Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOL004W (SIN3)6.29ON1536153673390.0
Smik_15.1666.29ON1566101745030.0
Suva_15.1716.29ON1561101243970.0
Skud_15.1586.29ON1555101743860.0
TDEL0G044006.29ON1490128138670.0
KAFR0A051206.29ON1479130536960.0
NCAS0D021306.29ON1434128736780.0
KNAG0F029206.29ON1492126536550.0
CAGL0E02475g6.29ON1493129135730.0
ACL004W6.29ON1377131935270.0
SAKL0E01540g6.29ON1415128635130.0
KLTH0C10956g6.29ON1433126234850.0
Kwal_56.224626.29ON1541124434030.0
Kpol_1037.226.29ON1496115832540.0
ZYRO0C07524g6.29ON167086930800.0
KLLA0C06182g6.29ON1519107329640.0
Ecym_30336.29ON1474103128270.0
TPHA0J004006.29ON151285927920.0
TBLA0E031606.29ON173985327870.0
NDAI0C026606.29ON165786227550.0
CAGL0J11594g6.29ON9373916263e-66
Suva_15.170singletonON1611163715e-40
NCAS0G002305.702ON17351261000.006
Kpol_1064.538.403ON48969890.12
YFR025C (HIS2)1.351ON33555762.9
Suva_8.2618.623ON75683755.1
Skud_11.2202.497ON1483120739.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL004W
         (1536 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  2831   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1739   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1698   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1694   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1494   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1428   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1421   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1412   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1380   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1363   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1357   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1347   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1315   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1258   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1191   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1146   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1093   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1080   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1078   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1065   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   245   3e-66
Suva_15.170 Chr15 (290805..291290) [486 bp, 161 aa] {ON}  YOL004...   147   5e-40
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    43   0.006
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    39   0.12 
YFR025C Chr6 complement(203743..204750) [1008 bp, 335 aa] {ON}  ...    34   2.9  
Suva_8.261 Chr8 (472765..475035) [2271 bp, 756 aa] {ON} YOR208W ...    33   5.1  
Skud_11.220 Chr11 complement(402296..406747) [4452 bp, 1483 aa] ...    33   9.2  

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 2831 bits (7339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1390/1536 (90%), Positives = 1390/1536 (90%)

Query: 1    MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITLPSLSALSTKE 60
            MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITLPSLSALSTKE
Sbjct: 1    MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITLPSLSALSTKE 60

Query: 61   EDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALKQPHEYHPRPKXXXXXXXINA 120
            EDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALKQPHEYHPRPK       INA
Sbjct: 61   EDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALKQPHEYHPRPKSSSSSPSINA 120

Query: 121  SLMNAGPAPLPTVGAASFSLSRFDNPLPIKAPVHTEEPKSYNGLQEEEKATQRPQDCKEV 180
            SLMNAGPAPLPTVGAASFSLSRFDNPLPIKAPVHTEEPKSYNGLQEEEKATQRPQDCKEV
Sbjct: 121  SLMNAGPAPLPTVGAASFSLSRFDNPLPIKAPVHTEEPKSYNGLQEEEKATQRPQDCKEV 180

Query: 181  PAGVQPADAPDPXXXXXXXXXXXXXXXXXXXXXXXYRPLNVKDALSYLEQVKFQFSSRPD 240
            PAGVQPADAPDP                       YRPLNVKDALSYLEQVKFQFSSRPD
Sbjct: 181  PAGVQPADAPDPSSNHADANDDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPD 240

Query: 241  IYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI 300
            IYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI
Sbjct: 241  IYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI 300

Query: 301  RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPSSVYXXXXXXX 360
            RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPSSVY       
Sbjct: 301  RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPSSVYQSEQNQD 360

Query: 361  XXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKT 420
               SLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKT
Sbjct: 361  QQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKT 420

Query: 421  RFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANX 480
            RFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 
Sbjct: 421  RFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANQ 480

Query: 481  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLYPASGYYGHPSNRGIPQQN 540
                                                   FLYPASGYYGHPSNRGIPQQN
Sbjct: 481  QVQHAQQHAQQQHEAQMHAQAQAQAQAQAQVEQQKQQQQFLYPASGYYGHPSNRGIPQQN 540

Query: 541  LPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANENPPLSDLR 600
            LPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANENPPLSDLR
Sbjct: 541  LPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANENPPLSDLR 600

Query: 601  TSLTEQYAXXXXXXXXXXXXXXXXXANTQYGDIPVRPEIDLDXXXXXXXXXXXXXXXXXX 660
            TSLTEQYA                 ANTQYGDIPVRPEIDLD                  
Sbjct: 601  TSLTEQYAPSSIQHQQQHPQSISPIANTQYGDIPVRPEIDLDPSIVPVVPEPTEPIENNI 660

Query: 661  XLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWF 720
             LNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWF
Sbjct: 661  SLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWF 720

Query: 721  KNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLND 780
            KNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLND
Sbjct: 721  KNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLND 780

Query: 781  EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIEN 840
            EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIEN
Sbjct: 781  EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIEN 840

Query: 841  MTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQ 900
            MTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQ
Sbjct: 841  MTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQ 900

Query: 901  KDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQT 960
            KDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQT
Sbjct: 901  KDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQT 960

Query: 961  NKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISL 1020
            NKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISL
Sbjct: 961  NKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISL 1020

Query: 1021 FFSISFEKIEESLYSHKQNVXXXXXXXXXXXIASRKRPYQQEMSLLDILHRSRYQKLKRS 1080
            FFSISFEKIEESLYSHKQNV           IASRKRPYQQEMSLLDILHRSRYQKLKRS
Sbjct: 1021 FFSISFEKIEESLYSHKQNVSESSGSDDGSSIASRKRPYQQEMSLLDILHRSRYQKLKRS 1080

Query: 1081 NDEDGKVPQLSXXXXXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFA 1140
            NDEDGKVPQLS                   AKNPWLTGNLVEEANSQGIIQNRSIFNLFA
Sbjct: 1081 NDEDGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFA 1140

Query: 1141 NTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVG 1200
            NTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVG
Sbjct: 1141 NTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVG 1200

Query: 1201 EDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDA 1260
            EDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDA
Sbjct: 1201 EDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDA 1260

Query: 1261 KTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALD 1320
            KTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALD
Sbjct: 1261 KTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALD 1320

Query: 1321 DLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTEVDEEFS 1380
            DLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTEVDEEFS
Sbjct: 1321 DLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTEVDEEFS 1380

Query: 1381 PEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISK 1440
            PEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISK
Sbjct: 1381 PEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISK 1440

Query: 1441 FLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQGIESETEKGKITKQEQSDNLD 1500
            FLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQGIESETEKGKITKQEQSDNLD
Sbjct: 1441 FLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQGIESETEKGKITKQEQSDNLD 1500

Query: 1501 SSTASVLPASITTVPQDDNIETTGNTESSDKGAKIQ 1536
            SSTASVLPASITTVPQDDNIETTGNTESSDKGAKIQ
Sbjct: 1501 SSTASVLPASITTVPQDDNIETTGNTESSDKGAKIQ 1536

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1739 bits (4503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 848/1017 (83%), Positives = 896/1017 (88%), Gaps = 2/1017 (0%)

Query: 520  FLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQ 579
            FLYPAS YYGH +NRGIPQQNLPPIGSFSPPTNGSTVHE YQDQQHMQPPH MPLPS+VQ
Sbjct: 551  FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQ 610

Query: 580  HGPNMVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXXXXXXXX-XANTQYGDIPVRPE 638
            HG N+VHQGIANEN PLSDLRTSLTEQYA                  AN+QYGD+PVRPE
Sbjct: 611  HGANIVHQGIANENLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGDVPVRPE 670

Query: 639  IDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 698
            IDLD                   LNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD
Sbjct: 671  IDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 730

Query: 699  LDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRL 758
            LDDLVEKVDFYLGSNKELF+WFKNFVGYQE+TK IENIVHEKHRLDLDLCEAFGPSYKRL
Sbjct: 731  LDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRL 790

Query: 759  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 818
            PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 791  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 850

Query: 819  FYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 878
            FYIESNLRTIQCLETIVNKIENMTENEK NFKLPPGLGHTSMTIYKKVIRKVYDKERGFE
Sbjct: 851  FYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 910

Query: 879  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 938
            IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA
Sbjct: 911  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 970

Query: 939  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITH 998
            DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIF DIL LAD+FI+H
Sbjct: 971  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISH 1030

Query: 999  TTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVXXXXXXXXXXXIASRKRP 1058
            TTAYSNPDKERLKDLLKYFISLFFSIS E+IEESL ++KQ+V             SRKR 
Sbjct: 1031 TTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQAYKQSVSESSGSDDGGSSVSRKRS 1090

Query: 1059 YQQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXXXXXXXXXXXXAKNPWLTG 1118
            YQQEM+LLDILHRSRYQKLKRS DEDGKVPQLS                   AKNPWLTG
Sbjct: 1091 YQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESNIIEEEELINEEAKNPWLTG 1150

Query: 1119 NLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTV 1178
            NLVEEANSQG+IQNR IFNLFANTNIYIFFRHWTTIYERLLEIKQMNE+VTKEINTRSTV
Sbjct: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210

Query: 1179 TFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFK 1238
            TFAKDLDLLS+QLSEMGLDF+GEDAYKQVL+LSRRLINGDLEHQWFEESLRQAYNN+AFK
Sbjct: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270

Query: 1239 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTE 1298
            LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRN +TTSAK QIIYRLQVRSHMSNTE
Sbjct: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330

Query: 1299 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIP 1358
            NMFRIEFDKRTLHVSIQYIALDDLTLKEPK DEDKWKYYVTSYALPHPTEG+ HEKLKIP
Sbjct: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390

Query: 1359 FLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKY 1418
            FLERLIEFGQDIDG +VDE+FSPEGISVSTLKIKIQP TY+L IENGSYDVFTRK+ NKY
Sbjct: 1391 FLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKY 1450

Query: 1419 PTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGN 1478
            PT+AND+T K +V QKKELIS+FLDCAV LRN+L+E+QK+SMQ+K+E+LKD+ AK +   
Sbjct: 1451 PTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVDG 1510

Query: 1479 QGIESETEKGKITKQEQSDNLDSSTASVLPASITTVPQDDNIETTGNTESSDKGAKI 1535
            Q ++++ E+   TKQEQ +NL SS ASV  +S + VPQDDNIE   +T  SD   KI
Sbjct: 1511 QVVDTKIEEATKTKQEQQENLASSDASVF-SSTSDVPQDDNIEVMRSTGLSDTETKI 1566

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/492 (74%), Positives = 380/492 (77%), Gaps = 13/492 (2%)

Query: 1   MSQVWHNSNSQSNDVATSNDATGSNERNE---KEPSLQGNKPGFVQQQQRITLPSLSALS 57
           MSQVWHN NSQSNDVATSNDA GSNERNE   KEP LQGN+  FVQQQQRITLPSLSAL+
Sbjct: 1   MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLLQGNQSSFVQQQQRITLPSLSALN 60

Query: 58  TKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALKQPHEYHPRPKXXXXXXX 117
            KEE+ RDSNGQ  L SH  HILGYPP H N +PSI +DS  KQ HEY P PK       
Sbjct: 61  NKEENGRDSNGQLPLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEYQPHPKSSSSSPS 120

Query: 118 INASLMNAGPAP----LPTVGAASFSLSRFDNPLPIKAPVHTEEPKSYNGLQEEEKATQR 173
           IN S+MNA  A     LPT G ASFSLSRFDNPLPI APVHTE  +SYN  QEEEKA+Q+
Sbjct: 121 INTSVMNAASASAPAPLPTAGGASFSLSRFDNPLPINAPVHTEGSQSYNCPQEEEKASQQ 180

Query: 174 PQDCKEVPAGVQPADAPDPXXXXXXXXXXXXXXXXXXXXXXX------YRPLNVKDALSY 227
            QD KEV AG QP DA                                YRPLNVKDALSY
Sbjct: 181 TQDHKEVSAGAQPTDATKSANDHIDTNDDNNNNNSNNNNENFNEEDPDYRPLNVKDALSY 240

Query: 228 LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG 287
           LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG
Sbjct: 241 LEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG 300

Query: 288 YRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPM 347
           YRIECS+NPDDPIRVTTPMGTTTVNNNISP  RGT DAQE  S PE+DGNG Q+  NVPM
Sbjct: 301 YRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEADGNGTQRSHNVPM 360

Query: 348 VPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVE 407
           VPS+VY           LPL ATS+GLPSIQQ E+P H QIPQ Q L  QED KKNVDVE
Sbjct: 361 VPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKKNVDVE 420

Query: 408 FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF 467
           FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF
Sbjct: 421 FSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDF 480

Query: 468 KKFLPDSSASAN 479
           KKFLPDSSASAN
Sbjct: 481 KKFLPDSSASAN 492

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1698 bits (4397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 823/1012 (81%), Positives = 875/1012 (86%)

Query: 520  FLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQ 579
            FLYPAS YY H +N GIPQQNLPPIGSFSPPTNGST HE +QDQQHMQPPH MPLPS+VQ
Sbjct: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ 603

Query: 580  HGPNMVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXANTQYGDIPVRPEI 639
             GPNMVHQGI NEN PLSDLRTSLT+QYA                  ++QYGD+PVRPEI
Sbjct: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQYGDVPVRPEI 663

Query: 640  DLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 699
            DLD                   LNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL
Sbjct: 664  DLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 723

Query: 700  DDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP 759
            DDLVEKVDFYLGSNKELF+WFKNFVGYQEK K IEN+VHEKHRLDLDLCEAFGPSYKRLP
Sbjct: 724  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLP 783

Query: 760  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 819
            KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF
Sbjct: 784  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 843

Query: 820  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 879
            YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI
Sbjct: 844  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 903

Query: 880  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD 939
            IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQAD
Sbjct: 904  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQAD 963

Query: 940  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHT 999
            KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDK+IFYDIL LAD+FI HT
Sbjct: 964  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHT 1023

Query: 1000 TAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVXXXXXXXXXXXIASRKRPY 1059
            TAYSNPDKERLKDLL YFISLFFSI  EKIEE+L S+KQN+              RKRPY
Sbjct: 1024 TAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDGDSSTPRKRPY 1083

Query: 1060 QQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXXXXXXXXXXXXAKNPWLTGN 1119
            QQEMSLLDILHRS+YQKLKRSNDEDGKVPQLS                   AKNPWLTGN
Sbjct: 1084 QQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELINEEAKNPWLTGN 1143

Query: 1120 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVT 1179
            LVEEANSQGIIQNR+IFNLFAN+NIYIFFRHWTTIYERLLEIKQMNE+VTKEI+ RS VT
Sbjct: 1144 LVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVT 1203

Query: 1180 FAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1239
            FAKDLDLLSSQLSEMGLDF GEDAYKQVL+LSRRLING+LEHQWFEE LRQAYNNKAFKL
Sbjct: 1204 FAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKL 1263

Query: 1240 YTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTEN 1299
            YTIDKV Q LVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQ RS+MSNTEN
Sbjct: 1264 YTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTEN 1323

Query: 1300 MFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPF 1359
            MFR+EFD+R LHVS+QYIALDDLTLKEP+ADEDKWKYYVTSYALPHPTEGI HEKLKIPF
Sbjct: 1324 MFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPF 1383

Query: 1360 LERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYP 1419
            LERLIE+GQD DG EVDE+FSPEG+SVSTLKIKIQP+TY+LHIE+GSYDVFTRKA NKYP
Sbjct: 1384 LERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYP 1443

Query: 1420 TIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQ 1479
            T+AND+  K MV +K  LISKFLD A+ LRN+L+E +KLSMQ+K ++LK +  K    ++
Sbjct: 1444 TVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDK 1503

Query: 1480 GIESETEKGKITKQEQSDNLDSSTASVLPASITTVPQDDNIETTGNTESSDK 1531
               ++ EK    K+EQ +NL +S   VLP+SI  VPQDDN E TGNT   DK
Sbjct: 1504 ITVAKNEKAIEAKEEQQENLPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDK 1555

 Score =  475 bits (1222), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 244/326 (74%), Positives = 256/326 (78%), Gaps = 6/326 (1%)

Query: 155 TEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPXXXXXXXXXXXXXXXXXXXXXX 214
           TE+ KS+NGL EEEKA Q  QD K  PA VQPADA +                       
Sbjct: 7   TEDRKSFNGLPEEEKANQPVQDHKRAPAAVQPADAAE-VSNVYADTKDEINAENTNDEDP 65

Query: 215 XYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYP 274
            YRPLNVKDALSYLEQVKFQF+SRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYP
Sbjct: 66  DYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYP 125

Query: 275 ILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPES 334
           ILIQGFNTFLPQGYRIECS+NPDDPIRVTTPMGTTTVNNN+SP  R   + QE  S PE+
Sbjct: 126 ILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSLPEA 185

Query: 335 DGNGVQQPSNVPMVPSSVYXXXXXXXXXXS-LPLLATSSGLPSIQQPEMPAHRQIPQSQS 393
           DG+ + Q  NVPMVPS+VY            LPLLA  SGLPSI QPE+P    IPQSQ 
Sbjct: 186 DGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELP----IPQSQP 241

Query: 394 LVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 453
           L  QED KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV
Sbjct: 242 LTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 301

Query: 454 THLFQNAPDLLEDFKKFLPDSSASAN 479
           THLFQNAPDLLEDFKKFLPDSSASAN
Sbjct: 302 THLFQNAPDLLEDFKKFLPDSSASAN 327

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1694 bits (4386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 823/1017 (80%), Positives = 878/1017 (86%)

Query: 520  FLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQ 579
            FLYPAS YY H +NRG+PQQNLPPIGSFSPPTNGSTVH+ YQDQQHMQPPH +PLPS+VQ
Sbjct: 538  FLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQ 597

Query: 580  HGPNMVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXANTQYGDIPVRPEI 639
            HGPNMVHQGIANEN P+SDLRTSLT+QYA                  + QYGD+PVRPEI
Sbjct: 598  HGPNMVHQGIANENLPISDLRTSLTDQYAPSTFQQQQQNPPSISPITDLQYGDVPVRPEI 657

Query: 640  DLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 699
            DLD                   LNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL
Sbjct: 658  DLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 717

Query: 700  DDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP 759
            DDLVEKVDFYLGSNKELF+WFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP
Sbjct: 718  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP 777

Query: 760  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 819
            KSDTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF
Sbjct: 778  KSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 837

Query: 820  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 879
            YIESNLRTIQCLETIVNKIENMTE+EK++FKLPPGLGHTSMTIYKKVIRKVYDKERGFEI
Sbjct: 838  YIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 897

Query: 880  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD 939
            IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD
Sbjct: 898  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD 957

Query: 940  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHT 999
            KKLLTTKQLISEI+SIKVDQTNKKIHWLTPKPKSQLDFDFPDK+IFYDIL LAD+FI+HT
Sbjct: 958  KKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHT 1017

Query: 1000 TAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVXXXXXXXXXXXIASRKRPY 1059
            TAYSNPDKERLKDLLKYFISLFFSI  EKIE++L  HK+NV             SRKRPY
Sbjct: 1018 TAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVSESSGSDDGGSSTSRKRPY 1077

Query: 1060 QQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXXXXXXXXXXXXAKNPWLTGN 1119
            QQEMSLLDILHR+RYQKLKRSNDE+GK+PQLS                   A+NPWLTGN
Sbjct: 1078 QQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDEESNTIEEEELISEEARNPWLTGN 1137

Query: 1120 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVT 1179
            LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMN ++TKE+NTRSTVT
Sbjct: 1138 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVT 1197

Query: 1180 FAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1239
            FAKDLDLLS+QL EMGLDF+GEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL
Sbjct: 1198 FAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1257

Query: 1240 YTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTEN 1299
            YTIDKVTQSLVKHAHTLM D KTAEIMALFVKDRNA TTSAKDQIIYRLQVRS+MSN EN
Sbjct: 1258 YTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIEN 1317

Query: 1300 MFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPF 1359
            MFRIE +KR+LHVS+QYIALDDLTLKEPKADEDKWKYYVTSY LPHPTEGI HEKLKIPF
Sbjct: 1318 MFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPF 1377

Query: 1360 LERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYP 1419
            LERLIEFGQD DG EVDEEFSPEGIS+STL+IKIQPITY+LHIENGSYDVFTRKA NKYP
Sbjct: 1378 LERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYP 1437

Query: 1420 TIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQ 1479
            TIAND+  K MV QK  LIS+FL+ A+  RN+L+EA K  MQ+K   LK   AK +  N+
Sbjct: 1438 TIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENE 1497

Query: 1480 GIESETEKGKITKQEQSDNLDSSTASVLPASITTVPQDDNIETTGNTESSDKGAKIQ 1536
              E +TE+    KQEQ  NL +S A+V+ +SI+  PQ  N E   +   S+K  KIQ
Sbjct: 1498 VKELKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKETKIQ 1554

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/488 (70%), Positives = 371/488 (76%), Gaps = 14/488 (2%)

Query: 1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGF---VQQQQRITLPSLSALS 57
           MSQVWHNSNSQ NDVATSNDA  SNER++KEP LQG +P F    QQQQRITLPSLSAL+
Sbjct: 1   MSQVWHNSNSQPNDVATSNDAAASNERSDKEPPLQGRQPSFPGQQQQQQRITLPSLSALN 60

Query: 58  TKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALKQPHEYHPRPKXXXXXXX 117
             +EDRRD NG Q L SHA HILGY P HSN +PSI+TDSALKQ HEYHP PK       
Sbjct: 61  ANDEDRRDYNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQSHEYHPHPKSSSSSPS 120

Query: 118 INASLMNAGPA--------PLPTVGAASFSLSRFDNPLPIKAPVHTEEPKSYNGLQEEEK 169
           +  ++++  PA        PLPT G ASFSLSRFDNPLPI   V T++ KSYNG+QEEEK
Sbjct: 121 LKTAVVDTAPATTLAPALAPLPTAGGASFSLSRFDNPLPINTSVCTKDSKSYNGVQEEEK 180

Query: 170 ATQRPQDCKEVPAGVQPADAPDPXXXXXXXXXXXXXXXXXXXXXXXYRPLNVKDALSYLE 229
           A Q  Q  ++       A+A +P                       YRPLNVKDALSYLE
Sbjct: 181 ANQ--QQIQDQRPAAHSANASEPSSNYVDTSYSVNNENSNDEDPD-YRPLNVKDALSYLE 237

Query: 230 QVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYR 289
           QVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYR
Sbjct: 238 QVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYR 297

Query: 290 IECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVP 349
           IECS+NPDDPIRVTTPMGTTTVNNN+SPSGRGT D QE  S  E DGN +Q   N+PMVP
Sbjct: 298 IECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFHNLPMVP 357

Query: 350 SSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFS 409
           S+VY          SLPL A S GL SI  PE+P H QI Q QSL  QEDAKKNVDVEFS
Sbjct: 358 SNVYRSEQSQDQKQSLPLSANSVGLSSIHPPEIPPHHQILQGQSLPVQEDAKKNVDVEFS 417

Query: 410 QAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKK 469
           QAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKK
Sbjct: 418 QAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKK 477

Query: 470 FLPDSSAS 477
           FLPDSSAS
Sbjct: 478 FLPDSSAS 485

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1494 bits (3867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 768/1281 (59%), Positives = 913/1281 (71%), Gaps = 71/1281 (5%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLNVKDALSYLEQVK+QF+SRPD+YN FLDIMKDFKSQAIDTPGVI+RVSTLF+GYP 
Sbjct: 191  YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250

Query: 276  LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335
            LIQGFNTFLPQGYRIECS+NPD+PIRVTTPMG+++V   I  +  G      +    +  
Sbjct: 251  LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAGTIENAVAGFPAQPRIQQLQQLG 310

Query: 336  GNGVQQ-PSNV-PMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQS 393
                Q  P +V P V  +                          Q P  PA  Q    QS
Sbjct: 311  QQQEQSLPEHVLPGVQVTTSATTTPTLNNQQPQPQPRPQLPADYQLPLQPAAGQ----QS 366

Query: 394  LVPQED-AKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 452
             +P  D  KK  DVEFSQAI+YVNKIK RFA+QPDIYKHFLEILQTYQREQKPINEVYAQ
Sbjct: 367  QLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQ 426

Query: 453  VTHLFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 512
            VT LFQNAPDLL+DFKKFLPDSS SAN                                 
Sbjct: 427  VTVLFQNAPDLLDDFKKFLPDSSPSANRQQQQPGVLQQQSPA------------------ 468

Query: 513  XXXXXXXFLYPASGYYGH---PSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPP 569
                     +  S YY     P++R    QNLPP+GSFSPP NG+  H  Y+DQQ    P
Sbjct: 469  ---------FGLSAYYNETSPPTSR----QNLPPLGSFSPPPNGAVPHNYYRDQQ----P 511

Query: 570  HFMPLPSIVQ--------HGPNMVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXXXXX 621
              + LP + Q          P++  QGIA E  P+S+LR+ +T Q               
Sbjct: 512  QTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQQIP 571

Query: 622  XXXXANT---QYGDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGN 678
                AN    QY DI VRPEIDLD                   L EE +FF++AK++IGN
Sbjct: 572  SQPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGN 631

Query: 679  KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVH 738
            K +YTEFLKILNL+SQD+LD+D+LV +V+ YLG NKELF WFKNFVG+Q+K K IENIVH
Sbjct: 632  KQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVH 691

Query: 739  EKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAH 798
            EKHRLDLDLCEA GPSYK+LPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGFIAH
Sbjct: 692  EKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAH 751

Query: 799  RKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHT 858
            RKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NM+E EKA FKLPPGLGHT
Sbjct: 752  RKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHT 811

Query: 859  SMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRE 918
            S+TIYKKVIRKVYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRE
Sbjct: 812  SLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRE 871

Query: 919  LEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFD 978
            LEQKV++KSLDHLGLTFKQADKKLLTTKQLISEI SIK DQTNK++HWLTPKPK QLD+ 
Sbjct: 872  LEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYY 931

Query: 979  FPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQ 1038
             PDK++F+DIL L DTFI H ++YSNPDK RLKDL K F+SLFFSI   ++ E++ S + 
Sbjct: 932  VPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAV-SRRG 990

Query: 1039 NV----XXXXXXXXXXXIASRKRPYQQEMSLLDILHRSRYQKLK-RSNDEDGKVPQLSXX 1093
            N+               + + KRP + E+SL ++LHR++ Q+ K R+ DE          
Sbjct: 991  NLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFKSRAADET----SEESA 1046

Query: 1094 XXXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTT 1153
                             AK PWL GNLVEE N+QG+I NR  FN+FANTNIY+FFRH TT
Sbjct: 1047 AEPEPELNEEEETIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTT 1106

Query: 1154 IYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRR 1213
            +YERL E+K+MN+ VTKEIN+R  V FAKDL+L+S QL EMGLDF G DAY+Q+  L +R
Sbjct: 1107 LYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKR 1166

Query: 1214 LINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDR 1273
            LI GD+EHQWFEESLRQAYNNKAFKLYT+DKV QSLVKHAHT++TD+KT+EIM  F KDR
Sbjct: 1167 LIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDR 1226

Query: 1274 NASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDK 1333
                TSAKDQI+YRLQVRS+MS+TENMFRIE++K++ +V IQ+IA+DDLTL EP++ E+K
Sbjct: 1227 TQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEK 1286

Query: 1334 WKYYVTSYALPHPTEGIPHEKLKIPFLERLIE----FGQDIDGTEVDEEFSPEGISVSTL 1389
            W+YYVTSY+L HPTEGI  E+L++PFLE+++E    +G D+D   +D +FSPEG+S STL
Sbjct: 1287 WRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSID-KFSPEGVSKSTL 1345

Query: 1390 KIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLR 1449
            KIKI P TY L IE GSYDVF+RK+ N++P I + N       +KK ++ +FL+   G +
Sbjct: 1346 KIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWK 1405

Query: 1450 NNLDEAQKLSMQKKWENLKDS 1470
             NLD+ Q  ++Q+K   +K++
Sbjct: 1406 KNLDDDQVKAIQEKLARVKEN 1426

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1428 bits (3696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 740/1305 (56%), Positives = 895/1305 (68%), Gaps = 126/1305 (9%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLNVKDALSYLEQVK QF+SRPDIYN FLDIMKDFKSQ IDTPGVIERVSTLFRGYP 
Sbjct: 210  YRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPS 269

Query: 276  LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335
            LIQGFNTFLP GYRI+C SNP+DPI+VTTP+G++T++       R  ++ Q+  +  +  
Sbjct: 270  LIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQALSQ-- 327

Query: 336  GNGVQQPSNVPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLV 395
             N + Q + +P                     + + S   ++         Q  Q+    
Sbjct: 328  -NNMMQQAQIP---------------------IGSISNNANLNAAVQSVDDQAKQAN--- 362

Query: 396  PQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 455
                 KK  DVEFSQAI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVYAQVT 
Sbjct: 363  -----KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTI 417

Query: 456  LFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 515
            LFQNAPDLL+DFKKFLPDSS                                        
Sbjct: 418  LFQNAPDLLDDFKKFLPDSSKEQQYTGQLPQQIPNQEQ---------------------- 455

Query: 516  XXXXFLYPASGYYGHPSNR---GIPQQNLPPIGSFSPPTN-GSTVHEAYQDQQHMQPPHF 571
                 L   SG Y  P N     + QQ+LPPIGSFSPP N G ++H+        Q PH 
Sbjct: 456  -----LEEFSGSYARPPNAPLDMVAQQSLPPIGSFSPPANTGISMHD------QSQRPHM 504

Query: 572  MPLPSIVQH----------GPNMVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXXXXX 621
            M LPS++QH           P +  QGI+N+  P+SD+R +     A             
Sbjct: 505  MALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVSDVRMAQYPNGAVPDYGQYPTHPQM 564

Query: 622  XXXXANTQ------------------------------YGDIPVRPEIDLDXXXXXXXXX 651
                A  +                              Y + PVRPEIDLD         
Sbjct: 565  KPDLATQRHILQQQEIQQQQLMLQQQQEQELLEQQQQQYVEAPVRPEIDLDPSIVPVVPE 624

Query: 652  XXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLG 711
                      L EE +FF+KAK++I NK +YTEFLK+LNL+SQD++ +DDLV KV++Y+G
Sbjct: 625  PTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIG 684

Query: 712  SNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRD 771
            S+KELF WF+NFVGYQ   K IENIVHEKHRLDLDLCEA GPSYKRLPKSDTFMPCSGRD
Sbjct: 685  SSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRD 744

Query: 772  DMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCL 831
            DMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ L
Sbjct: 745  DMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTL 804

Query: 832  ETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTA 891
            E IVNKI NM+E EK NFKL PGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPA+ A
Sbjct: 805  EAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAA 864

Query: 892  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISE 951
            P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISE
Sbjct: 865  PIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISE 924

Query: 952  ISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLK 1011
            ISSIKVDQ NK+IHWLTPKPKSQL+FD  D  I +DIL L++ FI H++ YS  DKERL 
Sbjct: 925  ISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLN 984

Query: 1012 DLLKYFISLFFSISFEKIEESL--YSHKQNVXXXXXXXXXXXIASRKRP--YQQEMSLLD 1067
            D LK FISLFFS+   +I  +L   ++++N              ++K+   +  E+S+ D
Sbjct: 985  DFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSD 1044

Query: 1068 ILHRSRYQKLKRSN-----DEDGKVPQLSXXXXXXXXXXXXXXXXXXXAKNPWLTGNLVE 1122
            ILHR++YQK+K SN      E+  +  +                    AK PWL G++++
Sbjct: 1045 ILHRTKYQKMKLSNRGSDSQEENNIDTI-IDEESDERLAEEADLIRQDAKRPWLLGDIID 1103

Query: 1123 EANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAK 1182
            + N+QGII +R  FNLFANTNIY+F RHWTT+YERLLE+K+MN  VTKEIN R +V FA+
Sbjct: 1104 KTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAE 1163

Query: 1183 DLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTI 1242
            DL L+S+QL  MGLDFV +D+Y+++LRLS+RLI  D+EHQWFEESLRQAYNN+AFKLYT+
Sbjct: 1164 DLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTV 1223

Query: 1243 DKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFR 1302
            DKV Q+LVKH HTLMTD KT E+M LF KDR +S TSAKDQI+YRLQ RSHMSNTE MFR
Sbjct: 1224 DKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFR 1283

Query: 1303 IEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLER 1362
            IE++K   ++ IQYIALDDLTLKE   +E+KWKYYVTSY+LPHPTEGI HE L+IPFL++
Sbjct: 1284 IEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQK 1343

Query: 1363 LIEFGQ-----DIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNK 1417
            ++EF Q     + +  + + ++SPEG+S S  KIKI P  Y L I+ GS+D+F+RK+ NK
Sbjct: 1344 ILEFDQEELENNDEENKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNK 1403

Query: 1418 YPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQK 1462
            YP   N++ +   +++KK +++ FL+   G + +L   ++LS++K
Sbjct: 1404 YPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHL--KKQLSLKK 1446

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1421 bits (3678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/1287 (57%), Positives = 894/1287 (69%), Gaps = 117/1287 (9%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLNVKDALSYLEQVK+QFS RPDIYN FLDIMKDFKSQ+IDTPGVIERVS LFRGYP+
Sbjct: 207  YRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPM 266

Query: 276  LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335
            L+QGFNTFLPQGYRIEC+++PD PIRVTTPMGT+T+      SG    +A      P S 
Sbjct: 267  LVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTL------SGGPAMEA------PSSS 314

Query: 336  GNGVQQPSN--VPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQS 393
             + +QQ  +   P +PS                 LA S+   S         +Q PQ   
Sbjct: 315  ESNLQQQQHHQSPTIPS-----------------LAASTFQES-------NFQQTPQ--- 347

Query: 394  LVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 453
              P++ + KN +VEFSQAI+YVNKIK RFADQPDIYK FLEILQTYQREQKPINEVY+QV
Sbjct: 348  --PEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQV 405

Query: 454  THLFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 513
            T LFQ+APDLL+DFKKFLP+SS + +                                  
Sbjct: 406  TVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGIQQRAAIPTPN-------------- 451

Query: 514  XXXXXXFLYPASGYYGHPSN---RGI-PQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPP 569
                     P    YG+P+N    G   QQNLPPIGSF+PP NG+   E     Q + P 
Sbjct: 452  ---------PKHQQYGYPNNYYPNGTGTQQNLPPIGSFAPP-NGTASREYAPGNQFVGPG 501

Query: 570  HFMPLPSIVQHG--------PNMVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXXXXX 621
                LPS++ +         P +VH G  NE  P+S+LR+ LT+Q               
Sbjct: 502  G---LPSMIPNDQALQQQQQPGLVH-GYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPG 557

Query: 622  XXXXANT------QY-GDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKR 674
                 N       QY  + P+RPEIDLD                   L EE  FFEKAK+
Sbjct: 558  QMDINNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKK 617

Query: 675  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIE 734
            +IG K +YTEFLKILNLYSQD+L  D+L  KV++YLGSN+ELFTWFKNFVG+QEK   IE
Sbjct: 618  FIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIE 677

Query: 735  NIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 794
            NIVHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSG
Sbjct: 678  NIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 737

Query: 795  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPG 854
            FIAHRKNQYEE+LFK EEERHEYDF IESNLRTIQ LETI NKI NMT  EK NFKLPPG
Sbjct: 738  FIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPG 797

Query: 855  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 914
            LGHTS TIYKKVIRKVYDK+RGFEIID LHE PA+T PVVLKRLKQKDEEWRRAQREWNK
Sbjct: 798  LGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNK 857

Query: 915  VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ 974
            VWRELEQKV++KSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNK+IHWLTPKPKSQ
Sbjct: 858  VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQ 917

Query: 975  LDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESL- 1033
            L+F F D +IF DIL L   FI H++ YSNP+KER+KD L+ F+SLFFSI  +K+ E+L 
Sbjct: 918  LEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALS 977

Query: 1034 -YSHKQNVXXXXXXXXXXXI-----------ASRKRPYQQEMSLLDILHRSRYQKLKR-- 1079
              SH               I            S+KRP   ++ L DIL + +YQK+++  
Sbjct: 978  DRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLADILRKHKYQKIRKQA 1037

Query: 1080 --SNDEDGKV---PQLSXXXXXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRS 1134
              SN+E+ +      +                     K PWL GN++E A++ G I NR 
Sbjct: 1038 KESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRK 1097

Query: 1135 IFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEM 1194
            +FN+FANTNIY+FFR WT IYERL E+KQ+NE+VTKE+N+R    FAKDL+L+S+QL +M
Sbjct: 1098 VFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDM 1157

Query: 1195 GLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAH 1254
            GLDFVG ++Y+++L LS+RLI  D+EHQWFEESLRQA+NNKAFKLYT+DKV QSLVKHAH
Sbjct: 1158 GLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAH 1217

Query: 1255 TLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSI 1314
            T++ D KT+EIM LF KDR  S+TSAK+QI+YRLQ R+HM+NTENMFRIEF++   HV I
Sbjct: 1218 TILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCI 1277

Query: 1315 QYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTE 1374
            QYIAL+DLT+K+PK+ E  W+YYVTSY+LPHPTEG+P ++LKIPFLE+ +E   D +G  
Sbjct: 1278 QYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEG-- 1335

Query: 1375 VDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQK 1434
             D + SPEG+S S LKIKI P +Y L IE GS+D+F+RK+ N YPT +++  ++  + Q 
Sbjct: 1336 -DNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSIDQ- 1393

Query: 1435 KELISKFLDCAVGLRNNLDEAQKLSMQ 1461
               ++KFLD   G + NL  A   +++
Sbjct: 1394 ---MTKFLDGKNGWKKNLTTADSTNIE 1417

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1412 bits (3655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/1265 (57%), Positives = 870/1265 (68%), Gaps = 85/1265 (6%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLNVKDALSYLEQVK QF+SRP IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G+P 
Sbjct: 218  YRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPA 277

Query: 276  LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335
            LIQGFNTFLPQGYRIECSSNP++PI+VTTPMG   V  N+  S         +G  P + 
Sbjct: 278  LIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---VLENVRGSDITADQQPAIGQLPTT- 333

Query: 336  GNGVQQPSNVPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLV 395
                Q P    + P               L L +T +   ++QQ           S ++ 
Sbjct: 334  ----QSPIQASLPPPQ----------SAHLHLPSTVAAATTVQQ-----------SANVH 368

Query: 396  PQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 455
             + + KK  DVEFSQAISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPINEVYAQVT 
Sbjct: 369  AENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTV 428

Query: 456  LFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 515
            LF NAPDLL+DFKKFLPDSSAS                                      
Sbjct: 429  LFHNAPDLLDDFKKFLPDSSAS-------------------NEQQPKQSPYSPQVYSGAD 469

Query: 516  XXXXFLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNG----STVHEAYQDQQHMQPPHF 571
                ++Y  +G Y +P     PQ NLPPIGSFSPP NG    +     + D+QH+     
Sbjct: 470  MARGYMYNNTGVY-YPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVP 528

Query: 572  MPLPSIVQHGPNMVHQGIANENPPLSDLRTSLT----EQYAXXXXXXXXXXXXXXXXXAN 627
               P   QH P+M++    N+   +S++R   T     QY                    
Sbjct: 529  AMAPHEQQHAPSMIN----NDGIQISNMRGGGTVPALNQYGMISPHDYTQQQAKQVQQFQ 584

Query: 628  TQY----------------GDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEK 671
                               GD+ VRPEIDLD                   L+EE +FFEK
Sbjct: 585  EDQQQQQQQSMMMDEQYGSGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEK 644

Query: 672  AKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTK 731
             K+ IGN+ +Y EFLK+LNL+SQD++ +D+LV KV+ YL    ELF WFKNFVGYQ+K K
Sbjct: 645  VKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPK 704

Query: 732  CIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE 791
             IEN++HEKHRLDLDLCEA+GPSYK+LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE
Sbjct: 705  IIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE 764

Query: 792  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKL 851
            DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKL
Sbjct: 765  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKL 824

Query: 852  PPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQRE 911
            PPGLGHTS+TIYKK+IRKVYDKERGFEIID LHEHPA+T P+VLKRLKQKDEEWRRAQRE
Sbjct: 825  PPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQRE 884

Query: 912  WNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKP 971
            WNKVWRELEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ NK++HWLTPKP
Sbjct: 885  WNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKP 944

Query: 972  KSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEE 1031
            K QLD+ F D +I +DI+ L D F+ H + YSNPDKERLKDL + FISLFF I  + I  
Sbjct: 945  KKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISA 1004

Query: 1032 SLYSHKQNVXXXXXXXXXXXIASRKRPYQQ-EMSLLDILHRSRYQKLKRSNDEDGKVPQL 1090
            +L + K +              S+KRP    E+SL DILHR++YQKLK     +G+   +
Sbjct: 1005 ALDT-KSDEGKSTDTKFEKADDSKKRPRPDVELSLSDILHRAKYQKLK-----NGEGLGM 1058

Query: 1091 SXXXXXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRH 1150
            S                   A  PWL G++VE ANS G++ +R+++NLF NTN+YIF RH
Sbjct: 1059 SEDDDEEKLAKEAEEMSEKNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRH 1118

Query: 1151 WTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRL 1210
            W+T+Y RLLE+KQM+ERVTKEIN R  V FA+DL+LLS+QL +MGLDF G++AY++ L+L
Sbjct: 1119 WSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKL 1178

Query: 1211 SRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFV 1270
            S+RLI  +LEHQWFEESLRQAYNNKAFKLYT+DKV  SLVKHAHTLMTD K++E+M LF 
Sbjct: 1179 SKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFE 1238

Query: 1271 KDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKAD 1330
            KDR  S+T  KDQI+YRL  RSHMS+TENMFR++++K T HVSIQYI LDD+TL++ K D
Sbjct: 1239 KDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDD 1298

Query: 1331 EDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTEV-DEEFSPEGISVSTL 1389
             ++W YY+TSYALPHPTEGI  +KL +PFLER++EF  D+   E   + ++P G S S L
Sbjct: 1299 NERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKL 1358

Query: 1390 KIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLR 1449
            KI I P TY+L I++GSYD+F+R + N+YP   +      MV ++KE   KFLD   G +
Sbjct: 1359 KINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWK 1418

Query: 1450 NNLDE 1454
             +L +
Sbjct: 1419 KDLSD 1423

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1380 bits (3573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1291 (55%), Positives = 867/1291 (67%), Gaps = 104/1291 (8%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLNVKDALSYLEQVKFQF +RPDIYNLFLDIMKDFKSQ IDTPGVIERVS+LF+GYP 
Sbjct: 185  YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244

Query: 276  LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335
            LIQGFNTFLPQGYRIECS+NP+DPI+VTTPMG++T   N +P                  
Sbjct: 245  LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQ----------------- 287

Query: 336  GNGVQQPSNVPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLV 395
                + PS     PS +               +A  + L S   P +P    + Q+    
Sbjct: 288  ----KSPS-----PSDIQTNNQQTQA------IAQEAQLQSQATP-IPTQHDVGQNFG-- 329

Query: 396  PQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 455
                AKK  DVEFSQAI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT 
Sbjct: 330  ---SAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTI 386

Query: 456  LFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 515
            LFQNAPDLL+DFKKFLPDSSAS +                                    
Sbjct: 387  LFQNAPDLLDDFKKFLPDSSASGSEETQVQQQQHYQSLSDKMGGNAEAANYAASG----- 441

Query: 516  XXXXFLYPASGYYGHPSNRGIP---------QQNLPPIGSFSPPTNGSTVHEAYQDQQHM 566
                 +   +GYY  P   G+          QQNLPPIGSFSPPTNG  V +  Q     
Sbjct: 442  -----MNAQTGYY-EPVKGGVSYNTQQNQHQQQNLPPIGSFSPPTNGPFVDQTQQSANPE 495

Query: 567  QPPHFMPLPSIVQHGPNMVHQGI--------------------------ANENPPLSDLR 600
                 M LPS++ +   +  Q I                          +N++ P+S+LR
Sbjct: 496  TQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLR 555

Query: 601  TSLTEQYAXXXXXXXXXXXXXXXXXANTQYG---DIPVRPEIDLDXXXXXXXXXXXXXXX 657
            T++ EQ                        G   ++ VRPEIDLD               
Sbjct: 556  TTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVRPEIDLDPSLVPVVPEPTEPIE 615

Query: 658  XXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELF 717
                L EE  FFE+ K+ IGNK +Y EFLKILNL+S D+L +D+LV+KV++Y+G+NKELF
Sbjct: 616  NSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELF 675

Query: 718  TWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEV 777
             WFK FVGYQ+K K IENIVHEKH+LDLDLCEA+GPSYK+LPK+DTFMPCSGRDDMCWEV
Sbjct: 676  DWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEV 735

Query: 778  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNK 837
            LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LETI NK
Sbjct: 736  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANK 795

Query: 838  IENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKR 897
            I NMT+ EKA F+LPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALH +PA++ P++L+R
Sbjct: 796  IANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRR 855

Query: 898  LKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKV 957
            LKQKDEEWRRAQREWNK+WR+LEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEI+ IKV
Sbjct: 856  LKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKV 915

Query: 958  DQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYF 1017
            DQ +K+IHWLTPKPK+QLD+DFPD +I +DI+ L   F  +T  YSNPDKER+KD+L+ F
Sbjct: 916  DQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVF 975

Query: 1018 ISLFFSISFEKIEESL----YSHKQNVXXXXXXXXXXXIA------------SRKRPYQQ 1061
            +S FFSI  +++ ++L    +S   N            IA            S+KRP+  
Sbjct: 976  VSQFFSIPLKEVSDALERRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPFDN 1035

Query: 1062 EMSLLDILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXXXXXXXXXXXXAKNPWLTGNLV 1121
            ++++ DILH+++ QK K + + DG                          +  WL G++V
Sbjct: 1036 DLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVV 1095

Query: 1122 EEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFA 1181
            + AN +  + NR+I+NLFANTNIYIFFRH  T+YERL E+KQ+N+ + KEI +R   TFA
Sbjct: 1096 DSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFA 1155

Query: 1182 KDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYT 1241
            KDL L+S+QLSE+GLDF   DAY+Q+L LS+RLI GD+EHQWFEES+RQAYNN+AFKLYT
Sbjct: 1156 KDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYT 1215

Query: 1242 IDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMF 1301
            IDKV QS VKHAHTL++D+KT+EIM LF   RN + T+ KDQI+YR+Q RSHMS+TENMF
Sbjct: 1216 IDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMF 1275

Query: 1302 RIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLE 1361
            RIE+ +   H SIQYIALDDLTLK  K+ E+ W YYVTSY+L +PTEG+PHE L++PFLE
Sbjct: 1276 RIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLE 1335

Query: 1362 RLIEFGQDIDGTEVDEE-FSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPT 1420
            ++IEF Q+      +   +S  GIS S L I I    Y L ++ GS DV++R    KYP 
Sbjct: 1336 KVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPI 1395

Query: 1421 IANDNTQKGMVSQKKELISKFLDCAVGLRNN 1451
            +A+D ++   +S+K + I K L    G  N+
Sbjct: 1396 VASDESRAANISEKTQEIRKVLSHYDGNSND 1426

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1363 bits (3527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 725/1319 (54%), Positives = 875/1319 (66%), Gaps = 134/1319 (10%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 129  YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188

Query: 276  LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335
            LIQGFNTFLP GY IEC S+P+DPI+VTTP GT      I  +G G   A    + P   
Sbjct: 189  LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTI---GEIPITGAGGNHAHGANTEPR-- 243

Query: 336  GNGVQQPSNVPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLV 395
               +Q   NVP V  S                 A  S          PA    P +    
Sbjct: 244  ---LQSTQNVPTVYRS-----------------AEGS----------PAAIATPATTQEQ 273

Query: 396  PQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 455
                 KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT 
Sbjct: 274  YGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTV 333

Query: 456  LFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 515
            LFQNAPDLL+DFKKFLPDSSA                                       
Sbjct: 334  LFQNAPDLLDDFKKFLPDSSAP-------------------------------QLQSHQQ 362

Query: 516  XXXXFLYPASGYYGHPSNRGIP-------QQNLPPIGSFSPPTNGSTVHEAYQDQQHMQP 568
                 + P  G+      + +P       QQNLPP+G+FS P +                
Sbjct: 363  INGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDH--------------- 407

Query: 569  PHFMPLPSIVQHGPN----------MVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXX 618
             H M LPS+   GPN          +V QG++N++ P+SDLR +    +           
Sbjct: 408  -HPMSLPSV--QGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASF----------R 454

Query: 619  XXXXXXXANTQYGDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGN 678
                    + QY +  VRPEIDLD                   L EE TFF+KAK++IGN
Sbjct: 455  ASEYNQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGN 514

Query: 679  KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVH 738
            K +YTEFLKILNLYSQD+L+ + LVE V  YL  + ELF WFK+FVGYQE+ K IEN++H
Sbjct: 515  KQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIH 574

Query: 739  EKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAH 798
            EKHRLDLDLCEA GPSYKRLPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAH
Sbjct: 575  EKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAH 634

Query: 799  RKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHT 858
            RKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ LETI NKI NMT  EKA FKLPPGLGHT
Sbjct: 635  RKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHT 694

Query: 859  SMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRE 918
            S+TIYKKVIRKVYDK+RGFEIIDALHEHPA+T P+VLKRLKQKDEEWRRAQREWNKVWRE
Sbjct: 695  SVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRE 754

Query: 919  LEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFD 978
            LEQKVF+KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ+NK+IH LTPK KSQL +D
Sbjct: 755  LEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYD 814

Query: 979  FPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLY---- 1034
            F +  +F DIL L   F+ +   YS  D ERLKD  K FISLFFS    +IEE L     
Sbjct: 815  FKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSS 874

Query: 1035 -----SHKQNVXXXXXXXXXXXIASRKRPYQQEMSLL-DILHRSRYQKLKRSNDEDGKVP 1088
                 SH  +             ++RKR       LL DIL+R++ QK+ +    D    
Sbjct: 875  QNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQ--- 931

Query: 1089 QLSXXXXXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFF 1148
              S                   AK PWL G++V+EA++ G + +R  FN+FANTNIY+FF
Sbjct: 932  --SSEEFEKESDIEEKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFF 989

Query: 1149 RHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVL 1208
            RH TT+YERL+E+K++N  VTKEI+ R  V FAKDL+L+S+QL++MGLDF G DAY+++L
Sbjct: 990  RHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEELL 1049

Query: 1209 RLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMAL 1268
            RLSR LI+G+LEHQWFEESLRQAY NKAFKLYTIDKV Q+LVKHAHT++ D KT EIM L
Sbjct: 1050 RLSRSLISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLL 1109

Query: 1269 FVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPK 1328
            F  DR +++TS KDQI+YRLQVRS+MSN ENMFRIE++  T H SIQ++A++DLTL EPK
Sbjct: 1110 FDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPK 1169

Query: 1329 ADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEF--GQDIDGTEVDEEFSPEGISV 1386
            +  DKW+YY+TSY+L HPTEGI H+ L+ PFLE++IE   G   DG   DE +SPEG++ 
Sbjct: 1170 SLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDG---DERYSPEGVAS 1226

Query: 1387 STLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAV 1446
            S +K+KI P+TY + +E G +D+F+RK+ NK+PT    + +K   ++ K ++  FL+   
Sbjct: 1227 SNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRV--DVKKKKSAELKLVLEGFLNGER 1284

Query: 1447 GLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQGIESETEKGKITKQEQSDNLDSSTAS 1505
            G +  L   +    +++ E +K++        + I ++T+    T  + + N+ +++ S
Sbjct: 1285 GWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEE-ISTDTKAALSTTTDTAGNVSTASFS 1342

 Score = 57.4 bits (137), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%)

Query: 395 VPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 454
           VP +D      +    A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+
Sbjct: 121 VPAQDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 180

Query: 455 HLFQNAPDLLEDFKKFLP 472
            LF   P L++ F  FLP
Sbjct: 181 TLFHGYPALIQGFNTFLP 198

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1357 bits (3513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/1286 (56%), Positives = 885/1286 (68%), Gaps = 83/1286 (6%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQAIDTPGVIERVS LF+GYP 
Sbjct: 158  YRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPN 217

Query: 276  LIQGFNTFLPQGYRIECSSNPDDP--IRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPE 333
            LIQGFNTFLPQGY+IECSSNP+DP  I+VTTP GTT         G  T +   L     
Sbjct: 218  LIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTT---------GSVTLNTAPLEQRYP 268

Query: 334  SDGNGVQQPSNVPMVP--SSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQS 391
            S+ N +  P ++ +    S +                  +      Q      H    Q 
Sbjct: 269  SNENVLLSPDHLQLQQHHSVLQQEQQQPQPQPQQQPQPQTQTQTQTQTQTQQQHYPDQQD 328

Query: 392  QSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYA 451
            Q  +    AKK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYA
Sbjct: 329  QHYL----AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYA 384

Query: 452  QVTHLFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 511
            QVT LFQNAPDLL+DFKKFLPD+SA  +                                
Sbjct: 385  QVTVLFQNAPDLLDDFKKFLPDASAPQSTTTPA--------------------------- 417

Query: 512  XXXXXXXXFLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHF 571
                       P +G   +P  +  PQQNLPP+GSFSPP++GS     +     +QPP  
Sbjct: 418  -----------PVNGGTFYP--QAAPQQNLPPLGSFSPPSSGSAREGEHVGLPAVQPPSM 464

Query: 572  MPLPSIVQHGPNMVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXANTQYG 631
                   QH   ++ QG++N++ P+S++R +    Y                     QY 
Sbjct: 465  DISGQPQQH---IITQGMSNDDIPISEVRNTADGAY-----------RSDLRNSGEVQYM 510

Query: 632  DIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILNL 691
            +   RPEIDLD                   L EE +FF+KAK++IGNK +YTEFLKILNL
Sbjct: 511  EPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNL 570

Query: 692  YSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAF 751
            YSQD+LD D+LVEKV++YLG NKELF WFKNFVGY++K K IENIVHEKHRLDLDLCEA 
Sbjct: 571  YSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEAC 630

Query: 752  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 811
            GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 631  GPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 690

Query: 812  EERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVY 871
            EERHEYDFYIE+NLRTIQ LETI NKI NMT  EKA FKL PGLGHTS+TIYKKVIRKVY
Sbjct: 691  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVY 750

Query: 872  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 931
            DK+RGFEIIDALHE P++  P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHL
Sbjct: 751  DKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 810

Query: 932  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCL 991
            GLTFKQADKKLLTTKQL+SEIS+IKVDQ NK+IH LTPKPKSQLD+ F D+ + YDIL L
Sbjct: 811  GLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNL 870

Query: 992  ADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVXXX---XXXXX 1048
            A  FI   T YSNPDKE++ D LK F+ LFFS    ++E +    + ++           
Sbjct: 871  AKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQ 930

Query: 1049 XXXIASRKRPYQQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXXXXXXXXXX 1108
                 SRKR  ++E  L D+L R++YQK  R+  E+  +P+ S                 
Sbjct: 931  ENSDLSRKRTREEENLLKDVLRRNKYQK-GRNFAEEEPIPEESEFAEKTVEEKEEEEIIR 989

Query: 1109 XXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERV 1168
              AK PWL G++V+EAN  G ++NR  FN+FANTNIY+FFRH  T+Y RL E+K +NE V
Sbjct: 990  QEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAV 1049

Query: 1169 TKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESL 1228
            T+EI  R  V FAKDL+L+S+QLS+MGLDF G DAY QVL LS+RLI GD+EHQWFEESL
Sbjct: 1050 TEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESL 1109

Query: 1229 RQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRL 1288
            RQAY NKAFK+YTIDKV QSLVKHAHT++TD KT EIM LF KDR    TSAK+QI+YRL
Sbjct: 1110 RQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRL 1169

Query: 1289 QVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTE 1348
            QVRSHM+  ENMFRIE+++++ H SIQ++A+DDLTL+EPK+ ED+WKYYVTSY+L HPTE
Sbjct: 1170 QVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTE 1229

Query: 1349 GIPHEKLKIPFLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYD 1408
            GI HE+L+ PFLE+++E  ++      + E+SPEG+S S LK+KI P TY L ++ GSYD
Sbjct: 1230 GISHEELQPPFLEKILEKEEEFQCE--NGEYSPEGVSSSNLKVKINPETYSLDVQPGSYD 1287

Query: 1409 VFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLK 1468
             F+RK+ NK+P   N++T K    +K + ++ +L+ A G +  L  ++ L  Q + E   
Sbjct: 1288 FFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIE--- 1344

Query: 1469 DSIAKTSAGNQGIESETEKGKITKQE 1494
                KT     G+ES+ +K  I K +
Sbjct: 1345 --YVKTKGTLVGLESK-DKNDIVKND 1367

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1347 bits (3485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/1262 (55%), Positives = 869/1262 (68%), Gaps = 64/1262 (5%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+GYPI
Sbjct: 142  YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPI 201

Query: 276  LIQGFNTFLPQGYRIECSSNPDDP--IRVTTPMGTTT-VNNNISPSGRGTTDAQELGSFP 332
            LIQG NTFLPQGY+IEC+ NP+DP  I+VTTP      +N     +G G  +       P
Sbjct: 202  LIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHP-SLMP 260

Query: 333  ESDGNGVQQPSNVPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQ 392
              D   V  P  V   P++V            L    T+  +P+     +P H Q  Q+Q
Sbjct: 261  SDD---VSPPKLVGHEPAAV---------QPKLENAPTNLPVPTTFNQNLPQHEQ--QNQ 306

Query: 393  SLVPQEDA--------------KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQT 438
                Q  A              + + DVEFS AISYVNKIKTRFADQP+IYKHFLEILQT
Sbjct: 307  QHGSQSPAMPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQT 366

Query: 439  YQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXX 498
            YQREQKPI+EVYAQVT LFQNAPDLL+DFKKFLPD++A+                     
Sbjct: 367  YQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLLQQQQQQQQQLQQQ 426

Query: 499  XXXXXXXXXXXXXXXXXXXXXFLYPASG----YYGHPSNRGIPQQNLPPIGSFSPPTNGS 554
                                   +   G    +Y   + +G PQ NLPP+GSFSPP NG 
Sbjct: 427  QIQQHQSHYQNASQDLDQRQQHTHQPFGNTVPFYQ--TQQGRPQ-NLPPLGSFSPPINGR 483

Query: 555  TVHEAYQDQQHMQPPHFMPLPSIVQHGP-NMVHQGIANENPPLSDLRTSLTEQYAXXXXX 613
              ++   +   +QPP        V H P ++V Q I     PLSDLR ++   +A     
Sbjct: 484  E-NDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTLPLSDLRGAMDGNFAPQPLQ 542

Query: 614  XXXXXXXXXXXXANTQYGDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAK 673
                         + Q+ +   RPEIDLD                   L EE +FF++AK
Sbjct: 543  SQ-----------DVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAK 591

Query: 674  RYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCI 733
            +Y+GNK +YTEFLKILNL+SQD++  ++LV+KV+ YLG + ELF WFK+FV Y EK K I
Sbjct: 592  KYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHI 651

Query: 734  ENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDS 793
            EN++HEKHRLDLDLCEA  PSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDS
Sbjct: 652  ENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDS 711

Query: 794  GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPP 853
            GFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETI NKI NMT  EK  FKLPP
Sbjct: 712  GFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPP 771

Query: 854  GLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWN 913
            GLGHTSMTIYKKVIRKVYDK+RGFEIIDALHE+PAV+ P++LKRLKQKDEEWRRAQREWN
Sbjct: 772  GLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWN 831

Query: 914  KVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKS 973
            KVWRELEQKVF+KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQTNK+I+  TPKPKS
Sbjct: 832  KVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKS 891

Query: 974  QLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESL 1033
            QLD+D  DK + +DILCL + FI H++ YSNPDKE+L    K F+S+FFSIS+++IE S 
Sbjct: 892  QLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENST 951

Query: 1034 YSHKQNVXXXXXXXXXXXIASRKRPYQQEMSLLDILH-RSRYQKLKRSNDEDGKVPQLSX 1092
             +    V              RKR ++ E  L ++L  + ++ K + ++ ED  +     
Sbjct: 952  PADSDAVSNSN---------PRKRLWESEQPLKELLRSKHKHHKKRDTSAEDDSISDDQN 1002

Query: 1093 XXXXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWT 1152
                              AK PWL GN+++EAN  G + NR IFNLFANTN+Y+FFRH T
Sbjct: 1003 SPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLT 1062

Query: 1153 TIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSR 1212
            T+Y+RL E+K MNE VT+EIN+R+ V FAKDL+L+S+QLS+MGLDF G+DAY Q+L L +
Sbjct: 1063 TMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCK 1122

Query: 1213 RLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKD 1272
            RLI  D++HQWFEESLRQAY NKAFK+YT+DKV QSLVKHAH+++TDAK+AEIM LF KD
Sbjct: 1123 RLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKD 1182

Query: 1273 RNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADED 1332
            R  + TS K+QI+YRLQVRS+M  TENMFR+E +K + HV IQY+A+DDLTLKEP++ +D
Sbjct: 1183 RRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKD 1242

Query: 1333 KWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIK 1392
            +W YY+TSYAL HPTEGIPHE++K+PFLE+ ++  ++ D  E  EE SP G S+S L+I+
Sbjct: 1243 RWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEAD--EGSEERSPSGHSLSNLRIQ 1300

Query: 1393 IQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNL 1452
            + P +Y+L IE GS D+FTR A N++   + +N+   +  +K++ +   LD + G +  +
Sbjct: 1301 VNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGM 1360

Query: 1453 DE 1454
             +
Sbjct: 1361 SQ 1362

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1315 bits (3403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1244 (56%), Positives = 840/1244 (67%), Gaps = 60/1244 (4%)

Query: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
            YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+GYP+
Sbjct: 249  YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPV 308

Query: 276  LIQGFNTFLPQGYRIECSSNPDDP--IRVTTPMGTT---TVNNNISPSGRGTTDAQELGS 330
            LIQG NTFLPQGY+IEC+SNP DP  I+VTTP  TT   ++++N        T    +G 
Sbjct: 309  LIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHN--------TGGSAVGG 360

Query: 331  FPESDGNGVQQPSNVPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQ 390
                       PS +P   ++V            LP  A +     +   E    R+I +
Sbjct: 361  HLAGPATVSTSPSQIPRQETAV-SETKQEETPVDLPASA-AFAQDQVHHAESDTQREIQK 418

Query: 391  SQSLVPQEDA------KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQK 444
            S  L   +        + N DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQREQK
Sbjct: 419  SAQLQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQK 478

Query: 445  PINEVYAQVTHLFQNAPDLLEDFKKFLPDSSAS---------ANXXXXXXXXXXXXXXXX 495
            PI+EVY QVT LFQNAPDLL+DFKKFLPD++A+                           
Sbjct: 479  PIHEVYTQVTSLFQNAPDLLDDFKKFLPDATAAHEQHQQLLQQQQQQQQLQHQIQLQQQQ 538

Query: 496  XXXXXXXXXXXXXXXXXXXXXXXXFLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGST 555
                                    F +PAS +Y H   R    QNLPP+G+FSPP NG  
Sbjct: 539  SQQYQSFQSSPQELDQRQQQSNSPFNHPAS-FYQHQQARA---QNLPPLGNFSPPINGRD 594

Query: 556  VHEAYQDQQHMQPPHF-MPLPSIVQHGPNMVHQGIANENPPLSDLRTSLTEQYAXXXXXX 614
             +EA  +   +QPP    P     Q   ++V QG+ N + P+SD+R  +   +A      
Sbjct: 595  -NEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYS 653

Query: 615  XXXXXXXXXXXANTQYGDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKR 674
                        + QY +   RPEIDLD                   L EE +FF+KAK+
Sbjct: 654  Q-----------DVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKK 702

Query: 675  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIE 734
            Y+GNK +YTEFLKILNL+SQD++D D+LV+KV+ YLG N ELF WFK+FV Y E+ K IE
Sbjct: 703  YMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIE 762

Query: 735  NIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 794
            N+VHEKHRLDLDLCEA  PSYK+LPK+DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSG
Sbjct: 763  NVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSG 822

Query: 795  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPG 854
            FIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETI NKI NMT  EK  FKLPPG
Sbjct: 823  FIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPG 882

Query: 855  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 914
            LGHTS TIYKKVIRKVYDK+RGFEIIDALHE+PAV+ P+VL+RLKQKDEEWRRAQREWNK
Sbjct: 883  LGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNK 942

Query: 915  VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ 974
            VWRELEQKVF+KSLDHLGLTFKQADKKLLT KQLISEISSIK+DQ NK+I+  T KPKSQ
Sbjct: 943  VWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQ 1002

Query: 975  LDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLY 1034
            LDFD  DK + +DIL L DTFI H+T YSNPDKE+L    + F+S+FFSI    ++    
Sbjct: 1003 LDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSE 1062

Query: 1035 SHKQNVXXXXXXXXXXXIASRKRPYQQEMSLLDILHRSRYQKLKR-SNDEDGKVPQLSXX 1093
             HK               ++RKR    +    D+L     Q  K+ S  ED         
Sbjct: 1063 EHK----------VENGDSTRKRSRDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDT 1112

Query: 1094 XXXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTT 1153
                             AK PWL GN+++EAN+ G + NR  +N+FANTNIY+FFRH TT
Sbjct: 1113 AAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTT 1172

Query: 1154 IYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRR 1213
            +Y+RL E K +NE VTKEIN+R  V FAKDL+L S+QLS+MGLDF G DAY+Q+L L +R
Sbjct: 1173 MYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKR 1232

Query: 1214 LINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDR 1273
            LI  D+EHQWFEESLRQAY NKAFK+YT+DKV QSLVKHAH+++TDAKTAEIM LF KDR
Sbjct: 1233 LIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDR 1292

Query: 1274 NASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDK 1333
             A TTS ++QI+YRLQVRS M  TENMFRIE +  + HVSIQ++A+DDLTL +P + +D+
Sbjct: 1293 KAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQ 1352

Query: 1334 WKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKI 1393
            W+YY+TSY+L HPTEG+PHE++K PFLE+ +    D D  E  E +SP G SVS L+I+I
Sbjct: 1353 WQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLR--DDGDSDEDSEWYSPGGQSVSQLRIQI 1410

Query: 1394 QPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKEL 1437
             P +Y L IE  S D+FTR   NK+PT   + + +   + +K L
Sbjct: 1411 NPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSL 1454

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1258 bits (3254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/1158 (56%), Positives = 793/1158 (68%), Gaps = 81/1158 (6%)

Query: 401  KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 460
            +K  DVEFSQA+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT LFQNA
Sbjct: 356  EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415

Query: 461  PDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF 520
            PDLL+DFKKFLPDSS S                                           
Sbjct: 416  PDLLDDFKKFLPDSSPSVTTQQPVQPQQQALPQQQQP----------------------- 452

Query: 521  LYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTV---HEAYQDQQHMQPPHFMPLPSI 577
            +Y  +  Y          QNLPP+G+FSPP+NG+      E   + QH    H M LPS+
Sbjct: 453  MYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH----HMMALPSM 508

Query: 578  VQ----HGPNMVHQGIA---NENPPLSDLRTSLTEQ---------------YAXXXXXXX 615
            +Q    H      Q IA   NE  P+SDLR+ + +                         
Sbjct: 509  LQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYTPIELAQLQQQQQQQQQQ 568

Query: 616  XXXXXXXXXXANTQYG-DIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKR 674
                          Y  +  VRPEIDLD                   L EE  FF+KAK+
Sbjct: 569  QQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKK 628

Query: 675  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIE 734
            +IGNK +Y EFLKILNLYSQDIL LDDL+EKVD+YLGSNKELF WFKNFVG+Q+K K IE
Sbjct: 629  FIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIE 688

Query: 735  NIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 794
            N+VHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSG
Sbjct: 689  NVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 748

Query: 795  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPG 854
            FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLP G
Sbjct: 749  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIG 808

Query: 855  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 914
            LGHTS TIY+KVIRKVYDKERGFEIIDALHE+P+V  PVVLKRLKQKD+EWRRAQREWNK
Sbjct: 809  LGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNK 868

Query: 915  VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ 974
            VWRELEQKVFFKSLDHLGLTFKQ+DKKLLTTKQL++EISSIKVDQTNK+IHWLTPKPKSQ
Sbjct: 869  VWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQ 928

Query: 975  LDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLY 1034
            LD++  DK + +DIL LAD FI HT++YSNPDKERL+D L+ +I LFFSI   +I++++ 
Sbjct: 929  LDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE 988

Query: 1035 SHKQNVXXXXXXXXXXXIA-SRKRPYQQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSXX 1093
            +   N               S KRP   E+ L DIL+RSRYQ+LK S   D     L   
Sbjct: 989  AAIDNGKQLDENEQNSSKKNSNKRPRDVEICLSDILNRSRYQRLKHS--LDSSEASLGAV 1046

Query: 1094 XXXXXXXXXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTT 1153
                             AK PWL G+LVEEANSQG+IQNR I+N+FAN N+Y+F R+  T
Sbjct: 1047 SPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLIT 1106

Query: 1154 IYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRR 1213
            IY+RL E+K +N+ VTKEIN R  V FAKDL+L+S+QL  MGLDF G D+Y Q+L LS+R
Sbjct: 1107 IYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKR 1166

Query: 1214 LINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDR 1273
            LI GDLEHQWFEESLRQAY N+AFKLYTIDKV QSLVKHAH +MTD+K++++MALF KDR
Sbjct: 1167 LIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDR 1226

Query: 1274 NASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDK 1333
             +S+T++KDQI+YRLQ RSHMS TE+MFRIE++ +   +SIQYIALDDLTL+EPK  EDK
Sbjct: 1227 ISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDK 1286

Query: 1334 WKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQ-DIDGTEVDEEFSPEGISVSTLKIK 1392
            WKYY+TSY+L HPTEGIP E++KIPFL+++IE  Q  ++  + + ++SPEG+S S L IK
Sbjct: 1287 WKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIK 1346

Query: 1393 IQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNL 1452
            I P TY+L +E GS+D+F+RK+ NK+P      + K     ++     FL+   G +  L
Sbjct: 1347 IDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQL 1406

Query: 1453 DEAQKLSMQKKWENLKDSIAKTSAGNQGIESETEKGKITKQEQSDNLDSSTASV-LPASI 1511
                   +++K+ +LK+                     T Q++S +  S T SV L AS 
Sbjct: 1407 SSDAISKIEQKFNDLKNG--------------------TFQQRSRSATSETTSVPLNASD 1446

Query: 1512 TTVPQDDNIETTGNTESS 1529
            +T  +    E+TG +E+S
Sbjct: 1447 STQKEQ---ESTGTSETS 1461

 Score =  187 bits (474), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 85/99 (85%), Positives = 92/99 (92%)

Query: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
           YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180

Query: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNN 314
           LIQGFNTFLPQGY IECSSNPDDPI+VTTP+G+  V N+
Sbjct: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188

Query: 471 LP 472
           LP
Sbjct: 189 LP 190

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 283
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 284 LP 285
           LP
Sbjct: 426 LP 427

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1191 bits (3080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/869 (66%), Positives = 677/869 (77%), Gaps = 9/869 (1%)

Query: 628  TQYGDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLK 687
             QY DI VRPEIDLD                   L EE +FF+KAK++IGNK LYTEFLK
Sbjct: 758  VQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLK 817

Query: 688  ILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDL 747
            ILNLYSQD+LD+D LVEKV+ YLG +KELFTWFKNFVGYQ++ K IEN++HEKHRLDLD+
Sbjct: 818  ILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDM 877

Query: 748  CEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 807
            CEA GPSYK+LPKSDTFMPCSGRD+MCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETL
Sbjct: 878  CEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETL 937

Query: 808  FKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVI 867
            FK+EEERHEYDFYIESNLRTIQ LETI +KI NMTE EKANFKLPPGLGHTS+TIYKKVI
Sbjct: 938  FKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVI 997

Query: 868  RKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKS 927
            RKVYDKERGFEIIDALHEHPAV  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKS
Sbjct: 998  RKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKS 1057

Query: 928  LDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYD 987
            LDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK+IHWLTPKPKSQLD+DFPD+ IF D
Sbjct: 1058 LDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCD 1117

Query: 988  ILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLY----SHKQNVXXX 1043
            IL L + F+ HT  YSN DKERLKD LK F+SLFFSI   ++ + L     S+K+     
Sbjct: 1118 ILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLRRRSPSNKEE-HEA 1176

Query: 1044 XXXXXXXXIASRKRPYQQEMSLLDILHRSRYQKLK-RSNDEDGKVPQLSXXXXXXXXXXX 1102
                    +A  KRP + E+ L DILHR++YQKLK RS+ E+G + Q             
Sbjct: 1177 NKKENGTALAHGKRPREIELPLRDILHRNKYQKLKLRSDGEEGSIGQSEEGLDEQEEVDE 1236

Query: 1103 XXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIK 1162
                    AK PWL GN+VEEAN+QGII NR  FNLFANT+IY+FFRH TT+YERL+E+K
Sbjct: 1237 EEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVK 1296

Query: 1163 QMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQ 1222
             +++ VT+EIN+R    FAKDL+L+S QL  MGLDF G DAY+Q+L LS+RLI GD+EHQ
Sbjct: 1297 SIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQ 1356

Query: 1223 WFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKD 1282
            WFEESLRQAYNN+AFK YT+DKV Q+LVKHAHT++TD K +EIM LF KDR  +TTSAKD
Sbjct: 1357 WFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKD 1416

Query: 1283 QIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYA 1342
            QI+YR+Q RSHMSNTENMFRIEF++ + HV IQYIA+DDLTL E K+ EDKWKYYVTSY+
Sbjct: 1417 QILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYS 1476

Query: 1343 LPHPTEGIPHEKLKIPFLERLIEFGQDID-GTEVDEEFSPEGISVSTLKIKIQPITYQLH 1401
            L HPTEGI HE L++PFLE++IE  Q+ D     D +FSPEG+S S+L+IKI P TY L 
Sbjct: 1477 LSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLE 1536

Query: 1402 IENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQ 1461
            +E GS DVF+RKA NK+P   N  + K  V +K ELI  +LD   G + NLD     S++
Sbjct: 1537 VEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVE 1596

Query: 1462 KKWENLKD--SIAKTSAGNQGIESETEKG 1488
            +K   +K+  ++    A   G+ES T++ 
Sbjct: 1597 EKLNFVKNYGTLQGYRAQENGLESTTKEA 1625

 Score =  190 bits (483), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 86/96 (89%), Positives = 93/96 (96%)

Query: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLFRGYP 
Sbjct: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336

Query: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTV 311
           LIQGFNTFLPQGYRI+CS NPD+PI+VTTPMG++TV
Sbjct: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTV 372

 Score =  175 bits (444), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 117/240 (48%), Positives = 137/240 (57%), Gaps = 37/240 (15%)

Query: 366 PLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQ 425
           P  A SSG     QPE+PA  Q PQ       +  KK  DVEFSQAISYVNKIK RF+DQ
Sbjct: 487 PTSAVSSGT-GPTQPEVPAPVQ-PQLA-----DQTKKAADVEFSQAISYVNKIKNRFSDQ 539

Query: 426 PDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANXXXXXX 485
           PDIYKHFLEILQTYQREQKPINEVYAQVT LFQNAPDLL+DFKKFLPDSSASA       
Sbjct: 540 PDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQ 599

Query: 486 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLYPASGYYGHPSNRGIPQQNLPPIG 545
                                                   GYYG   N+ + +QNLPP+G
Sbjct: 600 LQPVMQHQQAAAAT------------------------GYGYYGE--NQPVARQNLPPLG 633

Query: 546 SFSPPTNGSTVHEAYQD--QQHMQPP--HFMPLPSIVQHGPNMVHQGIANENPPLSDLRT 601
           SFSPP NG+   + YQ+  Q    PP  H     + V     ++ QG++N+  PLS++R+
Sbjct: 634 SFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQGMSNDAIPLSNMRS 693

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344

Query: 471 LP 472
           LP
Sbjct: 345 LP 346

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 283
           A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 284 LP 285
           LP
Sbjct: 585 LP 586

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1146 bits (2964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1073 (56%), Positives = 727/1073 (67%), Gaps = 44/1073 (4%)

Query: 401  KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 460
            +K  +VEFS AISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT LFQN 
Sbjct: 420  QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNN 479

Query: 461  PDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXX 517
            PDLL+DFKKFLPDSS S                                           
Sbjct: 480  PDLLDDFKKFLPDSSVSQQQQEQQQEPQQQQQDQQQEHQQDQEQQHHEQKQQPLPQDQNQ 539

Query: 518  XXFLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTN-------GSTVHEAYQDQQHMQPP- 569
               L P      + S +G  Q   P  G    PTN        ++   +  +  HM P  
Sbjct: 540  QAMLPPQPYLQQNQSMQG--QGFYPQSGVLMQPTNLPPLGNFSASGQASPAENSHMLPSM 597

Query: 570  --HFMPLPSIVQHGPNMVHQGIANENPPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXAN 627
              H      I QH   +V QG++N++ P+S++R+++   Y                    
Sbjct: 598  HQHIAGGHVIPQH---VVTQGMSNQDIPVSEMRSTMNGTY--NQVEYIQGAPGYPQPLEG 652

Query: 628  TQYGDIPV-RPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFL 686
             QY + P+ RPEIDLD                   L +EVTFFE+ KR+IGNK +Y EFL
Sbjct: 653  VQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFL 712

Query: 687  KILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLD 746
            KILNLYSQD+L   +LV KV+FYL S+KELF WFK+FVGYQEK K IENIVHEKHRLDLD
Sbjct: 713  KILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLD 772

Query: 747  LCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEET 806
            LCEA GPSYK+LPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+T
Sbjct: 773  LCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDT 832

Query: 807  LFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKV 866
            LFK+EEERHEYDFYIESNLRTIQ LETI NKI NMT  EK NFKLPPGLGHTS+TIYKKV
Sbjct: 833  LFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKV 892

Query: 867  IRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFK 926
            +RKVYDK+RGFEIIDALHEHPAVT P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++K
Sbjct: 893  VRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYK 952

Query: 927  SLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFY 986
            SLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNK+IH LTPKPKSQLDF+  D+ + Y
Sbjct: 953  SLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLY 1012

Query: 987  DILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVXXXXXX 1046
            DIL L  TF+    +YSN DK +L    K FISLFFS   + + E++ S + ++      
Sbjct: 1013 DILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAV-SERSSITDQENG 1071

Query: 1047 XXXXXIA----SRKRPYQQEMSLL--DILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXX 1100
                  +    S KR    E S L  DIL R++    K SN E+ +              
Sbjct: 1072 EEDSNKSDSEKSNKRTLSDEDSYLMKDILRRTK--NAKTSNSEENQ-----NSSSVKSNE 1124

Query: 1101 XXXXXXXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLE 1160
                      A  PWL G+L++EAN+ GI+ +R IFNLF NT IY+FFRH  T+YERLLE
Sbjct: 1125 EDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLE 1184

Query: 1161 IKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLE 1220
            +K+++  VT EI  R  V FA DL+L+S+QL++MGL F    AY ++LRLS+RLI GDL+
Sbjct: 1185 VKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLD 1244

Query: 1221 HQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSA 1280
            HQWFEESLRQAY NKAFK+YTIDKV QSLVKHAH+++TD K A +M LF +DR    T+A
Sbjct: 1245 HQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTA 1304

Query: 1281 KDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTS 1340
            KDQI+YRL+VR+ M  +ENMFRIE++  + HVSIQY+A+DDLTLKEP+  ++KW YYVTS
Sbjct: 1305 KDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTS 1364

Query: 1341 YALPHPTEGIPHEKLKIPFLERLIEF-GQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQ 1399
            Y+L HPTEGI  E +  PFL ++IE   + +D  E +++FSPEG+S S LK+ I P TY+
Sbjct: 1365 YSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYE 1424

Query: 1400 LHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNL 1452
            L  E GS DVFTRK+ NK+P+           +Q    + KFL+ + G + NL
Sbjct: 1425 LTFECGSTDVFTRKSVNKFPS--------SQSTQPASKMDKFLNSSKGWKKNL 1469

 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 90/94 (95%)

Query: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVI+RV+TLF+G+P 
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTT 309
           LIQGFNTFLP GY+IECS+NP+DPI+VTTP GTT
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268

Query: 471 LP 472
           LP
Sbjct: 269 LP 270

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 283
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 284 LP 285
           LP
Sbjct: 490 LP 491

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 15/107 (14%)

Query: 374 LPSIQQPEMPAHR-QIPQSQSLVP--------QEDAKKNVDVEFSQAISYVNKIKTRFAD 424
           L  +Q  E P  R +I    SLVP         EDA     +     +++  ++K RF  
Sbjct: 650 LEGVQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDA-----IALGDEVTFFERVK-RFIG 703

Query: 425 QPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 471
              +Y  FL+IL  Y ++    +E+ ++V     ++ +L + FK F+
Sbjct: 704 NKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFV 750

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1031 (56%), Positives = 709/1031 (68%), Gaps = 85/1031 (8%)

Query: 540  NLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNM----------VHQGI 589
            NLPP+GSFS P +                 H M LP +VQ  PNM          + QG+
Sbjct: 488  NLPPLGSFSTPGDH----------------HPMNLP-LVQ-APNMNLNQGHPAHIITQGM 529

Query: 590  ANENPPLSDLRTSLTEQYAXXXXXXXXXXXXXXXXXANTQYGDIPVRPEIDLDXXXXXXX 649
            +N+  P+SDLRT+    Y                   +TQY +   RPEIDLD       
Sbjct: 530  SNQKIPISDLRTTADTSY----------RPAEYSQGQDTQYMETNARPEIDLDPSLVPVI 579

Query: 650  XXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFY 709
                        L EE +FF+KAK+YIGNK +YTEFLKILNLYSQD+LD + LVEKV  Y
Sbjct: 580  PEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHY 639

Query: 710  LGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSG 769
            L    ELF WFK+FVGYQEK K IENIVHEKHRLDLDLCEA GPSYKRLPK+DTFMPCSG
Sbjct: 640  LSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSG 699

Query: 770  RDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ 829
            RD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ
Sbjct: 700  RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQ 759

Query: 830  CLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAV 889
             LETI NKI NMT  EKA FKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+
Sbjct: 760  TLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAI 819

Query: 890  TAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLI 949
            T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLT KQLI
Sbjct: 820  TVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLI 879

Query: 950  SEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKER 1009
            SEISSIKVDQ NK+IH LTPK KSQLD DF D  +FYDIL LA  F+ +   YS PDKER
Sbjct: 880  SEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKER 939

Query: 1010 LKDLLKYFISLFFSISFEKIEESL------------------YSHKQNVXXXXXXXXXXX 1051
            LKD  K FISLF S    +IE++L                  YS KQ             
Sbjct: 940  LKDFFKGFISLFCSYPVPQIEKALAKRDAASSSQSSNSNTETYSEKQQ------EDGDMK 993

Query: 1052 IASRKRPYQQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXXXXXXXXXXXXA 1111
            +  ++     +  L D+L R++ QK  R N   G     S                   A
Sbjct: 994  LPKKRNREDSDRLLRDVLFRNKQQKGGR-NSPRGD----SSISAEKESDMEEEEIIRQEA 1048

Query: 1112 KNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKE 1171
            KNPWL G++V+EA++ G ++NR  FNLFANTNIY+FFRH  TIYERL+E+K+MN+ VTKE
Sbjct: 1049 KNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKE 1108

Query: 1172 INTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQA 1231
            I  R  V FAKDL+L+S+QL++MGLDF GEDAY+++L+LSR LI GDLEHQWFEESLRQA
Sbjct: 1109 IANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQA 1168

Query: 1232 YNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVR 1291
            Y NKAFK+YT+DKV Q+LVKHAH ++TD KT EIM LF KDR + +TS KDQI+YRLQVR
Sbjct: 1169 YKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVR 1228

Query: 1292 SHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIP 1351
            S+MSN ENMFRIE+++ T HV IQ++A+DDLTL+EPK+ +DKW+YY+TSY+L HPTEGI 
Sbjct: 1229 SNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGIS 1288

Query: 1352 HEKLKIPFLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFT 1411
            H+ L+ PFLE++IE  +DI   + DE++SPEG++ S LK+KI PITY + +E GS+D+F+
Sbjct: 1289 HDNLRSPFLEKIIESEEDIIEDK-DEKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFS 1347

Query: 1412 RKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLK--- 1468
            RKA NK+P   +   +K   S+ K  + +FL+   G + +L   Q   ++K+ E +K   
Sbjct: 1348 RKAVNKFPVRVDIRKKKS--SELKLELERFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNG 1405

Query: 1469 -------DSIAKTSAGNQGIESETEKGKITK-QEQSDNLDSSTASVLPASITTVPQ--DD 1518
                   DS   +++   G  S+  K  I + Q +S  + +S A+   +++ T     D 
Sbjct: 1406 NLEEYSDDSAVASTSAVSG--SDLAKEDIARSQSESTVVSASMATCAQSTLKTEKDKPDS 1463

Query: 1519 NIETTGNTESS 1529
                T N ES+
Sbjct: 1464 TFTATNNAESN 1474

 Score =  185 bits (469), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (95%)

Query: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219

Query: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTT 309
           LIQGFNTFLPQGY IECSS+P+DPI+VTTP GTT
Sbjct: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTT 253

 Score =  145 bits (367), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 80/97 (82%), Gaps = 5/97 (5%)

Query: 380 PEMPAHRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTY 439
           P MP  RQ PQ Q        KK  DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTY
Sbjct: 331 PTMP-QRQ-PQDQFGT---GGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTY 385

Query: 440 QREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSA 476
           QREQKPINEVYAQVT LFQNAPDLL+DFKKFLPD+SA
Sbjct: 386 QREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASA 422

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P L++ F  F
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227

Query: 471 LP 472
           LP
Sbjct: 228 LP 229

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 283
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 284 LP 285
           LP
Sbjct: 417 LP 418

 Score = 33.5 bits (75), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 219 LNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQ 278
           LN+ +  S+ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 279 GFNTFLPQGYR 289
            F +F+  GY+
Sbjct: 649 WFKSFV--GYQ 657

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/859 (62%), Positives = 646/859 (75%), Gaps = 18/859 (2%)

Query: 632  DIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILNL 691
            DI VRPEIDLD                   L EE  FF+KAK++I NK +Y EFLKILNL
Sbjct: 619  DISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNL 678

Query: 692  YSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAF 751
            YSQ+IL++++LVEKV +YLGSNKELF WFK FVGYQ+K K IENIVHEKH+LDLDLCEA+
Sbjct: 679  YSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAY 738

Query: 752  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 811
            GPSYK+LPK+DTFMPCSGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 739  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIE 798

Query: 812  EERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVY 871
            EERHEYDFYIESNLRTIQ LETI +KI NMTE E+ANFKLP GLGHTS+TIY+KVIRKVY
Sbjct: 799  EERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVY 858

Query: 872  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 931
             KERGFE+IDALHE+PAV  P++LKRLKQKDEEWRRAQREWNKVWREL+QKV++KSLDHL
Sbjct: 859  GKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHL 918

Query: 932  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCL 991
            GLTFKQADKKLLTTKQLISEISSIKVDQTNKK+HWLTPKPKSQLD+   D+ I YDIL L
Sbjct: 919  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKL 978

Query: 992  ADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVXXXXXXXXXXX 1051
             D FI HT+ YSNPDKERL+D L+ FISLFF I    I+ ++   +  +           
Sbjct: 979  TDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAI-KIRSPLDDTKTDSEESS 1037

Query: 1052 IASRKRPYQQ-----EMSLLDILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXXXXXXXX 1106
              S K P ++     ++S  DIL + +YQK+K+  D++    +                 
Sbjct: 1038 GDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKN----ETFSNDISSATSVDDDEL 1093

Query: 1107 XXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNE 1166
                A+ PWL G++V++ANS GIIQNRS +N+F NTNIY+F RH  T+YERL E KQMN 
Sbjct: 1094 IRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNA 1153

Query: 1167 RVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEE 1226
             VT+EI  RS V FAKDL+L+S+QL  MGLDF G D+YKQ+L LS RLI G+LEH WFEE
Sbjct: 1154 EVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEE 1213

Query: 1227 SLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIY 1286
            SLRQA+ NKAFKLYTIDKVTQS+VKHAHT+M+D KTAEIM L  KDR+ +TTS+KDQI+Y
Sbjct: 1214 SLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILY 1273

Query: 1287 RLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHP 1346
            RLQ RSHMS T+NMFRIEF+K + ++SIQYI +DDLTL EPK  E+KWKYY+TSYAL HP
Sbjct: 1274 RLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHP 1333

Query: 1347 TEGIPHEKLKIPFLERLIEFGQDIDGTE--VDEEFSPEGISVSTLKIKIQPITYQLHIEN 1404
            TEG+P E+++IPFLE+++E  +     E  +++++SP+G+S S LKIKI P  Y L IE 
Sbjct: 1334 TEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKIKISPENYALEIEP 1393

Query: 1405 GSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQ------KL 1458
            GS+D F+R + NKYP     +  K       + ++ FL+   G + +L E +      K 
Sbjct: 1394 GSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKY 1453

Query: 1459 SMQKKWENLKDSIAKTSAG 1477
            S  KK+ +LK+ +    A 
Sbjct: 1454 SHIKKYGSLKNYVVPVVAA 1472

 Score =  291 bits (744), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 160/286 (55%), Positives = 191/286 (66%), Gaps = 26/286 (9%)

Query: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
           YRPLNVKDAL+YLEQVK QFSSRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTV-----------NNNISPSGRGTTD 324
           LIQGFNTFLPQGY IEC++NP+DPI+VTTP+G+ T+           N N+ P    +T 
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKPIPSAATNTNV-PGPTTSTS 260

Query: 325 AQELGSFPESDGNGVQQPSNVPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPA 384
                +   +        + +P +  +            + P L  + G PS    E+  
Sbjct: 261 PPTAATTTGTTTPVAANTTAIPNITRNKETNAIENVATAAQPSLLPNLGTPS--HTEVTK 318

Query: 385 HRQIPQSQSLVP---------QEDAK---KNVDVEFSQAISYVNKIKTRFADQPDIYKHF 432
              + QS +  P         Q+  K   K  DVEFSQA+SYVNKIK RF D+PDIYK F
Sbjct: 319 SESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTF 378

Query: 433 LEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASA 478
           LEILQTYQ+EQKPI+EVY+QVT LFQNAPDLL+DFKKFLPD++ SA
Sbjct: 379 LEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLPDNNNSA 424

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/853 (61%), Positives = 648/853 (75%), Gaps = 14/853 (1%)

Query: 630  YGDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKIL 689
            Y +  VRPEIDLD                   L EE  FF+K K+YIGNK +Y EFLK+L
Sbjct: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884

Query: 690  NLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCE 749
            NLYS D+L++D+LVEK+ +YL  N+ELF+WFKNFVGY EK K IENIVHEKH+LDLDLCE
Sbjct: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944

Query: 750  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 809
            A GPSYK+LPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004

Query: 810  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRK 869
            ++++ HEYDFYIESNLRTIQ LETI +KI NMTENEK NFKLP GLGHT+ TIYKKVIRK
Sbjct: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064

Query: 870  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 929
            VYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD
Sbjct: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124

Query: 930  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDIL 989
            HLGLTFKQADKKLLTTKQLISEISSIKVDQT+K++HWLTPKPKSQLDF+ PDK+I +DIL
Sbjct: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184

Query: 990  CLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSH---KQNVXXXXXX 1046
               + F+ HT+ YSNP+KERL D +KYF SLFFSI  E+I+E++      ++N       
Sbjct: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244

Query: 1047 XXXXXIASRKRPYQQ-EMSLLDILHRSRYQKLKRSNDEDGKVPQLSXXXXXXXXXXXXXX 1105
                   S+KR  +   +SL DIL R++YQ+LK  +D D                     
Sbjct: 1245 QKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEV--DGHGNRHDDQKLLEEEE 1302

Query: 1106 XXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMN 1165
                 AK PWL G LVEEAN+QG I +R+IFN+F+NTN+YIF RH TT+YERL EIKQMN
Sbjct: 1303 LLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMN 1362

Query: 1166 ERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFE 1225
            ++V++EI+ R    FAKDL+L+S+QL+EMGLDF   D Y+Q+L L +RLI GDLEHQWFE
Sbjct: 1363 DKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFE 1422

Query: 1226 ESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQII 1285
            ESLRQA+NNKAFKLYT+DKVTQ+LVKHAHT+++D KT EIMALF KDR  ++TS+KDQI+
Sbjct: 1423 ESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQIL 1482

Query: 1286 YRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPH 1345
            YRLQ R+ M++ ENMFRIE++  T H+ IQYIALDDLT+K+ K  E+KWKYY+TSYAL H
Sbjct: 1483 YRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSH 1542

Query: 1346 PTEGIPHEKLKIPFLERLIEFGQDIDGTEVDEE--------FSPEGISVSTLKIKIQPIT 1397
            PTEGI  E ++IPFLER+IE  Q  +  E D++        +SPEGIS STLKIKI P  
Sbjct: 1543 PTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQN 1602

Query: 1398 YQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQK 1457
            Y L+IE GS+D+F+RK+ N++P     +++ G + + K  + KFL+  +G +  + + Q 
Sbjct: 1603 YCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQM 1662

Query: 1458 LSMQKKWENLKDS 1470
             S++ KW++L ++
Sbjct: 1663 ESIESKWDHLSNN 1675

 Score =  300 bits (769), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 191/396 (48%), Positives = 221/396 (55%), Gaps = 89/396 (22%)

Query: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVI RVS+LF  YP 
Sbjct: 299 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPS 358

Query: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPE-- 333
           LIQGFNTFLPQGYRIECSSNP+ PI V TPMGTTTV+  +  S     + Q   S P+  
Sbjct: 359 LIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQNHQLQHSLPQPS 418

Query: 334 ------------SDGNGVQQPSNVP--MVPSSVYXXXXXXXXXXSLPLLAT-SSGLPSIQ 378
                       S  +G+  PSN+         +          S P+  + SS +PS  
Sbjct: 419 TTASASNVDSKVSSISGIMGPSNITEQSQQQQRHHPQQLINVNDSAPISGSISSTVPSNV 478

Query: 379 QP---------------EMP------------------AHRQIPQSQSLVP--QE--DAK 401
           +P                +P                  A +Q P   S+ P  QE  + +
Sbjct: 479 EPTNMNAAANAAISAASALPNTNTPKSQTTPPIATAGTATQQFPMVSSVSPPLQELPEQR 538

Query: 402 KNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAP 461
           +  DVEFSQAISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINEVY+QVT LFQ AP
Sbjct: 539 RTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAP 598

Query: 462 DLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFL 521
           DLLEDFKKFLPDSSA+ N                                        F+
Sbjct: 599 DLLEDFKKFLPDSSANNN------------------------------GSIVTSQEENFM 628

Query: 522 YPASGYYGH----PSNRGIPQQNLPPIGSFSPPTNG 553
           Y A+G+         +  I  QNLPP+GSFS   NG
Sbjct: 629 Y-ANGFNQQQPHLTPHSEIQAQNLPPLGSFSTQPNG 663

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/862 (60%), Positives = 635/862 (73%), Gaps = 24/862 (2%)

Query: 631  GDIPVRPEIDLDXXXXXXXXXXXXXXXXXXXLNEEVTFFEKAKRYIGNKHLYTEFLKILN 690
             + P RPEIDLD                   L EE +FFEK K++I +K +Y EFLK+LN
Sbjct: 712  SEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLN 771

Query: 691  LYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEA 750
            LYSQD+L  ++LV +VD+Y+GSNKELF WFK FVGY E    IENI+HEKH+LDLDLCEA
Sbjct: 772  LYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEA 831

Query: 751  FGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 810
            +GPSYK+LPK+DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI
Sbjct: 832  YGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 891

Query: 811  EEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKV 870
            EEERHEYDF+IESNLRTIQ LETI NKI NMT  EK NFKLP GLGHTS TIYKKVIRKV
Sbjct: 892  EEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKV 951

Query: 871  YDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDH 930
            YDKERGFEIIDALHEHPA   P++L+RLK+KDEEWRRAQREWNKVWRELEQKV++KSLDH
Sbjct: 952  YDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDH 1011

Query: 931  LGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILC 990
            LGLTFKQADKKLLTTKQLISEISSI+VDQ NK+IHWLTPKPKSQLDF F D +I  DIL 
Sbjct: 1012 LGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILD 1071

Query: 991  LADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHK----QNVXXXXXX 1046
            LA+ FI HT+ YSN +KERLKD L+ FI LFFSI   +I++ L        +        
Sbjct: 1072 LANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSS 1131

Query: 1047 XXXXXIASRKRPYQQEMSLLDILHRSRYQKLKR------SNDEDGKVPQLSXXXXXXXXX 1100
                  +++KR  + ++ L D+L + +YQK+K        N+ +    +           
Sbjct: 1132 TSNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQ 1191

Query: 1101 XXXXX----XXXXXAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYE 1156
                           K PWL G+++++ +  G+I+NR IFNLFANTNIY+FFRHWTTIYE
Sbjct: 1192 QQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYE 1251

Query: 1157 RLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLIN 1216
            RLLE+KQ+N++VT+EIN+R    FAKDL L+S+QL+ MGLDF   D+YK++L L++RLI 
Sbjct: 1252 RLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIK 1311

Query: 1217 GDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNAS 1276
             D+EHQWFEESLRQAYNNKAFKLYT DKV Q+LVKHA++++TD+K +EIMALF KDR  S
Sbjct: 1312 NDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRS 1371

Query: 1277 TTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKY 1336
            +T+ +DQIIYRLQ R+HM+NTENMFRIEF++ T HV IQYIA++DLTLK     ++ W+Y
Sbjct: 1372 STTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEY 1431

Query: 1337 YVTSYALPHPTEGIPHEKLKIPFLER----LIEFGQDIDG----TEVDEEFSPEGISVST 1388
            YVTSYALPHPTEG+P E LK+PFLE+     +E  QD+D      E  E+ SPEGIS S 
Sbjct: 1432 YVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSK 1491

Query: 1389 LKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGL 1448
            LKIKI   TY L +E GS+DVF+RK+ NK+PT A     +  + +K E  +KFL    G 
Sbjct: 1492 LKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKK--IESSIKEKSEAFNKFLSSKRGW 1549

Query: 1449 RNNLDEAQKLSMQKKWENLKDS 1470
             N     Q   +++ W+  +++
Sbjct: 1550 NNQFKPDQVAGIEEGWKKFQET 1571

 Score =  262 bits (670), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 169/362 (46%), Positives = 193/362 (53%), Gaps = 64/362 (17%)

Query: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275
           YRPLNVKDALSYLEQVK QF+S+P IYN FLDIMKDFKSQ IDTPGVIERVSTLF+GYP+
Sbjct: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329

Query: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335
           LIQGFNTFLPQGY I CS NPDD      P+  TT      P G  T       + P  D
Sbjct: 330 LIQGFNTFLPQGYTIHCSDNPDD------PVRVTT------PMGTST-----YTNLPNVD 372

Query: 336 GNGVQQPSNVPMVPSSVYXXXXXXXXXXSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLV 395
              V      P +P+             +      ++     QQ     H Q  Q+Q+  
Sbjct: 373 NTNVS-----PTLPTVQPLLQQPQPQGNNDTTNVINNAANQPQQVHAQTHLQ-EQTQAQT 426

Query: 396 PQEDAKK----------------------------NVDVEFSQAISYVNKIKTRFADQPD 427
           P +   +                            N +VEFSQAI+YVNKIKTR+ADQP 
Sbjct: 427 PADADAQAQAEVQAQVQAHAQAQAQAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPF 486

Query: 428 IYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANXXXXXXXX 487
           IYKHFLEILQTYQRE+KPI+EVY QVT LF +APDLLEDFKKFLP++ A+          
Sbjct: 487 IYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKFLPETPANNQPVQQPHAH 546

Query: 488 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLYPASGYYGHPSN-RGIPQQNLPPIGS 546
                                            LYP S     PS    IPQQNLPPIGS
Sbjct: 547 PQLQQLQPRIPSISQQQQPSQ------------LYPFSNNGPVPSGFYQIPQQNLPPIGS 594

Query: 547 FS 548
           FS
Sbjct: 595 FS 596

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 381 EMPAHRQI---PQSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQ 437
           E P   +I   P    ++P+       ++   +  S+  K+K   + +P IY  FL++L 
Sbjct: 713 EAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKP-IYMEFLKVLN 771

Query: 438 TYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 471
            Y ++    NE+  +V +   +  +L + FK F+
Sbjct: 772 LYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFV 805

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  245 bits (626), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 155/391 (39%), Positives = 222/391 (56%), Gaps = 51/391 (13%)

Query: 668  FFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVG-Y 726
            F    +  + ++ +Y EFLK++NL++Q ++DL+   ++   + GS+  L T F N +  Y
Sbjct: 206  FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 727  QEKTKCIENIVHEKHR-----LDLDLCEAF----GPSYKRLPKSDTFMPCSGRDDMCWEV 777
            ++        +H++ +      D D  E F    GPSYKRL   +T   C GRD +C EV
Sbjct: 266  KD--------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEV 317

Query: 778  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNK 837
            LNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S       +E ++ K
Sbjct: 318  LNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS-------VEHLIVK 370

Query: 838  IENMTENEKA-----------NFKLPPGLGHTSM-TIYKKVIRKVYDKERGFEIIDALHE 885
                TE EK+           N    P     S+ +I +KVIR++Y  E G  +IDA+  
Sbjct: 371  ---FTEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKT 427

Query: 886  HPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTT 945
            +P    P +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK A+K+ L  
Sbjct: 428  NPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLND 487

Query: 946  KQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNP 1005
            KQL+ E  S K D+  K+ H+   + K    ++F DK++ YD+    D  +    + S+ 
Sbjct: 488  KQLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDV---KDIILCGLRSNSST 539

Query: 1006 DKERLKDLLKYFISLFFSISFEKIEESLYSH 1036
              E  K+L       FF + FE  E S   H
Sbjct: 540  -SESQKNLYCQIFEAFFDLLFE--ESSFTKH 567

 Score =  126 bits (316), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 154/313 (49%), Gaps = 15/313 (4%)

Query: 1132 NRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINT--RSTVTFAKDLDLLSS 1189
            NR   N+F + NI   F +  T+YER  ++K     + K++ T  R     AK L LL  
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1190 QLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSL 1249
            QLS+ GL+   +D Y+ +   S++ ++G+L+HQWFEESLR  + NKA+KLYTID+V +++
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1250 VKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRT 1309
            +    T+       +I+ L V +    TT+   Q+ YR +VR  M    +MFR+E  + +
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS 798

Query: 1310 LHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPF--LERLIEFG 1367
              +  QYI +DDL   +   ++ +   Y   Y     T+ +  + L  P+  L  L    
Sbjct: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREE 858

Query: 1368 QDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQ 1427
            Q+I        F    I    L + I P+ Y + I  GS D+ +     K  +    + +
Sbjct: 859  QNI-------PFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSRK 911

Query: 1428 KGMVSQKKELISK 1440
              M S    LISK
Sbjct: 912  TQMAS----LISK 920

>Suva_15.170 Chr15 (290805..291290) [486 bp, 161 aa] {ON}  YOL004W
           (REAL)
          Length = 161

 Score =  147 bits (371), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 76/116 (65%), Positives = 85/116 (73%), Gaps = 11/116 (9%)

Query: 1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITLPSLSALSTKE 60
           MSQVWHN NSQSN+ +T+NDA  SNER EKEP LQG +P FVQ QQRITLPSLSAL+ K+
Sbjct: 1   MSQVWHNPNSQSNEASTANDAASSNERTEKEPPLQGAQPSFVQPQQRITLPSLSALNAKD 60

Query: 61  EDRRDSNGQQA-----------LTSHAAHILGYPPPHSNAMPSIATDSALKQPHEY 105
           EDRR+ NG              L SH+  ILGYPP HSN MPSI TDSALKQPH+Y
Sbjct: 61  EDRREGNGNGNGNGQQQQQQQPLASHSTRILGYPPAHSNVMPSITTDSALKQPHDY 116

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 12/126 (9%)

Query: 1375 VDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMV--- 1431
            +DE+F+ E + V   K  I  + +Q+HI+ G     T + +    T +ND T + +V   
Sbjct: 1040 LDEKFNHE-LQVDEFKETIDNLNFQIHIQKGKRSFITSEGS----TTSND-TDETVVNDT 1093

Query: 1432 SQKKELISKFLDCAVGLRNNLDEAQK--LSMQKKWENLKDSIAKTSAGNQGIESETEKGK 1489
            S K ELI        GL   LD +Q+   S++++ ENLK+S+ +T    +G+ESE   G+
Sbjct: 1094 SDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEV-SGE 1152

Query: 1490 ITKQEQ 1495
            +T  EQ
Sbjct: 1153 MTTTEQ 1158

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 675 YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQ---EKTK 731
           Y G K++Y ++LK+LN   QD   + D VE  D     + ++  +  N + YQ   E+ K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 732 CIENIVHEK 740
            I+N +H K
Sbjct: 140 YIDNFIHSK 148

>YFR025C Chr6 complement(203743..204750) [1008 bp, 335 aa] {ON}
           HIS2Histidinolphosphatase, catalyzes the eighth step in
           histidine biosynthesis; mutations cause histidine
           auxotrophy and sensitivity to Cu, Co, and Ni salts;
           transcription is regulated by general amino acid control
          Length = 335

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 380 PEMPAHRQIPQSQSLVPQ-EDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFL 433
           P + A    P+ QSL    E+    ++  F   +S+  +IKTR+AD+PD+   F+
Sbjct: 41  PRIEAKFIYPEEQSLGKNPEEVITKLETSFKNFMSHAQEIKTRYADRPDVRTKFI 95

>Suva_8.261 Chr8 (472765..475035) [2271 bp, 756 aa] {ON} YOR208W
           (REAL)
          Length = 756

 Score = 33.5 bits (75), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 669 FEKA-KRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQ 727
           FEK  K Y+G++  Y EF+K++  Y  D+   +D   K+   L +   L   F+ F+   
Sbjct: 124 FEKLLKNYLGSEEKYVEFIKVIKAY--DVFIFNDSFSKISTCLKTTFCLIEKFQKFIYRS 181

Query: 728 EKTKCIENIVHEKHRLDLDLCEA 750
             + C++ ++ E    D   C+A
Sbjct: 182 FPSPCLKFLLFEGSLKD---CKA 201

>Skud_11.220 Chr11 complement(402296..406747) [4452 bp, 1483 aa]
           {ON} YKL010C (REAL)
          Length = 1483

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 52/120 (43%), Gaps = 10/120 (8%)

Query: 845 EKANFKLPPGLGHTSMTIYK-KVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKD- 902
           E A+ ++P  +    + I+  + +   Y K +G  ++D L     V    + + L Q + 
Sbjct: 660 EFADMEIPDSVKPKKIFIHLFRALSLAYIKSKGMHLVDGLLSQMNVEQDAITEELHQIEN 719

Query: 903 -----EEWR---RAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISS 954
                E++    + + +W ++W  L++ +F +  D  G  F         TK+++S   S
Sbjct: 720 VVSILEDFSTPDKTEEDWKRIWSVLKKCIFHEDFDVSGFEFTSTGLASSLTKRIMSSTVS 779

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 160,132,563
Number of extensions: 7315721
Number of successful extensions: 21617
Number of sequences better than 10.0: 76
Number of HSP's gapped: 22208
Number of HSP's successfully gapped: 144
Length of query: 1536
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1413
Effective length of database: 39,377,481
Effective search space: 55640380653
Effective search space used: 55640380653
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 73 (32.7 bits)