Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOL003C (PFA4)6.28ON37837820310.0
Smik_15.1676.28ON37837816520.0
Suva_15.1726.28ON39837816140.0
Skud_15.1596.28ON37937916070.0
Kpol_1037.236.28ON37837912331e-169
TDEL0G044106.28ON38137812091e-166
CAGL0E02497g6.28ON37637811961e-164
ZYRO0C07546g6.28ON37737811761e-161
TPHA0J003906.28ON38037911351e-154
NCAS0D021406.28ON37637911091e-150
Ecym_30326.28ON37737811071e-150
NDAI0C026506.28ON38938911081e-150
SAKL0E01518g6.28ON37938011061e-150
Kwal_56.224596.28ON38337910611e-143
KLTH0C10978g6.28ON37737910541e-142
KLLA0C06204g6.28ON37737810191e-137
ACL003C6.28ON3753789871e-132
KAFR0A051306.28ON3964019501e-126
KNAG0F029306.28ON3863869471e-126
TBLA0B004806.28ON3774114562e-52
CAGL0D02508g3.12ON3321292203e-19
NCAS0E013003.12ON3271612169e-19
Kpol_1014.293.12ON3262132132e-18
KAFR0A085903.12ON3311392114e-18
KLTH0F19580g3.12ON3421682081e-17
TPHA0P015603.12ON3311322062e-17
NDAI0G013403.12ON3351302053e-17
KLLA0E02069g3.12ON3251282026e-17
KNAG0K025703.12ON3281332028e-17
SAKL0H16434g8.286ON5551651978e-16
TBLA0H001503.12ON3451291931e-15
TDEL0A003103.12ON3291081922e-15
SAKL0C13596g3.12ON333501885e-15
NDAI0J010008.286ON3391491877e-15
Kwal_55.221263.12ON360601878e-15
ZYRO0C03410g3.12ON3271201842e-14
Skud_14.153.12ON3362271842e-14
Suva_14.153.12ON3302091832e-14
Smik_14.63.12ON3342131832e-14
NCAS0B035908.286ON329481823e-14
KLLA0D18370g8.389ON355901815e-14
KAFR0B053708.286ON3291641805e-14
TPHA0C010708.286ON3331491805e-14
TPHA0C023608.389ON4041641816e-14
Smik_12.3068.389ON359851807e-14
NCAS0C029208.389ON374621808e-14
Ecym_20143.12ON339671771e-13
YNL326C (PFA3)3.12ON3362131771e-13
KNAG0A027108.389ON354901772e-13
YLR246W (ERF2)8.389ON359651762e-13
ZYRO0D06600g8.286ON330481753e-13
Skud_4.3878.286ON3362051744e-13
Suva_2.2898.286ON335691744e-13
Skud_12.3218.389ON356651726e-13
ADL197C3.12ON3901201727e-13
Suva_10.3428.389ON356721719e-13
Ecym_41788.389ON368721701e-12
CAGL0B01991g8.286ON3301421692e-12
SAKL0H13860g8.389ON352921692e-12
TBLA0D040408.286ON329491682e-12
ZYRO0C04092g8.389ON3661211673e-12
TDEL0F051308.389ON359911664e-12
KLTH0G13112g8.286ON3492581647e-12
NDAI0G022508.389ON389771622e-11
TDEL0F041308.286ON3281421602e-11
KLTH0F08668g8.389ON358591602e-11
YDR126W (SWF1)8.286ON336481602e-11
KAFR0H019808.389ON361911593e-11
Kpol_1033.168.286ON3211861583e-11
Smik_4.3728.286ON335481575e-11
Kwal_23.33028.389ON353641566e-11
CAGL0G08217g8.389ON326611532e-10
AGL125C8.389ON367691532e-10
KLLA0F19690g8.286ON324631522e-10
Ecym_42828.286ON340491513e-10
TBLA0H009208.389ON360751496e-10
TBLA0E028305.579ON3861071452e-09
AGR065W8.286ON326441423e-09
Kwal_56.236978.286ON338481399e-09
Kpol_1004.575.579ON3621321344e-08
Ecym_41145.579ON372841336e-08
NCAS0F013905.579ON3742501328e-08
NDAI0H018905.579ON4063301311e-07
Smik_4.7375.579ON3782291301e-07
KLTH0G04972g5.579ON3671881301e-07
ZYRO0D13860g5.579ON3651541302e-07
Skud_4.7345.579ON3802321302e-07
KNAG0H031108.286ON331481292e-07
KAFR0I011105.579ON370801283e-07
SAKL0G06160g5.579ON364921264e-07
Kwal_47.183665.579ON356701255e-07
KNAG0C028305.579ON354711247e-07
KLLA0D06149g5.579ON3491461231e-06
YDR459C (PFA5)5.579ON374891212e-06
CAGL0K06347g5.579ON3521571202e-06
Suva_2.6345.579ON3881521194e-06
TDEL0A044405.579ON365691185e-06
KAFR0H005705.626ON757721142e-05
KLTH0E02420g5.626ON734671133e-05
ZYRO0C11132g5.626ON7591141115e-05
TBLA0J008305.626ON7391151105e-05
ABR203W5.579ON359741086e-05
Suva_2.4325.626ON763511099e-05
NDAI0H008505.626ON786541099e-05
Skud_4.5275.626ON764661081e-04
TPHA0C003705.626ON759511081e-04
Smik_4.5155.626ON764511062e-04
Kpol_526.325.626ON777901053e-04
YDR264C (AKR1)5.626ON764661053e-04
NCAS0C052805.626ON757601034e-04
TDEL0A049205.626ON750581008e-04
Ecym_13305.626ON7391801000.001
CAGL0M08712g5.626ON76354990.001
Suva_8.875.626ON73089980.002
YOR034C (AKR2)5.626ON74990960.003
KNAG0C062305.626ON75254950.003
Smik_15.2135.626ON74454900.015
AER388C5.626ON72450890.019
SAKL0G07326g5.626ON73752870.040
Skud_15.1995.626ON74190860.044
KNAG0B031405.626ON68296840.078
NCAS0A017304.97ON78498820.15
KLLA0E16721g5.626ON75260800.23
Smik_5.256.17ON61550770.57
TBLA0D036001.532ON48644741.2
Smik_7.2674.97ON66751722.0
Kwal_33.14481singletonOFF128077722.7
Kwal_YGOB_33.144812.82ON170577713.3
YGL023C (PIB2)4.97ON63542704.2
KAFR0F031704.97ON59256694.9
Suva_7.2564.97ON68842695.1
Kpol_2000.481.100ON121643679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL003C
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   786   0.0  
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   640   0.0  
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   626   0.0  
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   623   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   479   e-169
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   470   e-166
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   465   e-164
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   457   e-161
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   441   e-154
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   431   e-150
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   431   e-150
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     431   e-150
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   430   e-150
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   413   e-143
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   410   e-142
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   397   e-137
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   384   e-132
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   370   e-126
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   369   e-126
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   180   2e-52
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    89   3e-19
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    88   9e-19
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    87   2e-18
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    86   4e-18
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    85   1e-17
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    84   2e-17
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      84   3e-17
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    82   6e-17
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    82   8e-17
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    80   8e-16
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    79   1e-15
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    79   2e-15
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    77   5e-15
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    77   7e-15
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    77   8e-15
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    75   2e-14
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    75   2e-14
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    75   2e-14
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    75   2e-14
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      75   3e-14
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    74   5e-14
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    74   5e-14
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    74   5e-14
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    74   6e-14
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    74   7e-14
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     74   8e-14
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    73   1e-13
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    73   1e-13
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    73   2e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    72   2e-13
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    72   3e-13
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    72   4e-13
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    72   4e-13
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    71   6e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    71   7e-13
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    70   9e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    70   1e-12
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    70   2e-12
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    70   2e-12
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    69   2e-12
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    69   3e-12
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    69   4e-12
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    68   7e-12
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     67   2e-11
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    66   2e-11
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    66   2e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    66   2e-11
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    66   3e-11
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    65   3e-11
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    65   5e-11
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    65   6e-11
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    64   2e-10
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    64   2e-10
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    63   2e-10
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    63   3e-10
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    62   6e-10
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    60   2e-09
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    59   3e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    58   9e-09
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    56   4e-08
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    56   6e-08
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    55   8e-08
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    55   1e-07
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    55   1e-07
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    55   1e-07
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    55   2e-07
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    55   2e-07
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    54   2e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    54   3e-07
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    53   4e-07
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    53   5e-07
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    52   7e-07
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    52   1e-06
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    51   2e-06
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    51   2e-06
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    50   4e-06
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    50   5e-06
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    49   2e-05
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    48   3e-05
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    47   5e-05
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    47   5e-05
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    46   6e-05
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    47   9e-05
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    47   9e-05
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    46   1e-04
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    46   1e-04
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    45   2e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   3e-04
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    45   3e-04
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    44   4e-04
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    43   8e-04
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    43   0.001
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    43   0.001
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    42   0.002
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    42   0.003
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    41   0.003
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    39   0.015
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    39   0.019
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    38   0.040
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    38   0.044
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    37   0.078
NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97      36   0.15 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    35   0.23 
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...    34   0.57 
TBLA0D03600 Chr4 complement(890231..891691) [1461 bp, 486 aa] {O...    33   1.2  
Smik_7.267 Chr7 complement(442158..444161) [2004 bp, 667 aa] {ON...    32   2.0  
Kwal_33.14481 s33 (690854..694693) [3840 bp, 1280 aa] {OFF} YNL1...    32   2.7  
Kwal_YGOB_33.14481 s33 (690854..694732,694735..695973) [5118 bp,...    32   3.3  
YGL023C Chr7 complement(450197..452104) [1908 bp, 635 aa] {ON}  ...    32   4.2  
KAFR0F03170 Chr6 complement(627907..629685) [1779 bp, 592 aa] {O...    31   4.9  
Suva_7.256 Chr7 complement(440959..443025) [2067 bp, 688 aa] {ON...    31   5.1  
Kpol_2000.48 s2000 (89157..90446,90448..90498,90501..90605,91448...    30   9.9  

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/378 (100%), Positives = 378/378 (100%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
           EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 361 YNDWGESLDDFGVDVDME 378
           YNDWGESLDDFGVDVDME
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/378 (80%), Positives = 335/378 (88%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M VKLRWPWLGIAIPT LISFIGYGAHYFILSNFL + KQI FEF LSMIW SYYLAI T
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPGRPLPNY+P P IW NFCKKCQ+YKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHFLRFLFWII+TTS+LFCIQ KRI FIWQ+R+ PGY FKKSEL FLTI SPLN FVLLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           IT+LFLRCLFNQI+NGRSQIESWDMDRLESLF+S RL QKLI NTWRIYPES++ Q+++D
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           AE  L ++R  F+ LVNFPY+FDL+TNA+LYLGP+HLWLWPYG+PTG+GNNFPKN IS Y
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
           E +S LED ILSLPWPPDGG+T TV N  +STIE  NE GEQ++R+R+ QNGR ASREKW
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360

Query: 361 YNDWGESLDDFGVDVDME 378
           +NDWGESLDDFGVDVDME
Sbjct: 361 FNDWGESLDDFGVDVDME 378

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/378 (76%), Positives = 328/378 (86%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M VKL+WPWLGIAIPTFLISFIGYGAHYFILSNFLSV KQI FE  LSMIW+SYYLAI T
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPG+P P Y+P P+ W N+CKKCQ+YKPERSHHCK CNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHFLRF+FW+I TT  LFCIQ KR+ FIWQQRHLPGY FKKSEL+FLTI +PLN FVLLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I ILFLRCLFNQI+NGRSQIESWDMDRLESLF+S RL +KLI+NTWRIYPE+RS Q ++D
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           AE+ LT+ + RF+E+VNFPY+ DL+TNA +YLGP+HLWLWP G P GDGN+F KN ISKY
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
           E NSSLED +LSLPWPPDGGK  T  NH +  IE  NE GEQ++R+R+ Q+GR A+REKW
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380

Query: 361 YNDWGESLDDFGVDVDME 378
           YNDWGESLDDFGVDVDME
Sbjct: 381 YNDWGESLDDFGVDVDME 398

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/379 (78%), Positives = 330/379 (87%), Gaps = 1/379 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M VKL+WPWLGIAIPTFLISFIGYGAHYFILSNFLS+ KQ+ FE  LSMIW+SYYLAI T
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           N GRPLPNY+P P IW NFCKKCQSYKPERSHHCK CNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHFLRFLFW+IVTTS+LFC+Q KRI FIWQQR LPGY F+KSELIFLTI SPL+ FVLLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I ILFLRCL NQI+NGRSQIESWDMDRLESL +SG+L  KLIDNTWRIYPE+RS Q+++D
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 AEEHLTKK-RPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISK 299
           A++ LT++ R RFDELV+FPY+F+  TNA+LYLGPI LWLWPYG P GDGN+FPKN IS+
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 300 YEANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359
           YE NS LED ILSLPWPPDG KT  V NH +STIE  NE GEQ++R+R  Q+G  A REK
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 360 WYNDWGESLDDFGVDVDME 378
           WYNDWGESLDDFGVDVDME
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  479 bits (1233), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/379 (59%), Positives = 284/379 (74%), Gaps = 2/379 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPVKL++PW+GIAIP FLISFI Y AHYFIL NFLS+ KQI FE  ++MIW+SYYLAI T
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPG+P  NY PP + W+N+CKKC +YKPER+HHCKTC QCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHFLRFLFW+IVTT+ L      RI F+W+ R+LP Y F KSE+IFLTI++P++ FVLLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I++LF+RC  NQ+L+GR+QIE+W+ +RLESLF   RL  +LI N W  +PE ++  N+  
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           AE+ +  KR RFD LV+FPYD  L  N    LG    WLW YG P+GDG  F KN  S +
Sbjct: 241 AEK-IVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 301 EANSSLEDHILSLPWPPDGGKTN-TVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359
           E +S LED ILSLPWPPDGGK    + N  +++IE   + GE +IR R P +    SR +
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 360 WYNDWGESLDDFGVDVDME 378
           WYNDWGE+L+DFGVD+D+E
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  470 bits (1209), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/378 (59%), Positives = 277/378 (73%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPVKL+WPWLGIAIP  L+SFIGY  H+FILSNFLS  KQ+ F+  L++IWLSYY AI T
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPGRP PN++ P   W+N+CKKCQ+YKPER+HHCKTCNQCVLMMDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHFLRFL W+IV T+ L      RI  +W+ R+LP Y F +SEL+FLTI +PL++FVLLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           ITIL  RCL NQI NG SQIE+W+++RL++LF+S RL   LI+  W I+P +R   N+  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           A E    K  R +++VNFPYD D ++NA   LG   LWLWP+G P GDG +F KN IS+Y
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
            + +S ED +LSLPWPPDGG+T       SS+IE   + GEQLIR R         R +W
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360

Query: 361 YNDWGESLDDFGVDVDME 378
            NDWGE+L+DFGVDVD E
Sbjct: 361 QNDWGENLEDFGVDVDTE 378

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  465 bits (1196), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 226/378 (59%), Positives = 277/378 (73%), Gaps = 2/378 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPVKL+WPWLGIAIP+FLI+ IGY AHYFIL NFLS+ KQ+ ++FC +MIWLSYYLAI T
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
            PG+P  N+KP  + W+ +CKKC+ YKPERSHHCKTCNQCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHF+RFLFW+IV T+ L      RI+ IW  R  P Y + KSELIFLTI +PLN+F+LLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I+IL +RCLFNQI NGRSQIESW+MDRLE+L    +L   LI+N W I+P  R+   +  
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           AE  L KKR   DELVNFPYD   + NA+  LG   LWL+P+  P  DG +F KN  S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
           E  +SL D IL LPWPPD  K     +  +S +++ +E GEQ+IR R P+  +  SR +W
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPE--KKLSRSEW 358

Query: 361 YNDWGESLDDFGVDVDME 378
            NDWGESL+DFGVDVD+E
Sbjct: 359 LNDWGESLEDFGVDVDVE 376

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  457 bits (1176), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/378 (57%), Positives = 276/378 (73%), Gaps = 1/378 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPV+L+WP+LGIAIP FLISFIGY AHYFILSNFLS  KQI FEF L+MIW SYYLAI T
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
            PG+PLPN++P  + W+++CKKC++YKPER+HHCKTCNQCVL MDHHCPWT NCVG+ N+
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHF+RFLFW+I TT  L      R YFI    + P Y + KSELIFLTI  P++ F+LLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I+ILF+RCL NQI  GR+QIE+W+ +RLE L+ S RL   L+ N W +YPE R+ + + +
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           A    T++R   D LVNFPYD D ++N + +LG    WLWP+G P GDG  FPKN IS++
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
           E  ++L D +L+LPWPPDGGK   +   G + +E     GEQ+IR RL      +SR +W
Sbjct: 301 E-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359

Query: 361 YNDWGESLDDFGVDVDME 378
            N WGE+L+DFGVDVD E
Sbjct: 360 QNTWGENLEDFGVDVDAE 377

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  441 bits (1135), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 214/379 (56%), Positives = 278/379 (73%), Gaps = 1/379 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPVK +WPW+GIAIP  LISFIGY +HY+IL   LS+ KQ  FEF L+MIW+SYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPG+P  N+KP P  WRNFCKKC +YKPERSHHCKTCNQCVLMMDHHCPWTMNC+GF N+
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHF+RFL WI+ TT  L   Q KRI ++W  R+LP Y F++SE+I L + +PLN F+LLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           IT+LF RCLFNQI+NG++QIE W+MDRLE+ F   +L  +LI N W +YPE +S ++ ++
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           AE  + KK  R+D +VNFPYD  ++ N    +G    WLWP+G P+G+G NF KN I+ +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 301 EANSSLEDHILSLPWPPDGGK-TNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359
           + +SSL    L+LPWPPD G+  N+   +  S +E     GEQ++R R        SRE+
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 360 WYNDWGESLDDFGVDVDME 378
           W+N+WGE+L+DFGVDV+ME
Sbjct: 361 WFNEWGENLEDFGVDVEME 379

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  431 bits (1109), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 200/379 (52%), Positives = 274/379 (72%), Gaps = 4/379 (1%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPVKL++PW+G+ IP  L SFIGY AH F+L+NF+S   Q+ F+  L+M+W+SY LAI T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPGRP  ++KP    W +FCKKCQ +KPER+HHCKTCNQCVLMMDHHCPWTMNCVGF N+
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHFLRFLFW++VTT  L     KR  ++W  + LP Y F+K+E+ FL I  P++ FVL+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           + +LF+RCL NQI+ G++QIESW+++RLE+L+   +L  +L+ N W IYP  ++ +NK  
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 AEEHLTKKRP-RFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISK 299
           A++   + R  RF+ +V FPYD D+++NAL  LG    WLW +G P  DG +F KN ++ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 300 YEANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359
           YE  +++ED +LSLPWPPDGG+         + +E   E+GEQ+IR R  +N  ++ R+ 
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGR--NFIQQKGTNVESITENGEQVIRQRNFEND-NSYRKT 357

Query: 360 WYNDWGESLDDFGVDVDME 378
           W NDWGE+L+DFGVDVD+E
Sbjct: 358 WNNDWGENLEDFGVDVDVE 376

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  431 bits (1107), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 207/378 (54%), Positives = 269/378 (71%), Gaps = 2/378 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPVKL+WPWLGIAIP FLI+FIGY A  F+L  FLSV +QI F+F L+MIWLSYY AI T
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPG P+P ++P    W+N+CKKCQ++KPER+HHCKTC QCVL+MDHHCP+TMNCVG+ N+
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHF+RFLFWII TT+ L     KR +F+W  RH       K E+IFLTI +P N+FVLLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I+ILF RC+ NQ+LNG +QIE+W+MDR+ES+F + RL  +L+ N   +YP S    +K +
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLD-GHKGE 239

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
            +  L  ++  F++LVNFPYD D + N +  +GP+  WL P+G P G+G  F KN +S Y
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
           E  S+L D +LSLPWPPDG +     N     +E    +GE +IR R P+   + SR +W
Sbjct: 300 EHGSTLTDKLLSLPWPPDGERAPNSSN-SRLKVESSTRNGEHIIRKRSPEPRLNLSRTEW 358

Query: 361 YNDWGESLDDFGVDVDME 378
           YNDWGE+L  FGVDVD +
Sbjct: 359 YNDWGENLAHFGVDVDAD 376

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  431 bits (1108), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 207/389 (53%), Positives = 273/389 (70%), Gaps = 13/389 (3%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M +KL++PWLG+AIP+F+ISFIGY +HYFILSNFLS+ KQI F+F LSMIW+SY LAI T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGRPLPNYKP----PPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116
           NPG+P  N KP        W   CKKC +YKPERSHHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 FANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSF 176
           + N+PHF+RFL WII+TT  L     KR   +W  RHLP Y F ++E+IFLTI  P+++F
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 VLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQ 236
           +LLTI++LF+RC  NQI+ G +QIE W+++RLE+LF + +L   +I   W +YP  R+  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 NKKDAEEHLT-KKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKN 295
               A++ L+ +K+ RF+ +VNFPYD D++TN    +G    W+W +GVP  +G  F KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 296 GISKYEANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQN---- 351
            IS YE  SS+ED +LSLPWPPD G+     ++  +++E     GEQ++R R   +    
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGR--NFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358

Query: 352 --GRHASREKWYNDWGESLDDFGVDVDME 378
              +  SRE+W NDWGESL DFGVD++ E
Sbjct: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  430 bits (1106), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 270/380 (71%), Gaps = 3/380 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M VKL+WPWLGIAIP FLISFIGY AHYFILSNFL   KQ+ FEF L MIW+SYYLAI T
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPG+P P ++P    W NFC KC +YKPER+HHCK CNQCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
            HF+RFLFW+I TTS L     KRI F+W +RH+P YF  +SELIFLTI +P+++FVLLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I++L LRC  NQIL G +QIESW+MDR+E++F+SG+L  ++++N   I P S S Q+  D
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQD-DD 239

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
             + L++ R   DE+VNFPYD + + NA+  LG ++ W+ P+G   G+G  F KN +S Y
Sbjct: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSST--IEMRNESGEQLIRTRLPQNGRHASRE 358
           E    +ED +LSLPWPPDGG+        +    +E     GE+++R R         R+
Sbjct: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359

Query: 359 KWYNDWGESLDDFGVDVDME 378
           KWYNDWGE+L DFGVD+D E
Sbjct: 360 KWYNDWGENLADFGVDLDEE 379

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  413 bits (1061), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 270/379 (71%), Gaps = 4/379 (1%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPVKL+WPWLGIAIP+ LI+FIGYG+HYFIL NFLS+ +Q+ F+ CLSMIW+SY LAI T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPG+P   ++P P  W+N C+KC++YKPER+HHCKTC+QCVL+MDHHCPWTMNCVG  N+
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHF+RFL W+I+TTS L  +  KRI+  WQ RH   Y  +K EL+F+ I++PLN+FV LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIY-VQKIELVFIFINTPLNAFVWLT 179

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I +L LRC  NQ L G +QIE W+ +R+E+ FN+GRL  +L++N   IY +     N  +
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGD--DILNSPN 237

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           A++ +  +  + +E+VNFPYD ++  N    +G +   + P+  P G+G  F KN +S Y
Sbjct: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297

Query: 301 EANSSLEDHILSLPWPPDGGKTN-TVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359
           +   ++ED +LSLPWPPDGG+   T  +  SS IEM +  GE ++R RL     +  R +
Sbjct: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357

Query: 360 WYNDWGESLDDFGVDVDME 378
           WYNDWGE+L DFGVDV+ E
Sbjct: 358 WYNDWGENLSDFGVDVESE 376

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  410 bits (1054), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 192/379 (50%), Positives = 266/379 (70%), Gaps = 4/379 (1%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPV+L+WPWLGIA+P+FLI++IGY +HYFIL NF S  +Q+ FEF L++IW+SY  AI  
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPGRP PN++PP   W+N+CKKC +YKPER+HHCKTC QCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHF+RFL W+++TTS L  +  +R +  W  R+    F   SEL FL +++PLN+F+LLT
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRK-FVHTSELCFLFVNAPLNAFILLT 179

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           +++L  RC+ NQ LNG +QIESW+ DR+E+LF + RL  +LIDN   ++PE     ++  
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTF--DEGA 237

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
           A++ L+ K+   ++++NFPYD D+  N    +GPI+ W  P G P  +G  F  N +S Y
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHG-SSTIEMRNESGEQLIRTRLPQNGRHASREK 359
           +  +S+ED +LSLPWPPDGG+  +  +   +ST+E  +  GE  +R R   +     R +
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 360 WYNDWGESLDDFGVDVDME 378
           W+NDWGE+L DFGVDVD E
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  397 bits (1019), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 188/378 (49%), Positives = 258/378 (68%), Gaps = 1/378 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M +KL+  WLG+AIP FL++ IGYG+HYFILSNFLS  +QI ++ C +MIW+SYYLAI T
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPG P  ++KP  + W N+CKKC+ YKPER+HHCKTCNQCVL MDHHCPWT+NCVG +N+
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
           PHF+RFLFW+I +T+ L  +   RIY +W  RH   +    SE+IF+ I +P+++FVLLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           ++ L  RC++NQ L+G +QIESW+MDR++SL    RL  ++ID      PE    + + +
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAK-QHE 239

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
             + L+K+    ++  NFPYD + +TN    +GP +LWLWP+  P   G +F KN +  Y
Sbjct: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
           + NSS+ED ++SLPWPPDG   ++      S+IE     GEQ+IR +         R  W
Sbjct: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSW 359

Query: 361 YNDWGESLDDFGVDVDME 378
           YNDWGE L DFGVD ++E
Sbjct: 360 YNDWGEDLSDFGVDTELE 377

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  384 bits (987), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 252/378 (66%), Gaps = 3/378 (0%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M V ++WPWLG+AIP FLISF GY AH+F+L+NFLS  + + F+  LSMIW+SY+ AI  
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           NPGRP   ++P    W+N+C KC++YKPER+HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
                   WII TT +L     KRI F W  R+       K ELIFLTI +PL++F+LLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
           I++LF+RC+ NQI+NGR+QIE+W+MDR+E+LF   RL  +L+ N   IYP S   Q +K+
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239

Query: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300
            EE L+     FDE++NFPYD + + N L  +G    WL P+G P  DG  F KN IS Y
Sbjct: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299

Query: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360
           +  +S++D +L+LPWPPD  +    F    S +E   + GEQ++R R         R +W
Sbjct: 300 DEATSIQDKLLALPWPPDDTRHGIAFP-SVSHVEKDTQGGEQVVRRRHVPIAV-PPRNEW 357

Query: 361 YNDWGESLDDFGVDVDME 378
           YNDWGESL+ FGVDV++E
Sbjct: 358 YNDWGESLEHFGVDVEVE 375

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 199/401 (49%), Positives = 260/401 (64%), Gaps = 28/401 (6%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M ++L+WPWLGIAIPTFLISFIGY AHYFIL + LS   Q+ F+F LSMIWLSYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGRP-LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFAN 119
           +PG P + +        R +CKKC +YKP R+HHCKTCN+C+LMMDHHCPWTMNCVGF N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 YPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLL 179
           YPHFLRFLFW+IVTT+ L     +RI FIW   +      ++ E++ LTI +P+++F+LL
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 180 TITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQK-----LIDNTWRIYPESRS 234
           TIT+L +RC  NQI +G SQIE W+M+RLES F S +   +     LI+N + I+    S
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIF----S 236

Query: 235 FQNKKDAEEHLT-------KKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTG 287
            ++ +D +E +        K+R  F  ++NFPYD D+ TNA   LGP   WL P+G P G
Sbjct: 237 IESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEG 296

Query: 288 DGNNFPKNGISKYEANSSLEDHILSLPWPPD--GGKTNTVFNHGSSTIEMRNESGEQLIR 345
           DG +F  N I+  E  S+L D +LSLPWPPD    K     + G+  +E   E GE ++R
Sbjct: 297 DGMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLR 355

Query: 346 TR-------LP-QNGRHASREKWYNDWGESLDDFGVDVDME 378
            R       LP  N    SR+ W N+WGE+L  FGVD++ E
Sbjct: 356 NRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  369 bits (947), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 250/386 (64%), Gaps = 16/386 (4%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           MPV+L+ PW GIAIP  LI FIGY AH+FIL N LS  +QI F+FCL+MIW+SYY+AI T
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGRP---LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF 117
           NPG+P           D+ R +C KC  +KPERSHHCKTC QCVLMMDHHCPWTMNC+GF
Sbjct: 61  NPGKPPHGSAQQHTDGDMNR-YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGF 119

Query: 118 ANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLP--GYFFKKS--ELIFLTISSPL 173
            N+P F+RFL W+I+TTS LF     RI  IWQ R++P  G     +  EL+ L + +P+
Sbjct: 120 GNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPM 179

Query: 174 NSFVLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESR 233
           + FVL TIT LF+RC+ NQ++ G +QIESW+M+RL+++F S +L   +I+  W  +P  +
Sbjct: 180 DLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQ 239

Query: 234 SFQNKKDAEEHLTKKRP---RFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGN 290
           + +++ +AE+ L        +F  +VNFPYD DL TN    LG   L LWP+    G+G 
Sbjct: 240 TPEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGV 299

Query: 291 NFPKNGISKYEANSSLEDHILSLPWPPDGGKT--NTVFNHGSSTIEMRNESGEQLIRTRL 348
            F KN IS YE N S+ D +L L WPPDGG+   +     G+  I+   E GE +IR R 
Sbjct: 300 TFQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR- 358

Query: 349 PQNGRHASREKWYNDWGESLDDFGVD 374
             N    SR  W N WGE+L+ FGVD
Sbjct: 359 --NSPIESRTTWENQWGETLEGFGVD 382

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  180 bits (456), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/411 (31%), Positives = 205/411 (49%), Gaps = 70/411 (17%)

Query: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60
           M ++   PW G+AIP+ +I  +   +++ IL + L+  + I +     MI  SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPE----------------RSHHCKTCNQCVLMM 104
            P         P  + ++F     + + +                R+HHCKTCN CV+MM
Sbjct: 61  PPT------PAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMM 114

Query: 105 DHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFK--KS 162
           DHHCPWTMNCVG+ NYPHF+RFL W+I++T+ L     K+ Y ++  R+ P + ++  K 
Sbjct: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174

Query: 163 ELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLI 222
           ++I LT+  P   FV LT+ +L L+ L NQI NG +QIE W  + +E+ +   + ++  +
Sbjct: 175 KIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSK--V 232

Query: 223 DNTWRIYPESRSFQNKKDAEEHLTKKR-------------PRFDELVNFPYDFDLYTNAL 269
               ++     +F NKK + + +TK +               F  ++NFPYD  L  N  
Sbjct: 233 ALQLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNIT 292

Query: 270 LYLGPIH--LWLWPYGVP-TGDGNNFPKNGI-SKYEANSSLEDHILSLPWPPDGGKTNTV 325
             +G ++   W  P+  P T   N   +  I    E + +++D +L LPWP +    +T 
Sbjct: 293 TTMGSLNPLSWFNPWYTPLTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTF 352

Query: 326 FNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKWYNDWGESLDDFGVDVD 376
                       + GE ++++               ND+GE+L DFGVD D
Sbjct: 353 ------------QDGELVVKS---------------NDYGETLQDFGVDYD 376

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 89.4 bits (220), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 74/129 (57%), Gaps = 7/129 (5%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           CK C S+KP+R HHC TCN CVL MDHHCPW   CVG+ N   F++FL +  V + ++  
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILVLI 165

Query: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITI-LFLRCLFNQILNGRS 198
           + +  IY  W      G FF + ELI  T+ S     ++++I+I +F     +Q+   ++
Sbjct: 166 LSSMEIY-TW----FKGEFF-EVELINFTLLSLWLLALVVSISITIFTVFSISQVCQNQT 219

Query: 199 QIESWDMDR 207
            IE + + R
Sbjct: 220 TIELYSLRR 228

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 87.8 bits (216), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 86/161 (53%), Gaps = 8/161 (4%)

Query: 79  FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLF 138
            C+ CQ +KP+R HHC TC++C+L MDHHCPW   C+GF N  +F++FL +    + V+ 
Sbjct: 100 LCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCTAYSIVVL 159

Query: 139 CIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCL-FNQILNGR 197
              +  +++ +  +        + ELI L + +     +++T++++F       Q+L  +
Sbjct: 160 FFTSCELHYWFSGKQY------EDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQ 213

Query: 198 SQIESWDMDRLESLFNSGR-LTQKLIDNTWRIYPESRSFQN 237
           + IE + M R +      R L    +DN + +    R++++
Sbjct: 214 TTIEMYGMKREKRDLELLRGLEDAEVDNIFDLGSRRRNWES 254

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 86.7 bits (213), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 97/213 (45%), Gaps = 39/213 (18%)

Query: 53  SYYLAICTNPGRPLP--------------NYKPPPDIW--RNF----------CKKCQSY 86
           +YY  I   PG PL                 + PPD    R+F          C+ C  +
Sbjct: 53  TYYKVIIVGPGSPLDFGQLTVRNIKDAEDGIELPPDFLAQRSFTLKHDGRFRVCRTCNVW 112

Query: 87  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIY 146
           KP+R HHC  C++C+L MDHHCPW   CVGF N  +F++FL +  V   ++    + +IY
Sbjct: 113 KPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYAILVMTYTSFQIY 172

Query: 147 FIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQIESWDMD 206
             W +  L      K  L+ + I   L+  V LT+T  F      Q +N R+ IE + + 
Sbjct: 173 -DWFKNELYETEIIKIRLLMVWI---LSVAVFLTVTC-FTGFSIYQTINNRTTIEMYTLR 227

Query: 207 R------LESLFNSGRLTQKLID--NTWRIYPE 231
           +      L   +   +LT+ + D  +TW  + E
Sbjct: 228 KYREELELYGNYRDSQLTRNIFDLGSTWENWCE 260

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 85.9 bits (211), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 73/139 (52%), Gaps = 15/139 (10%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+GF N  +F++FLF+    + ++  
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYCTSYSIIVLF 165

Query: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFN-----QIL 194
           + + +IY          ++F+ +   +  I   L +  LL I I     LF      Q+L
Sbjct: 166 VTSIQIY----------HWFRSTSYEYEFIDFKLLTVWLLAIVIFISLVLFTGFSVFQLL 215

Query: 195 NGRSQIESWDMDRLESLFN 213
             ++ IE +   R ++  N
Sbjct: 216 GNQTTIELYAYRRYKAELN 234

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 77/168 (45%), Gaps = 29/168 (17%)

Query: 7   WPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFE---FCLSMIWLSYYLAICTNPG 63
           W  +  A P  L  F+        + +   +P  +T      C+S+   +Y+  I T  G
Sbjct: 4   WSIITSAFPKCLTVFLFIYTGSVTVLDVRVLPISLTIAMAGLCMSLSLYTYFKVIRTGAG 63

Query: 64  RPL--PNYK-------------PPP-------DIWRN----FCKKCQSYKPERSHHCKTC 97
            PL  P  +             PPP        + RN    FC+ C  +KP+R HHC  C
Sbjct: 64  SPLDFPELRIDNVDAADEGVELPPPFLSKRSVTLKRNGRFRFCRVCAVWKPDRCHHCSAC 123

Query: 98  NQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRI 145
            +C L MDHHCPW  +CVG+AN  +F++FL +  V + ++F +    +
Sbjct: 124 KKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIFLLSGTEL 171

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (51%), Gaps = 13/132 (9%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C+ C  +KP+RSHHC TCN+CVL MDHHCPW   C+GF N   F++FL +      V+  
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNTTYAYVIAI 169

Query: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFN----QILN 195
           + +K++Y  +        F     L+FL        ++L  +  L L C        ++N
Sbjct: 170 LTSKQMYNWFDDGSYENEFVNMY-LLFL--------WILALVVSLALSCFAGFSVYMVMN 220

Query: 196 GRSQIESWDMDR 207
            ++ IE + M +
Sbjct: 221 NKTTIEMYAMRK 232

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 68/130 (52%), Gaps = 7/130 (5%)

Query: 79  FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV-L 137
            C+ CQ +KP+R HHC TCN+C+L MDHHCPW   C+GF N   F++FL +  +   V L
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTIYAFVAL 167

Query: 138 FCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGR 197
             I  + + +   Q ++  Y      + F  +   L +FV+    + F      Q+L  R
Sbjct: 168 GLISYQFVNWYKNQNYMNEY------IDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNR 221

Query: 198 SQIESWDMDR 207
           + IE + + R
Sbjct: 222 TTIEMYGIRR 231

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 82.4 bits (202), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 14/128 (10%)

Query: 70  KPPPDIWRN------------FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF 117
           + PPDI ++            FC+ C+ +KP+R HHC  CN+C L MDHHCPW  +CVGF
Sbjct: 83  EQPPDIIKDNCIFVKRDGSFRFCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGF 142

Query: 118 ANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELI--FLTISSPLNS 175
            N   F++FL +  V +  +  + + ++Y  ++Q            L+   L++ + + +
Sbjct: 143 RNQKFFVQFLAYTTVYSLYVLLMTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIAT 202

Query: 176 FVLLTITI 183
           F   T TI
Sbjct: 203 FAFTTYTI 210

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 73/133 (54%), Gaps = 15/133 (11%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C+ C+ +KP+R HHC +C++C+L MDHHCPW   CVGF N   F++FL +       +  
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 140 IQAKRIYF-----IWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQIL 194
           + + ++Y       +Q+  + GY      L+FL I S L  F+ +T   LF     +Q+L
Sbjct: 163 MTSVQLYRWFYNDKFQEELISGY------LLFLWIFS-LVVFIAMT---LFSAFSVSQVL 212

Query: 195 NGRSQIESWDMDR 207
             ++ IE + + R
Sbjct: 213 KNQTTIEMYGVQR 225

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C+ C   KP RS HC  CN+C+LM+DHHC W  NC+G  NY +F  FL   +   S  F 
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSF- 190

Query: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQ 199
           ++   I  + Q  ++     K   ++ LTI +         I  +F    FN + +G + 
Sbjct: 191 LRLTSIQLMSQTENI-----KTKPMLVLTILTG----CFDIIVAVFGYTQFNLVHDGMTT 241

Query: 200 IESWDMDRLESLFNSGRLTQKLIDNTW-RIYPESRSFQNKKDAEE 243
            E      ++     G L +    + + RI  ES S +++K+ E+
Sbjct: 242 NEQDKWFTVQEFMRDGNLVRDKKGHYYFRILDESSSDRDQKEEED 286

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 70/129 (54%), Gaps = 7/129 (5%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C+ C  +KP+R HHC +C++C+L MDHHCPW   C+GF N+ +F+ FL +  +  + +  
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVCL 165

Query: 140 IQAKRIY-FIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRS 198
           I +K ++ +  Q++++         L+ L I S + S  +     LF      Q+L  R+
Sbjct: 166 ISSKELWNWFSQEKYVTELI--NIHLLLLFIVSLITSVSM----TLFTAYSIYQVLINRT 219

Query: 199 QIESWDMDR 207
            IE +   R
Sbjct: 220 TIELYAYRR 228

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 4/108 (3%)

Query: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVL 137
             C+ C  +KP+R HHC  CN+C+L MDHHCPW  +CVGF N  +F++FL +  +    +
Sbjct: 106 RLCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATLYAFNV 165

Query: 138 FCIQAKRIYFIWQQ----RHLPGYFFKKSELIFLTISSPLNSFVLLTI 181
                 ++Y  + Q    R L         L+   +S  L+ F   +I
Sbjct: 166 LIFDTIQLYIWFHQGDYERQLIDLVLFSVWLLAFAVSIALSCFTGFSI 213

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFW 129
           C+ C+ +KP+RSHHC +CN+C L MDHHCPW  +C+GF N   F++FL +
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY 154

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 69/149 (46%), Gaps = 12/149 (8%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C+ C   KP RS HC+ CN C+L+ DHHC W  NC+G  NY +F  FL    +T +  F 
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQ 199
               R++ ++ Q H P      S    LT+     SF ++     FL+     + +G + 
Sbjct: 199 ----RLFLMYCQGHAP------SSRNILTLLILCGSFAVICAGFTFLQ--LQLVKDGMTT 246

Query: 200 IESWDMDRLESLFNSGRLTQKLIDNTWRI 228
            E      L+     G+L +   +N W I
Sbjct: 247 NEQDKWFTLQEYMRDGKLIRTKDENKWFI 275

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 40/60 (66%)

Query: 79  FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLF 138
           FC+ C  +KP+R HHC  CN+C L MDHHCPW  +CVG+ N  +F+ FL +    + ++F
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVF 191

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 56/120 (46%), Gaps = 26/120 (21%)

Query: 45  FCLSMIWLSYYLAICTNPGRPL--------------PNYKPPPDIWRN------------ 78
           F +++   +YY  I T PG PL                 + PP+                
Sbjct: 46  FLVAIGLYTYYKVIITGPGSPLDYDTIKVYDMQAVESGAELPPEFLSRRSITTKRDGRFR 105

Query: 79  FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLF 138
            C+ C  +KP+R HHC  C++C+L MDHHCPW   C+GF N   F+++L +    + V+F
Sbjct: 106 VCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIF 165

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 87/227 (38%), Gaps = 44/227 (19%)

Query: 15  PTFLISFIGYGAHYFILSNFLSVPK---QITFEFCLSMIWLSYYLAICTNPGRPLP---- 67
           P  L S + +   Y  L+    +P     +T    L +   +YY  I T PG PL     
Sbjct: 12  PRVLTSCLYFWTVYTTLTRIHQIPGWFLAVTLIPTLMVALYTYYKVISTGPGSPLDFPDL 71

Query: 68  ----------NYKPPPDIWRN------------FCKKCQSYKPERSHHCKTCNQCVLMMD 105
                       + PP+                 C+ C  +KP+R HHC +C+ C+L MD
Sbjct: 72  LVHDLKAAENGLELPPEYMSKRCMTLKRDGRFRVCQICHVWKPDRCHHCSSCDICILKMD 131

Query: 106 HHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELI 165
           HHCPW   C GF N   F++FL +   TT   F +     Y +       G +F      
Sbjct: 132 HHCPWFAECTGFKNQKFFIQFLMY---TTFYAFLVLIDTCYEL-------GTWFNSGSFS 181

Query: 166 FLTISSPLNSFVLLTITILFLRCLFN-----QILNGRSQIESWDMDR 207
              I   L    LL I +      F+     Q+ N ++ IE   M R
Sbjct: 182 RELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQTTIELHSMRR 228

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 83/209 (39%), Gaps = 34/209 (16%)

Query: 28  YFILSNFLSVPK---QITFEFCLSMIWLSYYLAICTNPGRPLP--------------NYK 70
           Y  L+    +P     +T    L +   +Y+ AI   PG PL                 +
Sbjct: 25  YITLTRIHQIPSWFLAVTIIPTLLVALYTYFKAIAKGPGSPLDFPDLLVHDLQAAENGLE 84

Query: 71  PPPDIWRN------------FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFA 118
            PP+                 C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GF 
Sbjct: 85  LPPEYMSKRCMTLKHDGRFRVCQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFK 144

Query: 119 NYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVL 178
           N   F++FL +   TT   F +     Y +    H     F +  + F  +   L +  +
Sbjct: 145 NQKLFIQFLMY---TTFYAFLVLIYSCYELGTWFHSGS--FNQELIDFHLLGVALLAIAI 199

Query: 179 LTITILFLRCLFNQILNGRSQIESWDMDR 207
               + F      Q+ N ++ IE + M R
Sbjct: 200 FISVLAFTAFSIYQVCNNQTTIELYGMRR 228

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 86/213 (40%), Gaps = 42/213 (19%)

Query: 28  YFILSNFLSVPK---QITFEFCLSMIWLSYYLAICTNPGRPL--PNY------------- 69
           Y  L+    +PK    +T    L++   +YY  I   PG PL  P+              
Sbjct: 25  YITLTRIHEIPKWFLTLTIVATLTVALYTYYKVISRGPGSPLDFPDLIVHDLKAAENGLE 84

Query: 70  KPPPDIWR-----------NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFA 118
            PP  I +             C+ C  +KP+R HHC +C+ CVL MDHHCPW   C GF 
Sbjct: 85  LPPEYISKRCMTLKHDGRFRVCQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFK 144

Query: 119 NYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYF----FKKSELIFLTISSPLN 174
           N   F++FL +   TT   F +       I+    L  +F    F +  + F  +   L 
Sbjct: 145 NQKFFIQFLMY---TTCYAFLV------LIYTCYELGTWFNSGSFNRELIDFQLLGVALL 195

Query: 175 SFVLLTITILFLRCLFNQILNGRSQIESWDMDR 207
           +  +    + F      Q+   ++ IE   M R
Sbjct: 196 AVAVFITVLAFTVFSIYQVCKNQTTIEVHGMRR 228

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (70%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127
           C+ CQSYKP RS HC  C++CVL+ DHHC W  NCVG  NY +F  FL
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL 184

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%)

Query: 66  LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLR 125
           LP   P   +   +C+ C+ ++P RS HC  C+ CVL  DHHC W  NC+G  NY  FL 
Sbjct: 160 LPTKNPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLE 219

Query: 126 FLFWIIVTTSVLFCIQAKRIYFIWQQRHLP 155
           FL    ++  +L  + + R+ +  Q R+ P
Sbjct: 220 FLMASTISCILLILLSSFRLSYSPQVRYTP 249

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 73/164 (44%), Gaps = 16/164 (9%)

Query: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVL 137
            FC  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY +F  FL    V+ ++L
Sbjct: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLL 190

Query: 138 FCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGR 197
                 RI  +     +    F    L FL +S          I ++F    F  + +G 
Sbjct: 191 LGYAFLRIILLTAYSDIG---FPNIVLTFLILSG-----AFFAILLVFTYLQFALVYDGM 242

Query: 198 SQIESWDMDRLESLFNSGRLTQKLIDN-TWRI-YPESRSFQNKK 239
           +  E      ++     GRL +   DN  W I +PE  + Q  +
Sbjct: 243 TTNEKDKWFTIQEFMREGRLIRT--DNGQWLIAHPEEPAGQATR 284

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 69/149 (46%), Gaps = 12/149 (8%)

Query: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVL 137
           N C  C   KP RS HC  C  C+L+ DHHC W  NC+G  NY +F  FL    ++ S  
Sbjct: 137 NVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYA 196

Query: 138 FCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGR 197
           F    + ++    +  +P    K   ++ L I +   SF ++     +L+    Q+ NG 
Sbjct: 197 F---LRLLHITLSKPDVP----KSKNILALCILT--GSFSVICGVFFYLQ--MKQVNNGM 245

Query: 198 SQIESWDMDRLESLFNSGRLTQKLIDNTW 226
           +  E+     ++ L   G+L  K  DN W
Sbjct: 246 TTNETDKWYAVQELMREGKLI-KSEDNNW 273

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 84/164 (51%), Gaps = 14/164 (8%)

Query: 79  FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLF 138
           +C+ C+ ++P RS HC  C+ CV+ +DHHC W  NCVG  NY +FL FL   I+T  V+F
Sbjct: 195 YCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMT--VIF 252

Query: 139 CIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRS 198
            +    I+ I + RH      +K     + ++  L  +  L+I+   +   ++ +L G +
Sbjct: 253 LLINTGIH-IGKNRH------EKKPASNIPVTILLTVYGSLSISYPIILLAYHLVLTGTN 305

Query: 199 QIESWDMDRLESLFNSGRLTQ-----KLIDNTWRIYPESRSFQN 237
           Q     +  +  + +  R ++     K+I N   IY +  +F+N
Sbjct: 306 QTTREFLKYVYEIRDQHRKSKNPVFMKIIKNKNNIYDKHNAFKN 349

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 3/85 (3%)

Query: 74  DIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVT 133
           DI   +C+ C+ ++P RS HC TCN CV++ DHHC W  NC+G  NY  FL FL   +++
Sbjct: 169 DITIKYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVIS 228

Query: 134 TSVLFCIQAKRIYFIWQQRHLPGYF 158
           + +L    A     I ++   PG++
Sbjct: 229 SIILL---ANCAIHIARESGGPGHY 250

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%)

Query: 66  LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLR 125
           LP +    +I   +CK C+ ++P RS HC  C  CVLM DHHC W  NCVG  NY +FL 
Sbjct: 170 LPTFHTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLT 229

Query: 126 FL 127
           FL
Sbjct: 230 FL 231

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%)

Query: 79  FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLF 138
           +C  C  +KP+RSHHC +CN+C L  DHHCPW  +C+GF N   F++FL +  + +  +F
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 139 CIQAKRI 145
                +I
Sbjct: 169 IAATLQI 175

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 86/213 (40%), Gaps = 42/213 (19%)

Query: 28  YFILSNFLSVPK---QITFEFCLSMIWLSYYLAICTNPGRPLP--------------NYK 70
           Y  L+    +P+    +T    L++   +YY  I   PG PL                 +
Sbjct: 25  YITLTRIHQIPRWFLALTIVPTLAVALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLE 84

Query: 71  PPPDIWRN------------FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFA 118
            PP+                 C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GF 
Sbjct: 85  LPPEYMSKRCLTLKHDGRFRVCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFR 144

Query: 119 NYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKS---ELIFLTISSPLNS 175
           N   F++FL +   TT   F +       I+    L  +F   S   ELI   +      
Sbjct: 145 NQKFFIQFLMY---TTLYAFLV------LIYTCYELGTWFNSGSFNRELIDFHLLGVALL 195

Query: 176 FVLLTITILFLRCL-FNQILNGRSQIESWDMDR 207
            V + I++L   C    Q+   ++ IE   M R
Sbjct: 196 AVAVFISVLAFTCFSIYQVCKNQTTIEVHGMRR 228

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 66  LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLR 125
           LP  +    +   +C  C+ ++P R+ HC+ C  CV   DHHC W  NCVG  NY +FL 
Sbjct: 172 LPTAQRSAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLT 231

Query: 126 FLFWIIVTTSVLFCIQAKRIYFIWQQRHLP 155
           FL     T +VLF   A  I+   + R +P
Sbjct: 232 FLTATCATCTVLFVSSA--IHLSHETRAVP 259

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%)

Query: 74  DIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVT 133
           DI   +C  C+ ++P RS HC TCN CV++ DHHC W  NC+G  NY  FL FL   I++
Sbjct: 169 DITIKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILS 228

Query: 134 TSVLF 138
           + +L 
Sbjct: 229 SVILL 233

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 32/48 (66%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127
           C+ CQ  KP RS HC  CNQCVL +DHHC W  NCVG  NY +F  FL
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL 182

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 84/205 (40%), Gaps = 35/205 (17%)

Query: 60  TNPGRPLPNYKPPPDIWRNF----CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCV 115
           +N  RP    K P D    +    C  C+  KP RS HC  CN+C+L+ DHHC W  NC+
Sbjct: 112 SNVHRPGSTEKYPYDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCI 171

Query: 116 GFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELI---FLTISSP 172
           G  NY  F  FL   IV+ S  F               L     K S  +    LT+S  
Sbjct: 172 GKGNYIQFYLFLISNIVSMSYAFL-------------RLCSISLKSSTALPRAVLTLSIL 218

Query: 173 LNSFVLLTITILFLRCLFNQILNGRSQIESWDMDR---LESLFNSGRLTQKLIDNTWRIY 229
              F ++     +L     Q+   R  + + + D+   ++     G+L + L D+     
Sbjct: 219 CGCFTIICAIFTYL-----QLAIVREGMTTNEQDKWYTIQEYMREGKLVRSLNDD----- 268

Query: 230 PES--RSFQNKKDAEEHLTKKRPRF 252
           P+S       K DA E L  ++  F
Sbjct: 269 PQSWFLKLTEKGDAAEPLQDQQGTF 293

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C  C++ K  RS HC  CN+CVL+ DHHC W  NC+G  NY  F  FLF  I + S  F 
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195

Query: 140 IQAKRIYFI 148
               R+YFI
Sbjct: 196 ----RLYFI 200

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%)

Query: 74  DIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVT 133
           DI   +C+ C+ ++P R+ HC TCN CV++ DHHC W  NCVG  NY  FL FL   I +
Sbjct: 169 DITIKYCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFS 228

Query: 134 TSVLF 138
           +  L 
Sbjct: 229 SVFLL 233

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 53/120 (44%), Gaps = 33/120 (27%)

Query: 49  MIWLSYYLAICTNPGRPL--------------PNYKPPPDIW------------RNFCKK 82
           +I  +Y+  I   PG PL                 + PPD                +C K
Sbjct: 114 LILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLDSTGRHRYCVK 173

Query: 83  CQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL-------FWIIVTTS 135
           C+ +KP+R HHC  C++C L  DHHC W   C+G+ N+  FL FL       FWI + T+
Sbjct: 174 CKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWICIITT 233

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%)

Query: 74  DIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVT 133
           DI   +C  C+ ++P RS HC TCN CV++ DHHC W  NC+G  NY  FL FL   I +
Sbjct: 169 DITIKYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFS 228

Query: 134 TSVLFCIQAKRI 145
           + +L    A  I
Sbjct: 229 SILLLVNCAVHI 240

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 66  LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLR 125
           LP+      I   +C  C+ ++P R+ HC TCN C++  DHHC W  NCVG  NY +FL 
Sbjct: 175 LPSSSTNSPIQLKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLT 234

Query: 126 FLFWIIVTTSVL 137
           F++  ++T  +L
Sbjct: 235 FIYSAVLTIILL 246

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 65/142 (45%), Gaps = 11/142 (7%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C+ C+  KP RS HC  CN C+ + DHHC W  NCVG  NY +F  FL       S L  
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL------CSNLLL 189

Query: 140 IQAKRIYFIWQQRHLPGYFFKKS-ELIFLTISSPLNSF-VLLTITILFLRCLFNQILNGR 197
           +    I  I+ Q +   Y    + E   L +S    SF V+L +   F+  L N  +   
Sbjct: 190 LSYSFIRLIFIQFNKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVNSGMTTN 249

Query: 198 SQIESWDMDRLESLFNSGRLTQ 219
            + + W M  +    N+G L +
Sbjct: 250 EK-DKWQM--VHDYINTGDLVR 268

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 54  YYLAICTNPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMN 113
           YY  I    G PL       +I   +C  C+ ++P R+ HC TC  C++  DHHC W  N
Sbjct: 151 YYNMITLPTGNPLI-----ANIEVKYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNN 205

Query: 114 CVGFANYPHFLRFLFWIIVTTSVLFCIQAKRI 145
           C+G  NY +F  FL   ++ T+ +    A R+
Sbjct: 206 CIGQRNYHYFFTFLVSCVIATAFIIANCAIRV 237

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLF 128
           CK C+  KP RS HC  C+QC+L+ DHHC W  NC+G  N+ +F  FLF
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLF 185

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 12/121 (9%)

Query: 79  FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLF 138
           +C  C+ ++P R+ HC TC  C+L  DHHC W  NC+G  NY +F+ FL   I+++  +F
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSS--IF 237

Query: 139 CIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRS 198
            I    I+ I+  R+LP    K    I L I         L I    L  +++ ++ GR 
Sbjct: 238 LIANCSIH-IYHHRNLPS---KVPVTILLLIYGG------LAIIYPMLLLIYHILMTGRQ 287

Query: 199 Q 199
           Q
Sbjct: 288 Q 288

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 65  PLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           P  N  P   I   +C  C+ ++P R+ HC TC  CV+  DHHC W  NCVG  NY +F+
Sbjct: 166 PKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFI 225

Query: 125 RFLFWIIVTTSVLFCIQAKRIYFIWQQRHLP 155
            FL   ++    LF I    I+   +   +P
Sbjct: 226 IFLIGTVLAE--LFLIANCSIHIARRSSQVP 254

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 103/258 (39%), Gaps = 35/258 (13%)

Query: 6   RWPWLGIAIPTFLISFIGYGAHYF-------ILSNFLSVPKQITFEFCLSMIWLSYYLAI 58
           R+ W   AIP F +S   Y    F       I S    V + +     LS   ++  L I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  CTNPGRPLPNYKPPPDIWRNF-------CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWT 111
              P     +  P  D +          C+ C+  K  R+ HC  C+QCV + DHHC W 
Sbjct: 107 WIKPKSTYAS--PMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWA 164

Query: 112 MNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISS 171
            NC+G  NY +F  FL       S +F      +  ++ QR     F    +L+ L+I  
Sbjct: 165 NNCIGRGNYQYFYLFL------VSNVFLTNYGFLRLLFLQR-----FVHSRQLLILSILL 213

Query: 172 PLNSFVLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPE 231
                +L   +       + Q +  R  + + + ++   + +  R  Q + D+T + Y  
Sbjct: 214 GCFGVILAVFS-------YFQFVLVRDGMTTNEENKWLVIHDMIRARQMVTDDTGKYYFR 266

Query: 232 SRSFQNKKDAEEHLTKKR 249
             +   ++D+ E LT  R
Sbjct: 267 LLA-DCQEDSAESLTNPR 283

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 66  LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLR 125
           LP   P   I   +C  C+ ++P RS HC  C  C++  DHHC W  NC+G  NY  FL 
Sbjct: 203 LPTGNPESTINIKYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLT 262

Query: 126 FLFWIIVTTSVLFCIQA 142
           FL      TS+   I A
Sbjct: 263 FLLSGTF-TSIFLIINA 278

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 65/142 (45%), Gaps = 9/142 (6%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C+ C   KP RS HC  C +CVL+ DHHC W  NC+G  NY  F  FL   +++ S  F 
Sbjct: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFL 197

Query: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQ 199
               R+ +I   +      + +S LIF  +     +F ++     +L+     + +G + 
Sbjct: 198 ----RVLWISVMKDPSMVVYPRSILIFTILCG---TFAIICGVFTYLQ--LQLVNDGMTT 248

Query: 200 IESWDMDRLESLFNSGRLTQKL 221
            E      ++ +   G L + L
Sbjct: 249 GEKDKWYTIQQIMREGNLVRTL 270

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
            +C  C+ ++P R+ HC TC  CVL  DHHC W  NC+G  NY +FL FL    + T++
Sbjct: 176 KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATTL 234

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127
           C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY  F  FL
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 3/91 (3%)

Query: 65  PLPNYKPPPD-IWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHF 123
           P+    P  D I   +C+ C+ ++P R+ HC  C  CV+  DHHC W  NCVG  NY +F
Sbjct: 162 PITRGNPNGDSILMKYCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYF 221

Query: 124 LRFLFWIIVTTSVLFCIQAKRIYFIWQQRHL 154
           + FL  I  T + +F +    I+   ++R +
Sbjct: 222 VTFL--ISGTLASIFLLANCAIHLARRRRSI 250

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 87/186 (46%), Gaps = 23/186 (12%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           CK C+  KP RS HC  C++C+L+ DHHC W  NC+G  NY  F  +LF    + ++++C
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWF--YLFIGGNSLTMIYC 192

Query: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQ 199
               R+ FI  +  +       S    LT++    SF ++     +L+      L+  SQ
Sbjct: 193 FT--RLLFISIKYKV------TSSRAILTMNILCGSFAIICSVFTYLQ------LDLVSQ 238

Query: 200 -IESWDMDR---LESLFNSGRLTQKLIDNTWRIYPESRSFQNKKDAEEHLTKKRPRFDEL 255
            I + +MD+   +      G+L +    N W +   + +F +    +   T+  P    +
Sbjct: 239 GITTNEMDKWYTIHEYCRDGKLARSKSGN-WFLIDSNNTFYSTNIYDH--TRYSPTQYTI 295

Query: 256 VNFPYD 261
           +N P D
Sbjct: 296 INDPTD 301

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127
           C  C   KP RS HC  CN+C+L+ DHHC W  NC+G  NY  F  FL
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFL 183

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLF--WIIVTTS 135
            +C  C+ ++P R+ HC  C  C+L  DHHC W  NC+G  NY +FL FL   W+     
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVIC 230

Query: 136 VLFC 139
           ++ C
Sbjct: 231 IVSC 234

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVL 137
            +C  C+ ++P R+ HC  C  CVL  DHHC W  NCVG  NY +FL FL    +  ++L
Sbjct: 158 KYCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALL 217

Query: 138 F 138
            
Sbjct: 218 I 218

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%)

Query: 66  LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLR 125
           LP+      +   +C  C+ ++P R+ HC  C+ C+L  DHHC W  NC+G  N+ +FL 
Sbjct: 173 LPSPVANAPVRLKYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLA 232

Query: 126 FLFWIIVTT 134
           FLF  ++++
Sbjct: 233 FLFSSVLSS 241

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 67  PNYKPPPDIWR--NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           P ++P   I+     C+ C++ K  RS HC  C +C+ + DHHC W  NCVG+ NY +F 
Sbjct: 114 PQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFY 173

Query: 125 RFL 127
            FL
Sbjct: 174 SFL 176

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLF 128
           C+ C+  K  RS HC  C +C+L+ DHHC W  NC+G  NY +F  FL 
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 60  TNPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFAN 119
           TN  R LP       I   +C  C  ++P R+ HC  C  C+ + DHHC W  NCVG  N
Sbjct: 171 TNTIR-LPVANKNHSIELKYCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRN 229

Query: 120 YPHFLRFLFWIIVTT 134
           Y +F+ FL   I+++
Sbjct: 230 YRYFIIFLVGAILSS 244

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 65  PLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           P   Y+  P  +  +C +CQS K ER+HH      CV   DH+C W    +G  NY  FL
Sbjct: 108 PPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFL 167

Query: 125 RFLFWIIVTTSVLFCIQAKRIYFIWQQR-HLPGYFFKKSELIFLTIS 170
           +F+ +  +  S+++      I+ I ++R + P + F  + +I L  +
Sbjct: 168 QFVAYYAINLSIIWVSIVSYIHMIIRKRPNQPHHHFNTNLIIILVFA 214

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 27/44 (61%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHF 123
           C+ C+  KP RS HC  C +CV + DHHC W  NCVG  NY  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127
           C+ C+  K  RS HC  C +C  + DHHC W  NC+G  NY +F  FL
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFL 178

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 64/132 (48%), Gaps = 6/132 (4%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139
           C  C+S K  R+HH K    C+   DHHC W    +G +NY  F +F+F+      + + 
Sbjct: 124 CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYFSCLLLIFWI 183

Query: 140 IQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQ 199
                I  I    H  GY    + ++ L +S P   F ++T++ LFL  ++   +N R+ 
Sbjct: 184 SIVSYIKRIVDYPH-TGYKLDPNLIVILILSVP---FSIMTLS-LFLSHVYFTFMN-RTS 237

Query: 200 IESWDMDRLESL 211
           +E  ++ R + L
Sbjct: 238 LEIINIKRNKKL 249

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 10/84 (11%)

Query: 72  PPDIWR-------NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           PPDI++        +C  CQS K ERSHH +    CV   DH+C W    +G  NY  F+
Sbjct: 112 PPDIYQCDPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFM 171

Query: 125 RFLFWI---IVTTSVLFCIQAKRI 145
           +++ +    +VT S+   +  KRI
Sbjct: 172 QYVMYFTIYLVTASLTIALFMKRI 195

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 104/250 (41%), Gaps = 19/250 (7%)

Query: 64  RPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHF 123
           +P   Y+   + +  +C  CQS K  RSHH K   +C+L  DH+C W    +   NY  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 LRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITI 183
           L+++ W      +L         FI     L G       +I   I S L   + L    
Sbjct: 162 LQYVGWF---NLLLLWYWLTIAVFIRTIGMLNG------NVIVGFILSCLGWMMTLG--- 209

Query: 184 LFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSF--QNKKDA 241
           LF+  ++  + N ++ IE+ D +R +   +   +T   I++  RI    + F   N++D 
Sbjct: 210 LFISHIY-YMSNNKTSIETLDAERGKRKKHKMMVTNDEIEHA-RIEYNRKYFCYYNQQDK 267

Query: 242 EEHLTKKRPRFDELVNFPYDFDLYTNALLYLGP-IHLWLWPYGVPTGDGNNFPKNGISKY 300
             ++ +     DE          + NA  +LG  I  WL+P+G    D      +    Y
Sbjct: 268 FRYVVELTA--DEFAKCWKKRSFWINAREFLGSDIIFWLFPWGSYFPDLRKREASSFQSY 325

Query: 301 EANSSLEDHI 310
             +  LE+ I
Sbjct: 326 GQSYDLENII 335

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 123/330 (37%), Gaps = 59/330 (17%)

Query: 60  TNPGRPLPNYKPP------PDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMN 113
           TN    + + KPP      P+ +  +C  CQS K ER HH +    C+   DH+C W   
Sbjct: 91  TNSNNRVISTKPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGT 150

Query: 114 CVGFANYPHFLRFLF-------WIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIF 166
            +G  NY  F++++F       WI ++ S    I++   +   + R L G          
Sbjct: 151 VIGRNNYRLFIQYVFYYNLLLAWIWLSISAF--IRSIVTFNEGEDRILNGN--------- 199

Query: 167 LTISSPLNSFVLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTW 226
           + +   L+    L    LF+  ++  I N  S      ++ L S   S     K+     
Sbjct: 200 IIVIIILSCIFWLMTGALFVTHIYYMINNKTS------LEVLASKHASKGRGMKI----- 248

Query: 227 RIYPESRSFQNKKDAEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPT 286
                    ++K +   + T+     DE  N   + D +   L Y      + + +G+ T
Sbjct: 249 ---------KSKLELIVNKTEGASAKDENTNISSNLDTHNKYLCYFNSNDRFRYVFGMTT 299

Query: 287 GDGNNFPKNGISKYEANSSLEDHILS--LPWPPDGGKTNTVFNHGSSTIEMRNESGEQLI 344
            D N   K   ++   N  L  +I++  +PW             GS   +     G Q +
Sbjct: 300 PDFNQCWKKDTTRANLNEFLGKNIITWFIPW-------------GSPIRKAGENQGIQDL 346

Query: 345 RTRLPQNGRHASREKWYNDWGESLDDFGVD 374
              L +       +K    +GE L +  ++
Sbjct: 347 EGCLAEESHRYGVQKIIGAYGEKLSEKTIE 376

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 89/229 (38%), Gaps = 38/229 (16%)

Query: 65  PLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           P   Y+  P+ +  +C  CQS K ERSHH      C+   DH+C W    +G  NY  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITIL 184
           +F  +      +++      I  I Q  H                +SPLN+ V LT+   
Sbjct: 176 QFTGYFSSLLLIMWVSICVFIRNITQHHH--------------NHNSPLNANVFLTLAFA 221

Query: 185 FLRCLF-NQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKDAEE 243
               LF   +L         +   LE++ +S R                ++F  +K    
Sbjct: 222 IFGWLFTTSMLASNIFYMCQNKTYLEAIMDSKR----------------KNFGTRKIFCY 265

Query: 244 HLTKKRPRF------DELVNFPYDFDLYTNALLYLGP-IHLWLWPYGVP 285
           +    + RF       E  +F     ++ N   ++GP + +WL P+G P
Sbjct: 266 YSEANKLRFVVEFERTEFHSFWSKKTIFANIKDFMGPNMLMWLIPFGKP 314

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 79/188 (42%), Gaps = 15/188 (7%)

Query: 58  ICTNPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF 117
           + TNP R    Y+  P  +  +C  CQS K  R+HH  T   C+   DH+C W    VG 
Sbjct: 113 MSTNPPRI---YQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGR 169

Query: 118 ANYPHFLRFLFWIIVTTSVLFCIQAKRI-YFIWQQRHLPGYFFKKSELIFLTISSPLNSF 176
            NY  F++F F+       +    A  +   I  Q H+P    + +  I + +   L   
Sbjct: 170 KNYRLFVQFAFYFWAFAIFVIVSTASFLPKIIRSQPHVP----RVNPNILIMMG--LCGM 223

Query: 177 VLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYP----ES 232
             L +  LFL   +  ++N R+ +E     R     N+       +D    ++     E+
Sbjct: 224 ATLMVGPLFLAHTYYMMVN-RTSLEIIATKRRSRATNTWLCYYNAVDGIRYVFEFKALEA 282

Query: 233 RSFQNKKD 240
           + F NK++
Sbjct: 283 QDFWNKRN 290

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 75/154 (48%), Gaps = 17/154 (11%)

Query: 69  YKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLF 128
           Y+  P+ +  +C  CQS K ER+HH +    CV   DH C +  + +G  NY  F+++  
Sbjct: 116 YQCDPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCV 175

Query: 129 WI-----IVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITI 183
           ++     I+ TS++  I++    +     HL G       LI + I   L +   +T+T 
Sbjct: 176 FMTIWLAIIWTSIVAYIRSITRDYRGHGSHLNG------NLIAILI---LTTLFWITVTS 226

Query: 184 LFLRCLFNQILNGRSQIESWDMDRLESLFNSGRL 217
           L L  L N I+  ++ IE   M+R    F++ ++
Sbjct: 227 LLLTQL-NCIVKNKTSIEV--MERRRKAFSTRKM 257

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 87/232 (37%), Gaps = 44/232 (18%)

Query: 65  PLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           P   Y+  P  +  +C  CQS K ER+HH      CV   DH+C W    +G  NY  F+
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFV 176

Query: 125 RFLFWIIVTTSVL---FCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTI 181
           +F+ +  +   ++    C+  K I    Q+ H  G                +N  V+LT+
Sbjct: 177 QFVAYFSILLLIMWASICVYTKEIT---QRHHSQG--------------PRINVNVMLTL 219

Query: 182 TILFLRCLFNQILNGRSQI-ESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240
               L  L      G +    S +   LE++ +S R                + F  +K 
Sbjct: 220 AFAILGWLLTTSTLGSAIFYMSQNKTSLEAIMDSKR----------------KKFGTRKI 263

Query: 241 AEEHLTKKRPRF------DELVNFPYDFDLYTNALLYLGP-IHLWLWPYGVP 285
              +    + RF       E   F     +  N   ++GP + +WL P G P
Sbjct: 264 FSYYSESNKLRFVVEFDRSEFHAFWSKKTILANVKDFMGPNMLMWLIPLGKP 315

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127
           C+ C + K  RS HC  C +C+ + DHHC W   C+G  N+ +F  FL
Sbjct: 139 CRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFL 186

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 60  TNPGRPLPN--YKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF 117
           T P   +P   Y+   + +  +C  C+  K  RSHH    N C+   DH+C W    +G 
Sbjct: 97  TQPTSTVPAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGK 156

Query: 118 ANYPHFLRFLFWIIVTTSVL 137
            NY  F+ FLF+  V+  ++
Sbjct: 157 DNYKQFVIFLFYCTVSFGIM 176

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 43/92 (46%), Gaps = 12/92 (13%)

Query: 72  PPDIWRN-------FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           PPDI++        +C  CQS K ER+HH  T   CV   DH+C W    VG  NY  F+
Sbjct: 112 PPDIYQCDPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFI 171

Query: 125 RF---LFWIIVTTSVLFCIQAKRIYFIWQQRH 153
           +F    F+  V   +  C   K I  I   RH
Sbjct: 172 QFSMYFFFYFVIVLIPVCKYLKDI--IHHNRH 201

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 35/70 (50%)

Query: 60  TNPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFAN 119
           T   +P   Y+  P  +  +C  CQS K  R+HH  T   C+   DH+C W    VG  N
Sbjct: 105 TRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKN 164

Query: 120 YPHFLRFLFW 129
           Y  F++F F+
Sbjct: 165 YRLFVQFAFY 174

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 7/71 (9%)

Query: 67  PNYKPPPDIWR-------NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFAN 119
           P    PP I++        +C  CQS K  R+HH      CV   DH+C W    +G  N
Sbjct: 106 PQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGN 165

Query: 120 YPHFLRFLFWI 130
           Y  F++FL ++
Sbjct: 166 YLLFIQFLVYM 176

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 61/146 (41%), Gaps = 19/146 (13%)

Query: 68  NYKPPPDIW----RNF---CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120
           N   PPDI+    R +   C  CQS K  R+HH      CV   DH+C W    +G  NY
Sbjct: 109 NSIAPPDIYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNY 168

Query: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180
             F++F F++ +   +L       I    Q R + G        +F      L    LL 
Sbjct: 169 KLFVQFTFYLDLVVLILM------ISIATQMRQMKGSANGNVYAVF-----ALACCALLM 217

Query: 181 ITILFLRCLFNQILNGRSQIESWDMD 206
              LFL  ++    N R+ IE  +++
Sbjct: 218 AGPLFLTHIYYMCYN-RTSIEIIEVN 242

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%)

Query: 65  PLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           P   Y+  P  +  +C +CQS K ER+HH      C+   DH+C W    +G  NY  F+
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFV 175

Query: 125 RFLFWIIVTTSVLFCIQAKRIYFIWQQRH 153
           +F  +      +++      I  I Q  H
Sbjct: 176 QFAAYFSTLLLIMWVSICVYIRIITQHNH 204

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 67/157 (42%), Gaps = 15/157 (9%)

Query: 67  PN-YKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLR 125
           PN Y+  P  +  +C  CQS K  R+ H      CV   DH+C W    +GF NY  F++
Sbjct: 102 PNCYQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQ 161

Query: 126 FLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFK-KSELIFLTISSPLNSFVLLTITIL 184
           F+F+  V   +++   +  I      R +  Y  +  + LI L I S +   +   + + 
Sbjct: 162 FVFYFAVLLMIVWITISVYI------RDIRQYHARLNANLIVLLIISGIGWLMTSGLFVS 215

Query: 185 FLRCLFNQI-------LNGRSQIESWDMDRLESLFNS 214
           ++  +   +       L  R +     M RL   +NS
Sbjct: 216 YIYYMSQNLTSIEVIDLKKRKRTPELSMQRLYCYYNS 252

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 67/152 (44%), Gaps = 21/152 (13%)

Query: 69  YKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLF 128
           Y+  P  +  +C  CQS K ER+HH      CV   DH+C W    +G  NY  F++F+ 
Sbjct: 126 YQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVT 185

Query: 129 WI---IVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTITILF 185
           +    ++   +  C+  + I     QRH  G+            + PLN  V+LT+ +  
Sbjct: 186 YFSSLLLLMWLSICVYIRDI----TQRHR-GH------------NPPLNVNVILTLALAL 228

Query: 186 LRCLFN-QILNGRSQIESWDMDRLESLFNSGR 216
              L N  +L       + +   LE++ +S R
Sbjct: 229 FGWLMNTSMLAATVFYMAQNKTSLEAIMDSKR 260

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLF- 138
           C  C S K ER+HH      CV   DH C W    +G  NY  F++F+ ++ + +  +F 
Sbjct: 127 CSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVFV 186

Query: 139 --CIQAKRI 145
             C   +RI
Sbjct: 187 PICAFIRRI 195

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
           RNFC +    KP RS      N  V   DH+CPW  N +G  N+  F+ F+  + +   +
Sbjct: 460 RNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEIGILI 519

Query: 137 LFCIQAKRIYFI 148
             C+  K   F+
Sbjct: 520 FVCLTMKYFDFL 531

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
           R+FC      KP RS   +     ++  DH CPW  N VG  N+  F+ FL  ++   S 
Sbjct: 451 RHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSC 510

Query: 137 LF--CIQ 141
            F  CI+
Sbjct: 511 FFIACIE 517

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 19/114 (16%)

Query: 35  LSVPKQITFEFCLSMIWL--SYYLAIC--TNPGRPLPNYKPPPDIW-------------- 76
           +++  Q T  F L +I L  SY L +   ++PGR +P  K    I               
Sbjct: 402 VTIQDQYTANFLLMIIILAVSYLLVVLVKSDPGR-IPTEKNTQVIRETIKDLLATGKFDS 460

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWI 130
           +NFC +    KP RS      N  V   DH+CPW  N +G  N+  FL  +  +
Sbjct: 461 KNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLV 514

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 52/115 (45%), Gaps = 19/115 (16%)

Query: 45  FCLSMIWLSY--YLAICTNPGRPLPNYKPPP--------------DIWRNFCKKCQSYKP 88
           F +S+I + Y  Y  I +NPGR   N+                  DI R+FC +    KP
Sbjct: 418 FGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDI-RHFCLETWVRKP 476

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVT--TSVLFCIQ 141
            RS         V   DH+CPW  N +G  N+  F+ F+F+  VT  + V+ C +
Sbjct: 477 LRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTIWSFVIVCFE 531

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 72  PPDIWRN-------FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124
           PPD+++        +C  CQS K  R+HH      CV  +DH+C W    +G  NY  F 
Sbjct: 107 PPDVYQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFN 166

Query: 125 RFLFWIIVTTSVLF 138
           +FL   ++   ++F
Sbjct: 167 QFLMCFLMHALIIF 180

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127
           +NFC +  + KP RS      N  V   DH+CPW  N VG  N+  F+ F+
Sbjct: 468 KNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWI 130
           +NFC +  + KP RS +    N  V   DH CPW  N VG  N+ +F+ F+  +
Sbjct: 471 KNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLV 524

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
           +NFC +  + KP RS      N  V   DH+CPW  N VG  N+     F+F+I +  S 
Sbjct: 469 KNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHK---AFIFFIALMESG 525

Query: 137 LFCIQA 142
           +F   A
Sbjct: 526 IFTFFA 531

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%)

Query: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLF 128
           NFC +  + KP RS +    N  V   DH+CPW  N VG  N+  FL F+ 
Sbjct: 462 NFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127
           ++FC +  + KP RS +    N  V   DH+CPW  N VG  N+  F+ F+
Sbjct: 469 KSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 14/90 (15%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
            NFC +    KP RS +    +  V   DH CPW  N +G  N+  F+ F+  +++    
Sbjct: 476 NNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIG--- 532

Query: 137 LFCIQAKRIYFIWQQRHLPGYFFKKSELIF 166
                      IW+  +L   +F + E ++
Sbjct: 533 -----------IWEYTYLAMEYFDELEDLY 551

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
           +NFC +    KP RS      N  V   DH+CPW  N VG  N+     F+F+I +  S 
Sbjct: 469 KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHK---AFIFFITLMESG 525

Query: 137 LFCIQA 142
           +F   A
Sbjct: 526 IFTFLA 531

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
           +NFC +    KP RSH        V   DH CPW  N +G  N+ +F+    W I+ T V
Sbjct: 454 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFM----WFILLTEV 509

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTT 134
           R+FC +    KP RS         +   DH+CPW  N VG  N+  FL F+  I V  
Sbjct: 459 RHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVAV 516

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 71/180 (39%), Gaps = 10/180 (5%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
           ++FC       P RS +    N  +   DH+CPW  N +GF N+  FL F+ ++ +   +
Sbjct: 453 KHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGVFI 512

Query: 137 LFCIQAKRIYFIWQQRHLPGYFFKKS---ELIFLTISSPLNSFVLLTI---TILFLRCLF 190
              +  +     WQ         + S   +L       P +SF+L  +   T+  +   F
Sbjct: 513 FVRLSIRYFELEWQNLDDIQMDCRSSFCPQLCKGYYLDPFHSFMLAWVCFQTMWVVALTF 572

Query: 191 NQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKDAEEHLTKKRP 250
            QI      +  ++      L+   R    + + T+   PE    ++  +A E + +  P
Sbjct: 573 VQIFEASKGVTDYEY----RLWVRKRRGISISEETFSSVPEELIEEDDSEASEVIVQSNP 628

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWI 130
           R+FC +    KP RS +    +  +L  DH+CPW  N VG  N+  F+ F+  +
Sbjct: 453 RSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILAL 506

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 14/89 (15%)

Query: 78  NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVL 137
           NFC +    KP RS +       V   +H+CPW  N +G  N+  F+ F           
Sbjct: 429 NFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFF----------A 478

Query: 138 FCIQAKRIYFIWQQRHLPGYFFKKSELIF 166
           F +Q +   F+W    L   +FKK+  I+
Sbjct: 479 FSVQYEMFLFMW----LCLEYFKKTNHIY 503

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 37/90 (41%), Gaps = 14/90 (15%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
            NFC +    KP RS +       V   DH+CPW  N VG  N+  F+ F          
Sbjct: 445 ENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFF---------- 494

Query: 137 LFCIQAKRIYFIWQQRHLPGYFFKKSELIF 166
              +Q     F+W    L   +FKK+  I+
Sbjct: 495 AVTVQYHMFLFMW----LCLAYFKKTNYIY 520

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWI 130
           +NFC +    KP R       ++ VL  DH+CPW  N VG  N+  F+ ++  +
Sbjct: 457 KNFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 23/54 (42%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWI 130
            NFC +    KP RS         V   DH CPW  N +G  N+  FL F   +
Sbjct: 442 ENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTV 495

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRF 126
           ++FC       P R+ + +  +  +L  DH+CPW  N +GF N+  F+ F
Sbjct: 445 KHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 23/52 (44%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLF 128
           ++FC      KP RS         V   DH CPW  N +G  N+  FL F+ 
Sbjct: 449 KHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL 500

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 36/90 (40%), Gaps = 14/90 (15%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
            NFC +    K  RS +       V   DH+CPW  N +G  N  H L   F + V    
Sbjct: 439 ENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN--HKLSLFFAMTV---- 492

Query: 137 LFCIQAKRIYFIWQQRHLPGYFFKKSELIF 166
               Q     F+W    L   +FKK+  I+
Sbjct: 493 ----QYHMFLFMW----LSLAYFKKTNHIY 514

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 7/96 (7%)

Query: 79  FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWI---IVTTS 135
           FC K    KP R    K   Q V   DH+C W  N VG  N+  ++ FL  +   ++T  
Sbjct: 404 FCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETFLMTFG 463

Query: 136 VL----FCIQAKRIYFIWQQRHLPGYFFKKSELIFL 167
           VL    F +  K        R +  + +K  +++FL
Sbjct: 464 VLNWRYFGLMEKTAECFLFNRTIICHGYKNLKVVFL 499

>NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97
          Length = 784

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 14/98 (14%)

Query: 23  GYGAHYFILSNFLS---VPKQITFEFCLSMIWLSYYLAICT------NPGRPLPNYKP-P 72
           G   H  +LSN +    +  Q +     S +  SY   I +      +  +  P ++   
Sbjct: 575 GSIPHQGVLSNAMDNLLLSSQSSVRSTTSSLVESYKSKIVSLFSHSNDSSKTEPTHEHWV 634

Query: 73  PDIWRNFCKKCQSYKP--ERSHHCKTCNQ--CVLMMDH 106
           PD  R  C+KCQ      ER HHC+ C +  C L + H
Sbjct: 635 PDSERTSCRKCQKQFTFIERKHHCRHCGEIYCALHLRH 672

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136
           ++FC       P RS + +     +   DH CPW  N +G  N  H L ++F +++  SV
Sbjct: 465 KHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLN--HKLFYMFVVLLEISV 522

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 189 LFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPES-RSFQN 237
           LFN I +GR    S+DM +  SL        KL D+  RI  ES RS +N
Sbjct: 536 LFNNIKSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAEN 585

>TBLA0D03600 Chr4 complement(890231..891691) [1461 bp, 486 aa] {ON}
           Anc_1.532 YKL211C
          Length = 486

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 135 SVLFCIQAKRIYFIWQQRHLPGYFFKKSELIF-LTISSPLNSFV 177
           S++ CI AKR+  +  Q  +PGY F+  E  F L ++ P+  FV
Sbjct: 214 SIMNCIYAKRMEDVTAQSKIPGYTFEDLEANFKLGLAPPVLDFV 257

>Smik_7.267 Chr7 complement(442158..444161) [2004 bp, 667 aa] {ON}
           YGL023C (REAL)
          Length = 667

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 13/51 (25%)

Query: 70  KPP------PDIWRNFCKKCQSYKP----ERSHHCKTCNQCVLMMDHHCPW 110
           KPP      PD  RN C+ C  +KP    ER HHC+ C   +   DH   W
Sbjct: 474 KPPTKDHWIPDSKRNSCRYC--HKPFTLWERKHHCRHCGD-IFCQDHLRHW 521

>Kwal_33.14481 s33 (690854..694693) [3840 bp, 1280 aa] {OFF} YNL172W
           (APC1) - subunit of ubiquitin- protein ligase [contig
           103] PARTIAL
          Length = 1280

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 186 LRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKDAEEHL 245
           L+ + NQ+ N  S++    +DR   L  + R+ + L   T +I     SF+N+K     L
Sbjct: 741 LKSIENQVSNVGSELSFSLIDR-SDLQKNERILKSLQSETCQISRTELSFENQKSGAGGL 799

Query: 246 TKKRPRFDELVNFPYDF 262
            KK P   ++++  Y+ 
Sbjct: 800 LKKPPNIKKIIDQIYNL 816

>Kwal_YGOB_33.14481 s33 (690854..694732,694735..695973) [5118 bp,
           1705 aa] {ON} ANNOTATED BY YGOB -
          Length = 1705

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 186 LRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKDAEEHL 245
           L+ + NQ+ N  S++    +DR   L  + R+ + L   T +I     SF+N+K     L
Sbjct: 741 LKSIENQVSNVGSELSFSLIDR-SDLQKNERILKSLQSETCQISRTELSFENQKSGAGGL 799

Query: 246 TKKRPRFDELVNFPYDF 262
            KK P   ++++  Y+ 
Sbjct: 800 LKKPPNIKKIIDQIYNL 816

>YGL023C Chr7 complement(450197..452104) [1908 bp, 635 aa] {ON}
           PIB2Protein of unknown function; contains FYVE domain;
           similar to Fab1 and Vps27
          Length = 635

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 7/42 (16%)

Query: 73  PDIWRNFCKKCQSYKP----ERSHHCKTCNQCVLMMDHHCPW 110
           PD  RN C+ C  +KP    ER HHC+ C   +   DH   W
Sbjct: 451 PDSKRNSCRYC--HKPFTLWERKHHCRHCGD-IFCQDHLRHW 489

>KAFR0F03170 Chr6 complement(627907..629685) [1779 bp, 592 aa] {ON}
           Anc_4.97 YGL023C
          Length = 592

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 4/56 (7%)

Query: 73  PDIWRNFCKKCQSY--KPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRF 126
           PD  R  CKKC       ER HHC+ C +  +    H   T+     A + H  +F
Sbjct: 460 PDSQRTNCKKCGKKFTVVERKHHCRHCGE--IFCQDHVKHTLYLDSDAKFCHLRQF 513

>Suva_7.256 Chr7 complement(440959..443025) [2067 bp, 688 aa] {ON}
           YGL023C (REAL)
          Length = 688

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 7/42 (16%)

Query: 73  PDIWRNFCKKCQSYKP----ERSHHCKTCNQCVLMMDHHCPW 110
           PD  RN C+ C  +KP    ER HHC+ C   +   DH   W
Sbjct: 501 PDSKRNSCRYC--HKPFTLWERKHHCRHCGD-IFCQDHLRHW 539

>Kpol_2000.48 s2000
            (89157..90446,90448..90498,90501..90605,91448..91456,
            92182..94377) [3651 bp, 1216 aa] {ON}
            (89157..90446,90448..90498,90501..90605,91448..91456,
            92182..94377) [3651 nt, 1217 aa]
          Length = 1216

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 171  SPLNSFVLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFN 213
            S LN  +LL    LF+  +FN I++G++ +  W M R   +F+
Sbjct: 1052 SQLNKKLLLG---LFVSIIFNMIISGKTNVIYWSMKRANKIFD 1091

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.480 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,579,553
Number of extensions: 2135321
Number of successful extensions: 7160
Number of sequences better than 10.0: 140
Number of HSP's gapped: 7205
Number of HSP's successfully gapped: 140
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)