL +   F   
Sbjct: 62  EGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESD 121

Query: 122 NFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPH 181
           N +   R+ KPQL F  P+DNSE+HPF PLL +KPNA+ PL E L++VD  E+ P HYP 
Sbjct: 122 NVT---RLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQ 178

Query: 182 PYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEH 241
           PYE EID QEY+ ++LQ  + IPSK W+++  IWVD    L +ML +LK   E+AVDLEH
Sbjct: 179 PYETEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEH 238

Query: 242 HDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQ 301
           HD+RSYYGI CLMQISTR  DYLVDT+ LR+ L +LN VFT+P I K+ HGAFMDIIWLQ
Sbjct: 239 HDFRSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQ 298

Query: 302 RDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAY 361
           RDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSK+YQLADWR RPLSK M AY
Sbjct: 299 RDLGLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAY 358

Query: 362 ARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEK 421
           ARADTHFLLNI+DQLRN LI+ +KLA +L+ESR VAKRRFEYSKY+P  PSS V+SP E 
Sbjct: 359 ARADTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTES 418

Query: 422 ESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVI 481
           + PW+ ++YQYNIP ++  LV+ L++WRD IARRDDESPR++MPNQL+A+LV Y PT+  
Sbjct: 419 DMPWRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPA 478

Query: 482 GVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSS----ETKADGILLETI 537
           GV+S+   +T+ VR NAK +ANLI+  L ++KN N   T + ++    ET ++ +    I
Sbjct: 479 GVISVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQI 538

Query: 538 S--VPQIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVK 595
              V Q  +++E++S   NSN++   +K   + S++  KI    +  I Y K G  + + 
Sbjct: 539 KFIVSQFENILEKYSS-NNSNLNDVTSKEGKD-SLVFSKIFNSRDDIITYDK-GTKHLIT 595

Query: 596 TEDIRIRAQNFKSALANLEDIIFEIE----------KPLVVPVKLEEIKTVDPASAPNHS 645
            + +  R +   +A+   E+I F +E          +P   P   EE+ +     A    
Sbjct: 596 EQQLSDRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEP---EEVISQSHLPAFEDK 652

Query: 646 PEIDNLDDLVVLXXXXXXXXXXXXXXGV---TEKDAVDYSKIPNILSNKPGQNNRQQ--K 700
            E ++LD+++VL              G    ++   +DYSK   ILS    Q+NR++   
Sbjct: 653 EEQEDLDEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILS----QDNRRRTPN 708

Query: 701 KRRFDPSSSDSNXXXXXXXXXX--XXXXXNLSFKR 733
           KR++DP S+D+N                 N+SFKR
Sbjct: 709 KRKYDPFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/757 (47%), Positives = 489/757 (64%), Gaps = 37/757 (4%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M+SE+ D LLS ++  VR++S+LA+QD+DFYK+LD                + N+++LSI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           D +++  +  ++   D W +  NIMDNL E SDH+LD +       + G  L+YL +   
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
            N  P+KR+EKPQL FK+P+DN+E HPF PLL+ KP++L+P   SL++V ++E+ PSHYP
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
           HPYEYEIDHQ+Y+  IL   E IPSK WD++  IWVDT   L  M ++L    E+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQIS RE D++VDT+ LRE L+ILN++FT+P++ KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLY+VGLFDTYHAS+ +G P+HSLAYLLE FANFKTSKKYQLADWRIRPL+KPM A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YARADTHFLLNI+D+LRN L+E NK++ VL+ESR VAKRRFEYS +RP  PSS V+SPIE
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           K+ PWK +M+QYNIP  +E+L+R LY+WRD IARRDDESPR+VMPNQLL +LVA  PT+ 
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIK-NTNEEATPIPSSETKADGILLETISV 539
           I V+S+++ V+EH+R N+K++ANLI+  L ++K N+N  A P+  S       L   I+ 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 540 PQIRDVMERFSVLCNSNISKSRAKPVTNS--SILLGKI-----------LPRE-----EH 581
            QI+ +   F  L  S I+  +     NS  S+L   I            P+      +H
Sbjct: 541 SQIKSIQNIFHSLA-SEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599

Query: 582 DIAYSKDGLPNKVKTEDIRIRAQNFKSALANLEDIIFEIEKPLVVP--VKLEEIKTVDPA 639
           ++   +  +   ++ E    +AQ+    L + ED     E P  V       E+ T DP+
Sbjct: 600 ELLKRQHEITRTLEQEYTDRQAQSI--VLPSNED-----EAPTQVSNDENRNEVITSDPS 652

Query: 640 SAPNHSPEI-DNLDDLVVLXXXXXXXXXXXXXXG-VTEKDAVDYSKIPNIL-SNKPGQNN 696
                  EI +N D+++ L                    + +DY+   ++L S K   N+
Sbjct: 653 QE-----EIEENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNS 707

Query: 697 RQQKKRRFDPSSSDSNXXXXXXXXXXXXXXXNLSFKR 733
           ++ KKRRFDP S +                 N+SFKR
Sbjct: 708 QKHKKRRFDPYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/741 (48%), Positives = 492/741 (66%), Gaps = 12/741 (1%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M+S++ D +L +V+  VRA+++LASQDV+F+K++D                + N I+LSI
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           D ++E  +   E++ ++   F N+MD L E +D SLD LN   ++     ++Q+L + + 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
               P++R+ KPQL FK+P+DNSESHPF PLL EKPNALK + ES +LV   E+ P H+ 
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
            PYEYEI +QEY+ +IL+ +E IPS SW D+  IWVD    L+ M+++LK + EIAVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQISTR +DY+VDT+ LR++L +LNEVFTNP I KVFHGAFMDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P  P + +++P+E
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
           KESPW+ LMYQYNIP ++E L+RELY+WRD++ARRDDESPR+VMPNQLL +LVAY P D 
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEA--TPIPSS-ETKADGILLETI 537
           I VVS+++ VT+HVR+N+K LANLI+  L  IK    ++    +PSS +   D   L+ +
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDE--LQFL 538

Query: 538 SVPQIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTE 597
              +I  +   F  + N     +++K    SS++L +IL   EH + Y  +G    V+  
Sbjct: 539 PSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYH-NGSACSVEES 597

Query: 598 DIRIRAQNFKSA--LANLEDIIFEIEKPLV-VPVKLEEIKTVDPASAPNHSPEIDNLDDL 654
           +++ R  ++  A  LA  ++I   +E      P++ EE              + +++D++
Sbjct: 598 ELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEI 657

Query: 655 VVLXXXXXXXXXXXXXX--GVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSN 712
           VVL                G   ++ VDYSK  NIL++   +  ++ KKR FDP SS   
Sbjct: 658 VVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYSSTGE 716

Query: 713 XXXXXXXXXXXXXXXNLSFKR 733
                           +SFK+
Sbjct: 717 GPKAAKKRRLVTKGKKISFKK 737

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/689 (50%), Positives = 462/689 (67%), Gaps = 12/689 (1%)

Query: 7   DVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSIDEHHES 66
           D LL +V++ +RA+S+LA+QDVDF+++L R               + N ++ SID++ E 
Sbjct: 7   DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66

Query: 67  FELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPT 126
               +E +++ W +F N+MDNL E+SD S D L  A  S+  G  L++L   S  +  P+
Sbjct: 67  LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126

Query: 127 KRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYE 186
           KR+ KPQL FK+P++N+E  PF+PLLKEKP AL+PL   +  V  ++  P HY  PYEYE
Sbjct: 127 KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPEHYAQPYEYE 184

Query: 187 IDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRS 246
           I+HQEY   ++   E IPSK W+ +  +WVD    L++M+ DLK+  EIAVDLEHHDYRS
Sbjct: 185 IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244

Query: 247 YYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGL 306
           YYGIVCLMQISTRERDYL+DT+ LR++L ILNEVF NP I+KVFHGAFMDIIWLQRDLGL
Sbjct: 245 YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304

Query: 307 YVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADT 366
           YVV LFDT+HAS+AIGLPRHSLAYLLE FANFKTSKKYQLADWR+RPLSK M AYARADT
Sbjct: 305 YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364

Query: 367 HFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPWK 426
           HFLLNIYDQLRN LIE NKLAGVL ESRNVAKRRFEYSK+RP+ PS  VY PI+K  PWK
Sbjct: 365 HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424

Query: 427 ILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSL 486
           +LM+QY+I P RE LV++LY WRD IARRDDESPR+VMPNQLL  L    PT+ I V+S+
Sbjct: 425 VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484

Query: 487 TNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVPQIRDVM 546
            + VT+HVR N+ +LA+LI++ L +    +++ T   +     D   L  ++VPQI+ + 
Sbjct: 485 NSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGT-FEADNNSTDAASL--LTVPQIQKLA 541

Query: 547 ERFSVLCNS-NISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIRIRAQN 605
             F+ +  +  I ++  K   +SSI    IL  E+  + Y  + + +  K E  +  A+ 
Sbjct: 542 ACFAGVSRAFTILQNEYKDGRSSSIFTD-ILTSEDDAVNYVGNNMDHITKKELGKRAAKA 600

Query: 606 FKSALANLEDIIFEIEKPLVVPVK--LEEIKTVDPASAPNH-SPEIDNLDDLVVLXXXXX 662
            +S     E   + +  P +      +EEI+   P       SP  +++D+++ L     
Sbjct: 601 LQSMEQFDEATSYYMPIPEIAKESNTMEEIRPPAPEEVKESPSPPKEDMDEIITLKKIKK 660

Query: 663 XXXXXXXXXGVTEKD--AVDYSKIPNILS 689
                    G++E++  AVDY+K   +L+
Sbjct: 661 QKSQSPKELGISEREIPAVDYTKTKKVLA 689

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/752 (45%), Positives = 478/752 (63%), Gaps = 27/752 (3%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M S + D L  R+++ +RAA++L++QD+DFY++L                 + NE++LS+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120
           DE++   +   ++  D W    N+MDN+ E SDH+ D +    +S++ G ++QYL + S 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180
            + +P+KR+EKPQL FK+P+DN+E HPF PLLKEKP+ALKPL ESL L  ++EN P+HYP
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240
           HPYEYEID Q Y+  +L++RE I  + W+ + PIWVD    L  ML++LK  KE+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQIS+R +D+LVDT+ LR++LH+LN +  +P++VKVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360
           QRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FA FKTSKKYQLADWR+RPL KP+  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420
           YAR+DTHFLL+IYD LRN L+++ KLA VL  SRNVAKRRFEY+ +RP  P S VYSPIE
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480
              PW+ LMYQYN+PP +E L+++LY+WRD +ARRDDES R+VMPNQLL +LV+ +P++ 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540
            GV+S++  VT++VR NA+ LANLI+  L  IK          SSE +A      T+S+ 
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSE-RALSNPAATLSLH 539

Query: 541 QIRDVMERF-SVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDI 599
            I+++ + F S+L  +           +SS+L    L      + Y+ +G  + +    +
Sbjct: 540 MIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYT-NGQKHVIGDNVL 598

Query: 600 RIRA----QNFKSALANLEDIIFEIEKPLVV-----PVKLEEIKTVDPASAPNH----SP 646
           + R     Q F S      + + +IE P        P   E+I   +P  + N      P
Sbjct: 599 QTRKHALLQKFTSQPV---EPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEP 655

Query: 647 EIDNLDDLVVLXXXXXXXXXXXXXXGVTEKDAVDYSKIPNILSN------KPGQNNRQQK 700
           + +   ++VVL                +  + VDYS    +L        K G  +R  +
Sbjct: 656 DFEK-SEIVVLRKKKKAHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDR-PR 713

Query: 701 KRRFDPSSSDSNXXXXXXXXXXXXXXXNLSFK 732
           KR+FDP   D+N               ++SFK
Sbjct: 714 KRKFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/725 (48%), Positives = 466/725 (64%), Gaps = 26/725 (3%)

Query: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSI 60
           M+S+N D LL++++  VRAASSLA+QD+DF ++LD                + NE+ILS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSD--LQYLGEF 118
            + +   E+ ++++   W +  NI+DNL E SDHSLD L   ++S S   D  +QYL   
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 119 SGKNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSH 178
           S ++   ++R+ KPQL+FK P+DNSE HPF PLLK KP+ALKPL E   L  + E  P+H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 179 YPHPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVD 238
           YPHPYEYEID+Q Y   +L I+E I   +WD++ PIWVD  T L  ML  LKN KEIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 239 LEHHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDII 298
           LEHHDYRSYYG+VCLMQISTRE D+LVDT+ LR++L +LNE+FT+PSI+KVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 299 WLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPM 358
           WLQRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FANFKTSKKYQLADWRIRPLSKPM
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 359 TAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSP 418
             YARADTHFLLNIYD+LRN LI+ +KL+GVL+ SRNVAKRRFEY+ +RP   S  V+SP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 419 IEKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPT 478
           IEK+ PW+ LM QYN+P  +E L+R+LY+WRD++AR+DDES R+VMPNQLL +LV   P+
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 479 DVIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETIS 538
           D  G++++ + + +HVR NA++L N+I   +  IK+ + E   I +  T         +S
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 539 VPQIRDVMERFSVLCNSNISKS-RAKPVTNSSILLGKILPREEHDIAYSKDG--LPN--- 592
           V  I+ +   F  L +   S +     V   S+L    L  +   +AY+  G  L N   
Sbjct: 541 VSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRE 600

Query: 593 --KVKTEDIRIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDN 650
               K++  +  ++ FK+A   +   I ++     +P       T     +P+     +N
Sbjct: 601 LLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPA-----DTTSNVESPSKEESKNN 655

Query: 651 LDDL-------VVLXXXXXXXXXXXXXXGVTEKDAVDYSKIPNILSNKPGQN----NRQQ 699
            DDL       +VL                 +K+ VDY+ + +IL N   Q+     R  
Sbjct: 656 SDDLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHV 715

Query: 700 KKRRF 704
            KR+F
Sbjct: 716 DKRKF 720

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/501 (57%), Positives = 375/501 (74%), Gaps = 1/501 (0%)

Query: 9   LLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSIDEHHESFE 68
           +L++V+  +RA+S++++QDVDFYK+LD                + N++++SID++++  E
Sbjct: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDNNDLIE 71

Query: 69  LKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPTKR 128
                + + WNN G +MD L E S+H+L  +     S   G++LQYL +      +   +
Sbjct: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKK-GSNIIGNNLQYLDDSQPLTDTTLTK 130

Query: 129 VEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEID 188
           + KPQ  F  P+DN+ESHPF PLL +KPNAL+PL + L+L  ++E  P+HYPHPYEYEID
Sbjct: 131 ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEID 190

Query: 189 HQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYY 248
           HQEY   +L+IR  IPSK W+++   WVD    L  M+ +L   KE+A+DLEHHDYR+YY
Sbjct: 191 HQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYY 250

Query: 249 GIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYV 308
           GI CLMQISTRE D+LVDT+ LR++L +LNE+FTNP ++KVFHGAFMD+IWLQRDLGLY+
Sbjct: 251 GITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYL 310

Query: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHF 368
           V LFDT+HAS+ +G P+HSLAYLLE +A+FKTSKKYQLADWRIRPLSKP+ AYARADTHF
Sbjct: 311 VSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHF 370

Query: 369 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPWKIL 428
           LLNIYDQ+RN LIE  KLA  L+ SR VAKRRFEY+K+RP   +SEVYSP+E+E PW+ L
Sbjct: 371 LLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSL 430

Query: 429 MYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTN 488
           ++ YNIP  +  L++ LY+WRD IARRDDESPR+VMPNQLL ALV   PTD  G++S+T+
Sbjct: 431 IFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTS 490

Query: 489 GVTEHVRQNAKLLANLIRDAL 509
            VTEHVR NAK L+ LI+  L
Sbjct: 491 FVTEHVRSNAKSLSQLIKKTL 511

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/509 (56%), Positives = 375/509 (73%), Gaps = 7/509 (1%)

Query: 9   LLSRVINVVRAASSLASQDVDFYKNLDRGFXXXXXXXXXXXXXMANEIILSIDEHHESFE 68
           +L++VI  +RA+S++ +QDV FYKNLD                + N+I+LS+DE+++  E
Sbjct: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71

Query: 69  LKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRG---SDLQYLGEFSGKNFSP 125
              E +   W+N G +MD L E S+H+L     A   +  G     +QYL +    +   
Sbjct: 72  QGSEGLESAWSNVGEVMDLLFEKSEHAL----AAGEKRDNGELSKTVQYLDDSPSLHDGA 127

Query: 126 TKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEY 185
            K++ KPQL FK PIDNSESHPF PLLK+KP+AL+ L ESLRL  + E+ P+HYP PYEY
Sbjct: 128 PKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEY 187

Query: 186 EIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYR 245
           EIDHQEY+  +LQI E +PS  WD++   WVD +  L+ ML +L    EIA+DLEHHDYR
Sbjct: 188 EIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYR 247

Query: 246 SYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLG 305
           +YYGI CLMQISTRE+D+L+DT+ LR++L ILNEVFT+P I KV HGAFMDIIWLQRDLG
Sbjct: 248 TYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLG 307

Query: 306 LYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARAD 365
           LY+V LFDTYHAS+ +G P+HSLAYLLE +A+FKTSKKYQL+DWR+RPL K + AYARAD
Sbjct: 308 LYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARAD 367

Query: 366 THFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPW 425
           THFLLNIYD +RN LIE NKL+ VL++SRNVAKRRFE++ +RP   +S V+SPIE+E PW
Sbjct: 368 THFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPW 427

Query: 426 KILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVS 485
           + LM+QYNIP  + +LVR LY+WRD++ARRDDESPR+V+PNQLL +L    PT    +++
Sbjct: 428 RTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMA 487

Query: 486 LTNGVTEHVRQNAKLLANLIRDALRNIKN 514
            +  VTEH+RQNAK LA LI+ +L +  N
Sbjct: 488 TSTFVTEHIRQNAKSLALLIKKSLESSSN 516

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 323 LPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIY 373
           L +  L  L     NF  + +YQ+A W+ R  ++  + +   D HF  NI+
Sbjct: 112 LVKGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

>TPHA0I02770 Chr9 (610421..614296) [3876 bp, 1291 aa] {ON} Anc_1.290
           YJL080C
          Length = 1291

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 8/73 (10%)

Query: 404 SKYRPLTPSSEVYSPIEKESPWKILMY--QYNIPPEREVLVRELYQWRDLIARRDDESPR 461
           SKY   T  ++  +  + + P K+ +   QYN+    E +  E+ +W D+I +       
Sbjct: 741 SKYDITTQFADADTKPQSKEPMKVTLIGIQYNVKRAVEFINTEIKRWSDIITK------E 794

Query: 462 FVMPNQLLAALVA 474
           F+ P Q  AAL+ 
Sbjct: 795 FIAPLQYHAALIG 807

>KLTH0D11616g Chr4 complement(951182..952090) [909 bp, 302 aa] {ON}
           similar to uniprot|Q08686 Saccharomyces cerevisiae
           YOR251C catalyzes transfer of the sulfane atom of
           thiosulfate to cyanide to form sulfite and thiocyanate
          Length = 302

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 23/120 (19%)

Query: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPL-SKPMTAYA----- 362
           VG F     +  + +  H L YLL NF  +K             PL + P T+++     
Sbjct: 99  VGNFSAPRCAWTLAVFGHELVYLLNNFPAYKAEG---------FPLDTTPRTSFSELEPS 149

Query: 363 --RADTHFL---LNIYDQLRNKLIESNKLAGV--LYESRNVAKRRFEYSKYRPLTPSSEV 415
             ++D  F    +  Y+++ +KL+E  KLA V  ++++R + +   E S+ RP  PS  +
Sbjct: 150 DYKSDADFTKQEVVSYEEI-HKLVEDGKLAEVYNVFDARALPRFTGESSEPRPEIPSGHI 208

>TBLA0H00830 Chr8 complement(184669..186708) [2040 bp, 679 aa] {ON}
           Anc_8.403 YDR195W
          Length = 679

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 10/115 (8%)

Query: 177 SHYPHPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIA 236
           S  P P +  I H   S +I QIR++I  K W     +  + + E+E+ +  L+N   + 
Sbjct: 2   SSAPIPKQINISHALQSTKIQQIRQDI--KDWQQMKDLTPEQNLEIENYINSLENAFMLF 59

Query: 237 V-DLEHHDYRSYYGIVCLMQISTRER----DY---LVDTLKLRENLHILNEVFTN 283
             D EH + R     V  +Q+ T  +    DY   L+D  +L+ +  I+N    N
Sbjct: 60  TKDNEHVEKRMEGVTVADVQLYTGLKKMYIDYLNELIDIKRLKNSQDIVNSANNN 114

>SAKL0H14652g Chr8 (1272436..1274526) [2091 bp, 696 aa] {ON} weakly
           similar to uniprot|Q99296 Saccharomyces cerevisiae
           YLR149C Hypothetical ORF
          Length = 696

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 35/91 (38%), Gaps = 12/91 (13%)

Query: 113 QYLGEFSGKNFSPTKRVEKPQLKFKSPIDNSESH---------PFIPLLKEKPNALKPLS 163
           QY G +  K    T+R   PQ  FKSP    E H          F P   ++ N L    
Sbjct: 77  QYGGTYGSKKHQKTRRQSLPQNAFKSPAAGDEYHAPSKKVVEFAFKPRCFQENNGLIACG 136

Query: 164 ESLRLVDDDENNPSHYPHPYEYEIDHQEYSP 194
               LV  D+N  ++    Y   ++  + SP
Sbjct: 137 G---LVGPDDNGSANNLSRYSLSVNDNDDSP 164

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,257,987
Number of extensions: 3773982
Number of successful extensions: 12994
Number of sequences better than 10.0: 56
Number of HSP's gapped: 13467
Number of HSP's successfully gapped: 56
Length of query: 733
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 616
Effective length of database: 40,065,477
Effective search space: 24680333832
Effective search space used: 24680333832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)