Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOL002C (IZH2)6.27ON31731716650.0
Smik_15.1686.27ON32731716200.0
Skud_15.1606.27ON32731715900.0
Suva_15.1736.27ON32731715000.0
SAKL0E01474g6.27ON31128110611e-145
KNAG0M012406.27ON31427710291e-140
CAGL0E02519g6.27ON31528010121e-138
TDEL0G044206.27ON32230610091e-137
NCAS0H015106.27ON31328210001e-136
KAFR0G026506.27ON3212859951e-135
NDAI0F017406.27ON3133109601e-130
TBLA0E030606.27ON3193179551e-129
KLTH0C11044g6.27ON3153059401e-127
ZYRO0C07612g6.27ON3192919321e-125
Ecym_30316.27ON3283169251e-124
TPHA0M002906.27ON3273109201e-123
Kwal_56.224546.27ON3152799161e-123
KLLA0D01331g6.27ON3082999081e-122
Kpol_1032.96.27ON3182768961e-120
ACL002C6.27ON3292728741e-116
SAKL0C09218g3.90ON3143067088e-92
NDAI0A071603.90ON3303167031e-90
CAGL0G04631g3.90ON3163106966e-90
Skud_4.7663.90ON3163096958e-90
Suva_2.6683.90ON3153076959e-90
YDR492W (IZH1)3.90ON3163096941e-89
TPHA0A006403.90ON3272746942e-89
KLTH0C09504g3.90ON3193136923e-89
TDEL0D053403.90ON3163096913e-89
NCAS0I025703.90ON3143146802e-87
Smik_4.7693.90ON3162906792e-87
ZYRO0B06556g3.90ON3183086784e-87
AFR337W3.90ON3173006714e-86
Kwal_56.227043.90ON3202996653e-85
Kpol_1053.263.90ON3243186646e-85
Ecym_35883.90ON3052886522e-83
KLLA0C12441g3.90ON3153116506e-83
KAFR0A081303.90ON3193096332e-80
TBLA0B022903.90ON3263106272e-79
KNAG0K021603.90ON3233175933e-74
TBLA0B082553.90ON2962843833e-43
NCAS0C049203.90ON3263183121e-32
NDAI0G043003.90ON3182832936e-30
CAGL0I07491g3.90ON3012952102e-18
Suva_15.643.90ON3123121934e-16
KLLA0F15510g5.197ON6223051814e-14
AAL153C5.197ON4193291805e-14
Skud_12.915.197ON5422331762e-13
NDAI0I023305.197ON5782381673e-12
Skud_15.533.90ON3123161644e-12
Smik_12.865.197ON5422381647e-12
Smik_15.563.90ON3123161601e-11
KAFR0J006705.197ON5092311621e-11
Suva_10.1045.197ON5412381593e-11
TPHA0E031205.197ON5692461583e-11
NCAS0D026005.197ON5432761584e-11
KNAG0B051005.197ON5382431575e-11
YLR023C (IZH3)5.197ON5433191551e-10
YOL101C (IZH4)3.90ON3122391432e-09
Kpol_2002.945.197ON5772371407e-09
SAKL0G12980g5.197ON5632521381e-08
KLTH0B03498g5.197ON5462751372e-08
ZYRO0B10538g5.197ON5312391372e-08
Kwal_33.151225.197ON5662471353e-08
TDEL0E043205.197ON4502551301e-07
Ecym_71095.197ON5682471264e-07
TBLA0C060505.197ON4372431174e-06
CAGL0D03322g5.197ON5452371158e-06
KNAG0K006703.90ON3212251042e-04
KLTH0D09174g2.171ON1117110770.42
Suva_14.2322.171ON118581741.1
CAGL0H10516g2.319ON88034712.3
Skud_5.1697.236ON53391702.7
TBLA0E015604.45ON139466685.1
NDAI0E047807.241ON53585685.2
YER060W (FCY21)na 1ON528168685.5
Suva_5.169na 1ON526168676.5
NDAI0A025707.236ON4391626510.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL002C
         (317 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   645   0.0  
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   628   0.0  
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   617   0.0  
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   582   0.0  
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   413   e-145
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   400   e-140
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   394   e-138
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   393   e-137
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   389   e-136
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   387   e-135
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      374   e-130
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   372   e-129
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   366   e-127
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   363   e-125
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   360   e-124
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   358   e-123
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   357   e-123
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   354   e-122
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   349   e-120
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   341   e-116
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   277   8e-92
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   275   1e-90
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   272   6e-90
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   272   8e-90
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   272   9e-90
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   271   1e-89
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   271   2e-89
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   271   3e-89
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   270   3e-89
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   266   2e-87
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   266   2e-87
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   265   4e-87
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   263   4e-86
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   260   3e-85
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   260   6e-85
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   255   2e-83
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   254   6e-83
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   248   2e-80
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   246   2e-79
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   233   3e-74
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             152   3e-43
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   124   1e-32
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    117   6e-30
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    86   2e-18
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    79   4e-16
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    74   4e-14
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    74   5e-14
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    72   2e-13
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     69   3e-12
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    68   4e-12
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    68   7e-12
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    66   1e-11
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    67   1e-11
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    66   3e-11
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    65   3e-11
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    65   4e-11
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    65   5e-11
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    64   1e-10
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    60   2e-09
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    59   7e-09
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    58   1e-08
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    57   2e-08
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    57   2e-08
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    57   3e-08
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    55   1e-07
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    53   4e-07
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    50   4e-06
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    49   8e-06
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    45   2e-04
KLTH0D09174g Chr4 (762443..765796) [3354 bp, 1117 aa] {ON} simil...    34   0.42 
Suva_14.232 Chr14 complement(417816..421373) [3558 bp, 1185 aa] ...    33   1.1  
CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]...    32   2.3  
Skud_5.169 Chr5 complement(262759..264360) [1602 bp, 533 aa] {ON...    32   2.7  
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    31   5.1  
NDAI0E04780 Chr5 (1074922..1076529) [1608 bp, 535 aa] {ON}             31   5.2  
YER060W Chr5 (274567..276153) [1587 bp, 528 aa] {ON}  FCY21Putat...    31   5.5  
Suva_5.169 Chr5 (251694..253274) [1581 bp, 526 aa] {ON} YER060W-...    30   6.5  
NDAI0A02570 Chr1 (573728..575047) [1320 bp, 439 aa] {ON}               30   10.0 

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/317 (100%), Positives = 317/317 (100%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV
Sbjct: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120
           KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL
Sbjct: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120

Query: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180
           FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF
Sbjct: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180

Query: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240
           CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW
Sbjct: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240

Query: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300
           TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL
Sbjct: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300

Query: 301 LNSYELVHIKMENGIVS 317
           LNSYELVHIKMENGIVS
Sbjct: 301 LNSYELVHIKMENGIVS 317

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/317 (95%), Positives = 315/317 (99%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           MSTLLERTKSVQELKKRAAGKTSANPAEVA+AKKVL+RLYSWDEIPEWQRDNDFILHGYV
Sbjct: 11  MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYV 70

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120
           +ETSSFIETFKSLFYLHNESVNIYSHL+PALGFFTVLLLDKSTIKVF TTTW DH+VIDL
Sbjct: 71  RETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDL 130

Query: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180
           FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSIL+YGY+EKFSLF
Sbjct: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLF 190

Query: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240
           CLFALITVSFG+ACSIVSLKDKFRKREWRPYRAGLFVCFGLSSI+PIFSGLYCYSFSEIW
Sbjct: 191 CLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIW 250

Query: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300
           TQIQLFWVLLGGVLYIIGAVLYGMRFPEK+CPGKFDIWGHSHQLFHFLVVIA+LCHLRGL
Sbjct: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGL 310

Query: 301 LNSYELVHIKMENGIVS 317
           LNSYELVHIKME+GI+S
Sbjct: 311 LNSYELVHIKMESGIIS 327

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/317 (93%), Positives = 309/317 (97%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           MSTLLERTKSVQELKKRAAGKT ANPAEVA+AKKVL+RLYSWDEIPEWQRDND+ILHGYV
Sbjct: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120
           +ET SF+ETFKSLFY+HNESVNIYSHLIPALGFFTVLLLDKSTIKVF TTTW DHM+IDL
Sbjct: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDL 130

Query: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180
           FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSM SILYYGY+EKFSLF
Sbjct: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLF 190

Query: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240
           CLFALITVSFGIACSIV+LKDKFRKREWRPYRAGLFVCFGLSSI+PIFSGLYCY+FSEIW
Sbjct: 191 CLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIW 250

Query: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300
           TQIQLFWVLLGGVLYIIGAVLYGMRFPEK+CPGKFDIWGHSHQLFHFLVVIA+ CHLRGL
Sbjct: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGL 310

Query: 301 LNSYELVHIKMENGIVS 317
           LNSYELVH+KME  IVS
Sbjct: 311 LNSYELVHLKMEGKIVS 327

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/317 (89%), Positives = 305/317 (96%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           MSTLLERT SVQELKKRAAG T+ANPAEVAKAKKVL+R+YSWDEIPEWQRDND+ILHGYV
Sbjct: 11  MSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYV 70

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120
           KETSSF++TFKSLFY+HNESVNIYSHLIPA+GF TVLLLDK+TI VF TTTWLDHM+IDL
Sbjct: 71  KETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDL 130

Query: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180
           F++GAFACLILSSSFHC KSHSL+IATLGNKLDYLGICILIVTSMVSILYYGY++KF  F
Sbjct: 131 FFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAF 190

Query: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240
           CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSI+PIFSGLY YSFSEIW
Sbjct: 191 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIW 250

Query: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300
            QIQLFWVLLGG LYIIGAVLYGMRFPEK+ PG+FDIWGHSHQLFHFLVVIA+LCH+RG+
Sbjct: 251 NQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGV 310

Query: 301 LNSYELVHIKMENGIVS 317
           LNSYELVHIKM+NGIVS
Sbjct: 311 LNSYELVHIKMQNGIVS 327

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  413 bits (1061), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 190/281 (67%), Positives = 234/281 (83%)

Query: 33  KKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALG 92
           KK +RRLYSW+EIP+WQ+DN+ I HGYV+ET+SF+  F SLFY+HNESVNIY+HL+P L 
Sbjct: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89

Query: 93  FFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 152
           FF V+L DK  IKVF TTT+LD++++DLF+ GAF CLILSS+FHCLK+HSLRIA LGNKL
Sbjct: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149

Query: 153 DYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 212
           DYLGI  LIV+SM+SI+YYG+F+    F  F+ +T+ FGIAC+I SL D FR REWRPYR
Sbjct: 150 DYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYR 209

Query: 213 AGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICP 272
           A LFV FGLS+++PIFSG+  Y F E W ++Q+ WVLLGGV YIIGA+LY +R PE+I P
Sbjct: 210 AALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISP 269

Query: 273 GKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMEN 313
           GKFDIWGHSHQ+FH LVVIAALCHL+ +LNSYELVH K+ +
Sbjct: 270 GKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  400 bits (1029), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 181/277 (65%), Positives = 231/277 (83%)

Query: 32  AKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPAL 91
            KK+ +R+Y+W+EIPEWQ+DN+ I+ GYV+ET+SF++   SLFYLHNESVN+YSHLIPAL
Sbjct: 29  TKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88

Query: 92  GFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK 151
            FF+VL L+K  +K F TT+ +D++ IDLF+ GAF CLILSS+FHC KSHSL++AT GNK
Sbjct: 89  CFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNK 148

Query: 152 LDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPY 211
           LDYLGI +LIVTSM+SILYYG+++   +F  F+ +T+SFG AC +VSLKD FR REWRPY
Sbjct: 149 LDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208

Query: 212 RAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKIC 271
           RAGLFV FGLS+I+PI SG++ Y   E + +IQ+ W++L GV YI+GA LYG+RFPEK  
Sbjct: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268

Query: 272 PGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308
           PGK+DIWGHSHQ+FH LVV+AALCHL+GL+ SYELVH
Sbjct: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 179/280 (63%), Positives = 228/280 (81%)

Query: 31  KAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPA 90
           + K V+R+LY+W+EIPEWQ+DN+ I  GYV+ETSS +E  +SLFYLHNE+VNIYSHLIPA
Sbjct: 30  RKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPA 89

Query: 91  LGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGN 150
           + FF+ +  +K  +  ++TTT +D+++ID+F+ GAF+CLILSS+FHCLKSHSLR+A  GN
Sbjct: 90  IAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGN 149

Query: 151 KLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRP 210
           KLDYLGI  LIV SMVSILYYG+      F +F+LIT++FG AC++VSLKD FR REWRP
Sbjct: 150 KLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRP 209

Query: 211 YRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKI 270
           YRA LFV FGLS+++PI +GL+ Y  +E WT+IQL WV+L GV YI GA LYG+RFPEK+
Sbjct: 210 YRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKM 269

Query: 271 CPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIK 310
            PG FD+WGHSHQ+FH LVV+AALCHL+ LL SY LVH +
Sbjct: 270 SPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  393 bits (1009), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 186/306 (60%), Positives = 233/306 (76%), Gaps = 4/306 (1%)

Query: 6   ERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSS 65
           ++T +V   K+  +G       +    KK  R+LY+WDEIP WQRDN+ IL GYV ET S
Sbjct: 16  DQTSTVT--KEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHILSGYVGETRS 71

Query: 66  FIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGA 125
             + F SLFYLHNESVNIY+HL+P + F  VL  DK  +  F TTT +D+++IDLF   +
Sbjct: 72  MFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVS 131

Query: 126 FACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFAL 185
           F CL LSS FHCLK+HS  +AT GNKLDYLGI +L+VTSMVSI+YYG+FE  +LF LF+ 
Sbjct: 132 FTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSF 191

Query: 186 ITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQL 245
           IT +FG AC++VSLK+ FR REWRPYRA +FV FGLS+++PI +G++ Y FSEI+ +IQ+
Sbjct: 192 ITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQV 251

Query: 246 FWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYE 305
            WVLLGG+ YI GAVLYG+RFPEK  PGK+DIWGHSHQLFH LVV+AALCHL GL+ SY 
Sbjct: 252 KWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYN 311

Query: 306 LVHIKM 311
           LVH+KM
Sbjct: 312 LVHLKM 317

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/282 (63%), Positives = 224/282 (79%)

Query: 30  AKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIP 89
            K    +R+LY+WDEIPEWQ+DN+ I+ GYV+ET+SF   F SLFY+HNE+ N+YSHL+P
Sbjct: 32  TKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVP 91

Query: 90  ALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLG 149
            + FF  +L DK  I  F TTT+ D+++I+LF+ GAF CLILSS+FHC KSHSL+IAT G
Sbjct: 92  GVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFG 151

Query: 150 NKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWR 209
           NKLDYLGI +LIVTSM+SIL+YG+++    F  F+L+T+SFG AC+IVSLKDKFR REWR
Sbjct: 152 NKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWR 211

Query: 210 PYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEK 269
           PYRAGLFV FGLS+++PI +G+  Y   E WT+IQL WV+L GV YI GA LYG+RFPEK
Sbjct: 212 PYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEK 271

Query: 270 ICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKM 311
              G FDIWGHSHQ+FH LVV+AA CHL+ LL SYELVH+ +
Sbjct: 272 YVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/285 (64%), Positives = 226/285 (79%)

Query: 25  NPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIY 84
           N  E  ++ + + +LY+W+EIP+WQ+DN+ I+ GYVKET+SF    +SLFYLHNESVN+Y
Sbjct: 26  NKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVY 85

Query: 85  SHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLR 144
           SHLIPA+ F    LL+K+ +  F TTT LD++ IDLF+ GAF CLILSS+FHC KSHSLR
Sbjct: 86  SHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLR 145

Query: 145 IATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFR 204
           IAT GNKLDYLGI +LI TSM+S+LYYG+++  SLF +FA IT+SFG+AC+ VSLKDKFR
Sbjct: 146 IATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFR 205

Query: 205 KREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGM 264
            RE R YRA LFVCFGLS+++P+  GLY Y F   W +IQL WVLL GV YI GA LYG+
Sbjct: 206 SRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGI 265

Query: 265 RFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHI 309
           RFPEK  PGK+DIWGHSHQLFH LVVIAALCH + L+ SYE VH+
Sbjct: 266 RFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHM 310

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  374 bits (960), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 231/310 (74%), Gaps = 1/310 (0%)

Query: 3   TLLERTKSVQELKKRAAGKTSANPAEVAKAK-KVLRRLYSWDEIPEWQRDNDFILHGYVK 61
           T+ +R  +            + N   + + K KV+ +LY WDEIPEWQ+DN+ I+ GYV+
Sbjct: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63

Query: 62  ETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLF 121
           ET+SF     SLFY+HNES N+YSHL+P + FF  ++L+K  I +++TT+ +D+++IDLF
Sbjct: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLF 123

Query: 122 YSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFC 181
           + GAF CLILSS FHC KSHSL++ATLGNKLDYLGI ILIVTSM+SI+Y+G+F+    F 
Sbjct: 124 FFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFY 183

Query: 182 LFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWT 241
            F+ +T  FG AC+ VSLKD FR REWRPYRAGLFV FGLS+I+PI +G + Y   E + 
Sbjct: 184 FFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFI 243

Query: 242 QIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLL 301
           +IQL W++L G  YI GA LYG+RFPEK  PG FDIWGHSHQ+FH LVV+AA CHLRGLL
Sbjct: 244 RIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLL 303

Query: 302 NSYELVHIKM 311
           +SYE+VH ++
Sbjct: 304 SSYEIVHSRL 313

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 230/317 (72%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           M T ++R K     ++        N  ++  +    +RLY+WDEIP WQ DN++I  GYV
Sbjct: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120
           +ET+S  E+F SLFY+HNESVNIY+HLIPA  F ++LL +   +K   TTT+ D++ IDL
Sbjct: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120

Query: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180
           F+ GAF CL LSS+FHC KSHSL+I+  GNKLDYLGI ILI TS++S+LY+GY +   +F
Sbjct: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIF 180

Query: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240
            +F+ IT+ FGIAC I SLKDKFR REWRPYRA LFV FGLS ++PI +G+  Y   E++
Sbjct: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240

Query: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300
            ++QL W++  GVLYI GA LYG RFPEK  PGK DIWG SHQ+FH LVVIAALCHLRGL
Sbjct: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300

Query: 301 LNSYELVHIKMENGIVS 317
           + SYELVH K++  + S
Sbjct: 301 IGSYELVHQKLDAQLQS 317

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  366 bits (940), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 224/305 (73%)

Query: 4   LLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKET 63
           L +R     EL  R   + S+   +    ++  RRLY+WDEIPEWQRDN+ I+ GY+ ET
Sbjct: 6   LTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILET 65

Query: 64  SSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYS 123
            S  E  KSL YLHNESVNIY+HL+P   F  V + ++  I+ F TT  +D+++IDLF+ 
Sbjct: 66  KSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFL 125

Query: 124 GAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLF 183
           G F CL++SS FHC K HSL +A LGNKLDYLGI  L+VTS+VSIL+YG+ +    F LF
Sbjct: 126 GGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLF 185

Query: 184 ALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQI 243
           + +T++FG+AC+ VSL +KFR REWRPYRA LFV FGLS+++P+ +G   Y   E WT+I
Sbjct: 186 SGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRI 245

Query: 244 QLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNS 303
           QL WVLLGGV YI+GAVLYG+RFPE++ PG FDIWGHSHQLFH LVV+AALCHLR LL +
Sbjct: 246 QLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGA 305

Query: 304 YELVH 308
           Y+L H
Sbjct: 306 YKLFH 310

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/291 (58%), Positives = 213/291 (73%), Gaps = 3/291 (1%)

Query: 21  KTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNES 80
           +T+     V   KK+L   Y+W+EIP+WQ+DN+ I+ GYV+ET+S  E  +SL YLHNES
Sbjct: 27  QTTIKIEPVNTQKKLL---YTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNES 83

Query: 81  VNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKS 140
           +NIY+H +P L F    + DK  IK F TTTW+D+M ID F+ GAF+CLILSS+FHC KS
Sbjct: 84  INIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKS 143

Query: 141 HSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLK 200
           HS R++  GNKLDYLGI ILIV SM+SILYY + +   LF  F LI   FG++C+I S  
Sbjct: 144 HSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFD 203

Query: 201 DKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAV 260
           D FR REWRPYRAGLFV FGLS+++PI  G+  Y F E WT+IQ+ WV+L G+ YI GA 
Sbjct: 204 DTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAF 263

Query: 261 LYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKM 311
           LY +RFPE++ PG FD  GHSHQ+FH LVVIAALCHL  L+NSYELVH  +
Sbjct: 264 LYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 222/316 (70%), Gaps = 9/316 (2%)

Query: 9   KSVQELKKRAAGK-----TSANPAEVAKAK----KVLRRLYSWDEIPEWQRDNDFILHGY 59
           + +Q+     AGK     TS    ++ +A     K   +L+SW EIPEWQRDN+ IL GY
Sbjct: 9   RKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGY 68

Query: 60  VKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVID 119
           VKET+SF ET  SL YLHNESVNIY+HLIP + FF VL L+K  I  F TTTW D+ +ID
Sbjct: 69  VKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIID 128

Query: 120 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSL 179
            F+ GAFACL++S ++HCLKSHS  ++ +GN+LDY+GI ILI TSM S+LYYG++    +
Sbjct: 129 TFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKM 188

Query: 180 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEI 239
           F  F+ +T+  G  C++V+L  +FR R WRPYRA +FV FGLSSI+PI + +  Y   E 
Sbjct: 189 FYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEET 248

Query: 240 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRG 299
           W  +QL W++L GVLYI GA +YG+RFPE + PG FDIWGHSHQLFH LVVIAALCH + 
Sbjct: 249 WNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKA 308

Query: 300 LLNSYELVHIKMENGI 315
           +  SYELVH ++   +
Sbjct: 309 VTQSYELVHFRLNEAV 324

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  358 bits (920), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 224/310 (72%), Gaps = 3/310 (0%)

Query: 2   STLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYS---WDEIPEWQRDNDFILHG 58
            T++  +   +E    A     +N   V    +  R+L +   WD++P+WQ+DN+ I  G
Sbjct: 13  ETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEG 72

Query: 59  YVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVI 118
           YVKET+SFI  F+SLF+LHNESVNIYSH++P L    +LL+D + IK F TTT++D+ +I
Sbjct: 73  YVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMI 132

Query: 119 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFS 178
           DLF +GAF+CLILSS+FH LKSHSL +A  GNKLDYLGI ILIVTSM+SILYYG+++   
Sbjct: 133 DLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPY 192

Query: 179 LFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSE 238
            F LF+ IT+ FGIAC  VSL +KFR REWRPYRA LFVCFGLS++ P+ +G++ Y   +
Sbjct: 193 FFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLED 252

Query: 239 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLR 298
            + +IQL W++  G  YI GA LY MR+PE+ICPG FD+WGHSHQ+FH  VVIAA  H  
Sbjct: 253 TFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFH 312

Query: 299 GLLNSYELVH 308
           GLL++YE  H
Sbjct: 313 GLLSAYEYAH 322

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  357 bits (916), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/279 (59%), Positives = 212/279 (75%)

Query: 33  KKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALG 92
           ++  RRLY WDEIPEWQ+DN+ IL+GY+ ET S     KSL YLHNESVNIY+HLIP   
Sbjct: 35  ERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWC 94

Query: 93  FFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 152
           F  + L ++  I+ + TT  +D+++IDLF+ G F CL++SS+FHC K HSL +A LGNKL
Sbjct: 95  FLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKL 154

Query: 153 DYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 212
           DYLGI  L+VTSMVSIL+YG+ +    F +F+ +T+ FG+AC+IVSL DKFR R+WRPYR
Sbjct: 155 DYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYR 214

Query: 213 AGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICP 272
           A LFV FGLS++ P+ +G+  Y F   WT+IQL WV L GV YI+GA+LYG+RFPE++ P
Sbjct: 215 AALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAP 274

Query: 273 GKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKM 311
           G FDIWG SHQLFH LVVIAA CHLR LL +Y+ VH +M
Sbjct: 275 GTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  354 bits (908), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/299 (57%), Positives = 216/299 (72%), Gaps = 5/299 (1%)

Query: 15  KKRAAGKTSANPAEVAKAKKVLR----RLYSWDEIPEWQRDNDFILHGYVKETSSFIETF 70
           K+    + +A   E    KK +R    R+YSWDEIP+WQ+DN+ ILHGYV+ET S+ E F
Sbjct: 5   KRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELF 64

Query: 71  KSLFYLHNESVNIYSHLIPALG-FFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACL 129
            SLFYLHNESVNIY+HLIPA+  FF +L      I  + TT+ +D+ +I+LF+ G   CL
Sbjct: 65  HSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCL 124

Query: 130 ILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVS 189
            +SS FH +K HSL IAT GNKLDYLGI +LI TSM+SIL+YG+ +   LF  FA +T  
Sbjct: 125 TMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSL 184

Query: 190 FGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVL 249
           FG+ C  +SLKDKFR REWRPYRA +FV FGLS++ PI +G   Y   E W ++QL WV+
Sbjct: 185 FGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVI 244

Query: 250 LGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308
             GVLYI GA LYG+RFPE++ PGKFDIWGHSHQLFH LVV+AALCHL+ L+ SY LVH
Sbjct: 245 WEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVH 303

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  349 bits (896), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 156/276 (56%), Positives = 215/276 (77%)

Query: 38  RLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVL 97
           +L +W+ +P+WQ+DN+ IL GYVKET+S      SL ++HNESVNI+SHL+PA  F T +
Sbjct: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99

Query: 98  LLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 157
           + DK  ++ + TTT  D++++DLF  GAF CL++SS+FHCLK+HS  +++ GNKLDYLGI
Sbjct: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGI 159

Query: 158 CILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 217
            +LIV+SM SILYYG+++   L+  F+ IT +FG++C++VSL ++FR REWRPYRA +FV
Sbjct: 160 VVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219

Query: 218 CFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDI 277
            FGLS+++PIF+G   Y   E   ++QL WV+L GV YI GA+LYG+RFPE++ PG FDI
Sbjct: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279

Query: 278 WGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMEN 313
           WGHSHQLFH LVV+AALCHLRGLL SY +VH ++ +
Sbjct: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  341 bits (874), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 155/272 (56%), Positives = 207/272 (76%)

Query: 39  LYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLL 98
           L SWD++P+WQ+DN+ IL GYV+ET+S+ +TF+SLFYLHNESVNIYSHLIP + F  + L
Sbjct: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111

Query: 99  LDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGIC 158
            +K  +  ++TTTW D+++ID+F  GA  CL LS  +HC+KSHSL ++  GNKLDY+GI 
Sbjct: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171

Query: 159 ILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 218
            LI  SM+S +YYG+++  ++F LF+ +T+S  +AC++VSL   FR REWR YRA +F  
Sbjct: 172 ALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTA 231

Query: 219 FGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIW 278
           FGLS ++P+ +  + Y   E +++IQL W+ L GVLYI GAVLYG+RFPEK+ PG FDIW
Sbjct: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291

Query: 279 GHSHQLFHFLVVIAALCHLRGLLNSYELVHIK 310
           GHSHQLFH LVVIAALCHLR LL+ Y+ VH  
Sbjct: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  277 bits (708), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 198/306 (64%), Gaps = 6/306 (1%)

Query: 5   LERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETS 64
           +  T +V++ +++   K SA     AK +K   RL +++E+P+WQ+DN+ IL GYV+ET 
Sbjct: 1   MSSTTTVRQ-RRKTTQKASAESIATAKGRK---RLCTFEELPDWQKDNELILDGYVRETR 56

Query: 65  SFIETFKSLFYLHNESVNIYSHLIPALGFFTVL--LLDKSTIKVFATTTWLDHMVIDLFY 122
           S  E FKSL Y HNE+VNIY+HL+P + +  +L  L D   I  F ++T  D+++I+ F 
Sbjct: 57  SVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFL 116

Query: 123 SGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCL 182
            GAF CL+ SS FHCLK HS   + + +K+DY+GI +LI  SMVSILYYG+ +    F +
Sbjct: 117 LGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKI 176

Query: 183 FALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQ 242
           F ++TV  G  C+   L D+F  + +R +RA  FV FG S ++PI  GL  +  SE   +
Sbjct: 177 FTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHR 236

Query: 243 IQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLN 302
           +QL +V L  V YI GAV YG R PE   PGKFD+ GHSHQ+FH +VV+ +LCHLR ++ 
Sbjct: 237 VQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVG 296

Query: 303 SYELVH 308
           SY  +H
Sbjct: 297 SYIFMH 302

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  275 bits (703), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 208/316 (65%), Gaps = 11/316 (3%)

Query: 2   STLLERTKS-----VQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFIL 56
           +T L R++S     + E        TS  P    + +K+   L  +DE+PEWQ+DND IL
Sbjct: 13  TTCLLRSRSNSVGGIFETNHLEDNDTSQKPKTNRRKRKI--HLSKFDELPEWQKDNDKIL 70

Query: 57  HGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFF----TVLLLDKSTIKVFATTTW 112
            GYV+ET+SFI  F+SLFYL+NE++NIY+HLIP++ +     T + ++   I  F TT+ 
Sbjct: 71  TGYVRETNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSV 130

Query: 113 LDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYG 172
           +D++VI++F  GAF CL+LSS FHCLK HS +  TL +KLDY+GI ILI  S++ ILY+G
Sbjct: 131 IDYIVINIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFG 190

Query: 173 YFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLY 232
           YF++ S F  F ++T SF I CSI+ L +KF    +RP RAGLF+ F  + +IP+ +G Y
Sbjct: 191 YFDRLSYFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFY 250

Query: 233 CYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIA 292
            + +  +  +I L +VLL  + YIIG +LYG R PE   PG FD++G SHQ+FH  VV+ 
Sbjct: 251 IFGYKGVMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLG 310

Query: 293 ALCHLRGLLNSYELVH 308
           ++CH   ++ SY L+H
Sbjct: 311 SICHFGAVIKSYCLMH 326

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  272 bits (696), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 142/310 (45%), Positives = 204/310 (65%), Gaps = 8/310 (2%)

Query: 2   STLLER-TKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           +TL +R +KSV E   R  G   A+  E  K++K+L   + ++E+PEWQ+DND IL GYV
Sbjct: 5   TTLRKRASKSVGESGGRNDGSIHAHGEE--KSEKLL---WHFNELPEWQKDNDKILRGYV 59

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGF--FTVLLLDKSTIKVFATTTWLDHMVI 118
           +ET+SF    +SL YL+NESVNIY+HLIPA+ +   ++ L +   I V+ +T+ +D+++I
Sbjct: 60  RETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVII 119

Query: 119 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFS 178
           ++F+ GAF CL+ SS FHC+K HS     + +KLDYLGI  LI  S V ++YYGYF+  S
Sbjct: 120 NVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHIS 179

Query: 179 LFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSE 238
            F +F  IT+   I CS+  L DKF   E+RP RA  F  FG S IIP+ +G   +    
Sbjct: 180 EFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEG 239

Query: 239 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLR 298
           +  +I L ++ L  + YI GA++YG RFPE I PGKFD +G SHQ+FH +VV+ ++CHL 
Sbjct: 240 VLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLF 299

Query: 299 GLLNSYELVH 308
            ++ SY L+H
Sbjct: 300 AMVESYHLIH 309

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  272 bits (695), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 202/309 (65%), Gaps = 4/309 (1%)

Query: 2   STLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVK 61
           +T     +SV      A+ K  A  ++ A  K+ L  L+++DE+PEWQ+DND IL GYV+
Sbjct: 5   TTRRRNQESVCCKATTASIKVEAVQSKTASEKEKL--LHNFDELPEWQKDNDKILTGYVR 62

Query: 62  ETSSFIETFKSLFYLHNESVNIYSHLIPALGFF--TVLLLDKSTIKVFATTTWLDHMVID 119
           ET S+ +  +SLFY +NE+VNIY+HL+PA+ +F   + L +   I VF +T+W D+ VI+
Sbjct: 63  ETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 120 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSL 179
           +F  GAF+CL+ SS FHCLK HS   +   +KLDYLGI  LI  SM+ I+Y+GYF+  S 
Sbjct: 123 IFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSY 182

Query: 180 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEI 239
           F LF  +T+     C++  L +KF    +RP+RA  F+ FG S ++P+ +G + +    +
Sbjct: 183 FSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 240 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRG 299
             +I++ +V    + YI GAV+YG R PE I PGKFD  G SHQ+FH +VV+ +LCHL+ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKA 302

Query: 300 LLNSYELVH 308
           +++SY+L+H
Sbjct: 303 IIDSYKLMH 311

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  272 bits (695), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 135/307 (43%), Positives = 203/307 (66%), Gaps = 6/307 (1%)

Query: 8   TKSVQELKKRAAGKTSAN-PAEVAKAKKVLRR---LYSWDEIPEWQRDNDFILHGYVKET 63
           T + +  ++    KTS +   E  K+K  LR+   L+ + E+P+WQRDND IL GYV+ET
Sbjct: 4   TATRRRNQENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRET 63

Query: 64  SSFIETFKSLFYLHNESVNIYSHLIPALGFFT--VLLLDKSTIKVFATTTWLDHMVIDLF 121
            S+ +   SLFY +NE+VNIY+HL+PA+ +F   V L +   I VF +TTW D+ VI++F
Sbjct: 64  LSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIF 123

Query: 122 YSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFC 181
             GAF CL+ SS FHC+K HS + +   +KLDYLGI  LI  SM+ I+Y+GYF+  S F 
Sbjct: 124 LMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFS 183

Query: 182 LFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWT 241
           LF ++T+     C+I  L DKF    +RP+RA  F+ FG S ++P+ +GL+ +    +  
Sbjct: 184 LFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLN 243

Query: 242 QIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLL 301
           +I++ +V    + YI GA++YG R PE + PGKFD +G SHQ+FH +VV+ ++CHL+ ++
Sbjct: 244 RIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAII 303

Query: 302 NSYELVH 308
           +SY+L+H
Sbjct: 304 DSYKLMH 310

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  271 bits (694), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 202/309 (65%), Gaps = 4/309 (1%)

Query: 2   STLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVK 61
           +T      SV     RA+ K  A   +    K+ L  L+++DE+PEWQ+DND IL GYV+
Sbjct: 5   TTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKL--LHNFDELPEWQKDNDKILTGYVR 62

Query: 62  ETSSFIETFKSLFYLHNESVNIYSHLIPALGFF--TVLLLDKSTIKVFATTTWLDHMVID 119
           ET S+ +   SLFY +NE+VNIY+HL+PA+ +F   + L +   I VF +T+W D+ VI+
Sbjct: 63  ETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 120 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSL 179
           +F  GAF+CL+ SS FHC+K HS + +   +KLDYLGI  LI  SM+ I+Y+GYF+  S 
Sbjct: 123 IFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISY 182

Query: 180 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEI 239
           F LF ++T+     C++  L DKF    +RP+RA  F+ FG S ++P+ +G + +    +
Sbjct: 183 FSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 240 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRG 299
             +I++ +V    + YI GAV+YG R PE + PGKFD +G SHQ+FH +VV+ ++CHL+ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKA 302

Query: 300 LLNSYELVH 308
           +++SY+L+H
Sbjct: 303 IIDSYKLMH 311

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  271 bits (694), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 188/274 (68%), Gaps = 2/274 (0%)

Query: 37  RRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTV 96
           ++LYS+ E+PEWQ+DN+ I+ GYV+ET+S+ + F SL Y HNES+NIY+HLIP L +F +
Sbjct: 43  KKLYSFHELPEWQKDNELIIQGYVRETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIM 102

Query: 97  LLL--DKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDY 154
           LL   D   +  F +TT +D++VID +  GAF CL+ SS FHCLK HS   +   +K+DY
Sbjct: 103 LLFYTDLLVVPSFPSTTIMDYIVIDFYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDY 162

Query: 155 LGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAG 214
           +GI  LI  S++S+LYYGYF+ F  F +F LIT+     C++  L ++F  + +RP RAG
Sbjct: 163 VGIICLISCSLISLLYYGYFDHFIYFKVFTLITLILATICTVCVLDERFNAKNFRPIRAG 222

Query: 215 LFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGK 274
            FV F  S++IPI +GL  + + E+  +IQL +V      Y++GA+LYG R PE   PG+
Sbjct: 223 FFVVFATSAVIPICTGLIKFDYVEVINRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGR 282

Query: 275 FDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308
           FD+ G SHQ+FH +VVI +L HL+ ++ SYE +H
Sbjct: 283 FDLVGSSHQIFHVMVVIGSLFHLKAVIGSYEFMH 316

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  271 bits (692), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 193/313 (61%), Gaps = 10/313 (3%)

Query: 3   TLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKE 62
           TL +R +     K +A    +  P +          L  ++E+P+WQRDND IL GYV+E
Sbjct: 6   TLRQRRQQCAPNKGKAGTSGATAPGK--------NGLCCFEELPDWQRDNDKILAGYVRE 57

Query: 63  TSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFATTTWLDHMVIDL 120
           T+S  + F+SL Y HNE+VNIY+HLIP+  +  +L+   D   I  F TTT  D+++I+ 
Sbjct: 58  TNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINF 117

Query: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180
           F  GAF CL+ S+ FHCLK HS   + + +K+DY+GI +LI  S VS+LYYG+++    F
Sbjct: 118 FLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHF 177

Query: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240
            +F +  V  G  C+   L D+F  + WR  RAG FV FG S I+PI  GL  +  +E  
Sbjct: 178 KMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESS 237

Query: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300
            ++QL +VLL  + YI GAV+YG R PE + PGKFD  GHSHQ+FH LVV+ +LCH R L
Sbjct: 238 KRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRAL 297

Query: 301 LNSYELVHIKMEN 313
           L SY  +H  + +
Sbjct: 298 LGSYFFMHTGISS 310

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  270 bits (691), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 199/309 (64%), Gaps = 12/309 (3%)

Query: 2   STLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVK 61
           +T+ +R  +VQE +K          A  +K   + ++LY ++E+PEWQ+DND IL GYV+
Sbjct: 5   TTIRQRKTTVQETQK----------ARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVR 54

Query: 62  ETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFATTTWLDHMVID 119
           ET S +    SL Y +NESVNIY+HL+ A+ +F +LL   D   I  F +TT  D+++I+
Sbjct: 55  ETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIIN 114

Query: 120 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSL 179
            +  GAF CL+ SS FHC K HS   +   +K+DY+GI  LI  S++S+LYYGYF+    
Sbjct: 115 FYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFY 174

Query: 180 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEI 239
           F LF++ITV   +ACS+  L D+F   + RP RA  F+ F  SS+IPI +G++ + ++E+
Sbjct: 175 FKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEV 234

Query: 240 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRG 299
           + ++QL +V      Y+ GA+LYG R PE I PGKFD  G SHQLFH LVV+ + CHLR 
Sbjct: 235 FHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRA 294

Query: 300 LLNSYELVH 308
           ++ SY  +H
Sbjct: 295 VMGSYMFMH 303

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  266 bits (680), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 138/314 (43%), Positives = 198/314 (63%), Gaps = 2/314 (0%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           MS +    +   +++  A G ++ +       +   RRL++++E+PEWQRDND IL GYV
Sbjct: 1   MSRVTTTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYV 60

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFT--VLLLDKSTIKVFATTTWLDHMVI 118
           +ET SF +  +SL Y +NE++NIY+HLIPAL + T  V L++   +  F TT+ +D+ VI
Sbjct: 61  RETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVI 120

Query: 119 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFS 178
           ++F  GAF CLILSS FHCLK HS R  TL +KLDY+GI ILI  S++ ++Y+GYF+   
Sbjct: 121 NVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLY 180

Query: 179 LFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSE 238
               F ++T SF   CSI  L +KF    +RP+RA +F+ F  S  IPI +G Y + F  
Sbjct: 181 YVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHG 240

Query: 239 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLR 298
           ++ ++ L +V    + YI GA LYG R PE   PG FD  G SHQ+FH LVV+ ++CH R
Sbjct: 241 VFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFR 300

Query: 299 GLLNSYELVHIKME 312
            ++ SY L+H  M 
Sbjct: 301 AVIKSYILMHSSMN 314

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  266 bits (679), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 193/290 (66%), Gaps = 4/290 (1%)

Query: 21  KTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNES 80
           K  A  +     KK L  L+++DE+PEWQ+DND IL GYV+ET S+ +   SLFY +NE+
Sbjct: 24  KVEAVSSTTVSEKKKL--LHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNET 81

Query: 81  VNIYSHLIPALGFF--TVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCL 138
           VNIY+HL+PA+ +F   + L +   I VF +T+W D+ VI++F  GAF+CL+ SS FHC+
Sbjct: 82  VNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCM 141

Query: 139 KSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVS 198
           K HS + +   +KLDYLGI  LI  SM+ I+Y+GYF+  S F LF ++T+     C++  
Sbjct: 142 KQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCV 201

Query: 199 LKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIG 258
           L +KF    +RP+RA  F+ FG S ++P+ +G + +    +  +I++ +V    + YI G
Sbjct: 202 LHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISG 261

Query: 259 AVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308
           AV+YG R PE + PGKFD  G SHQ+FH +VV+ ++CHL+ ++ SY+L+H
Sbjct: 262 AVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMH 311

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  265 bits (678), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 128/308 (41%), Positives = 198/308 (64%), Gaps = 3/308 (0%)

Query: 10  SVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIET 69
           S+ E+K+R     + N   + K     + LY + E+PEWQ+DND IL GY++ET S ++ 
Sbjct: 3   SITEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKC 62

Query: 70  FKSLFYLHNESVNIYSHLIPALGFFTVLL--LDKSTIKVFATTTWLDHMVIDLFYSGAFA 127
            +SLF  +NE+VNIY+HL+ A+ +F ++L   D   +  F T+T+ D+ VI+ +  GAF 
Sbjct: 63  VRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFG 122

Query: 128 CLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALIT 187
           CL+ SS FH  K HS   +   +K+DY+GI +LI  SM+S++YYG+F+    F LF ++T
Sbjct: 123 CLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLT 182

Query: 188 VSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFW 247
           ++   AC++  L DKF  +++RP RAG F+ FGLS + P+ +G+  +       ++QL +
Sbjct: 183 LTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKY 242

Query: 248 VLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELV 307
           + L  + YI GA++YG R PE + PG+FD WGHSHQ+FH LVVIA+  HL+ ++ SY   
Sbjct: 243 LGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFK 302

Query: 308 HIKMENGI 315
           H  + NG+
Sbjct: 303 HSHL-NGV 309

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  263 bits (671), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 188/300 (62%), Gaps = 8/300 (2%)

Query: 7   RTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSF 66
           + +++ E+ +  A  TS         KK +R+LY++DE+P WQ+DN+ IL GYV+ET+S 
Sbjct: 8   KEQTISEMAQEMAHTTSEG------LKKRIRKLYTFDELPAWQKDNELILSGYVRETNSV 61

Query: 67  IETFKSLFYLHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFATTTWLDHMVIDLFYSG 124
            E  +++ Y +NES+NIY+HLIP + +  + L+  D    ++       +H ++  +  G
Sbjct: 62  KECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLG 121

Query: 125 AFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFA 184
           AF CL  SS FHCLK HS   + L +K+DYLGI   I  S +S+LYYGY    S F  F+
Sbjct: 122 AFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFS 181

Query: 185 LITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQ 244
            +TV+   AC+++ L D F    +RP RA LF+ FGLS +IP+ +G Y + F+E   +IQ
Sbjct: 182 TLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQ 241

Query: 245 LFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSY 304
           L +VL   V YI GA++YG R PE+  PGKFD+ GHSHQ+FH LVV+  LCH R +  SY
Sbjct: 242 LKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  260 bits (665), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 191/299 (63%), Gaps = 6/299 (2%)

Query: 15  KKRAAGKTSANPAEVAKAKKVLRR--LYSWDEIPEWQRDNDFILHGYVKETSSFIETFKS 72
           ++R+A K      + +K+ +  ++  L  ++E+PEWQRDN+ IL GYV+ET S  +  +S
Sbjct: 9   QRRSACKNELKNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLES 68

Query: 73  LFYLHNESVNIYSHLIPALGFFTVLLL---DKSTIKVFATTTWLDHMVIDLFYSGAFACL 129
           L Y HNE++NIY+HLIP+ G + VLL+   D   I  F +TT  D+++I+ +  GAF CL
Sbjct: 69  LTYFHNETLNIYTHLIPS-GTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCL 127

Query: 130 ILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVS 189
           + S+ FHCLK HS   + + +K+DY+GI +LI  S VS+LYYG+ +    F +F +  V 
Sbjct: 128 LCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVV 187

Query: 190 FGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVL 249
            G  C+   L D+F  + WR  RAG FV FG S I+PI  GL  +  +E   ++QL +VL
Sbjct: 188 LGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVL 247

Query: 250 LGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308
           L    YI GA++YG R PE + PGKFD  GHSHQ+FH LVV+ +LCH R L+ SY  +H
Sbjct: 248 LEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMH 306

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  260 bits (664), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 129/318 (40%), Positives = 200/318 (62%), Gaps = 4/318 (1%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLR--RLYSWDEIPEWQRDNDFILHG 58
           M+ +    +    + KR   K++     +   ++     +L  + E+P+WQ+DN+FIL G
Sbjct: 1   MAHIATVEREYSSVSKRRTSKSANGTVTIEVEREEHEEIKLCHFHELPDWQKDNEFILTG 60

Query: 59  YVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFATTTWLDHM 116
           YV+ET+S  +  +SL   +NES+NIYSHLI A+ +F VLL   D   I  F +TT++D+M
Sbjct: 61  YVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYM 120

Query: 117 VIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEK 176
           VIDL+  GAF CLI SS FHC+K HS   + + +K+DY+GI  LI  S++S+LYYGY + 
Sbjct: 121 VIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDH 180

Query: 177 FSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSF 236
           F  F +F +IT+     C+I  L  +F  + +RP RAG F+ F +S++IPI +G   + F
Sbjct: 181 FIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGF 240

Query: 237 SEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCH 296
           +E+  +IQL +V      Y++GA+LYG R PE + PG FD+ G SHQ+FH +V++ ++ H
Sbjct: 241 TEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFH 300

Query: 297 LRGLLNSYELVHIKMENG 314
           L+ +L SY  +H  + + 
Sbjct: 301 LKAVLGSYTFMHSNISSN 318

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  255 bits (652), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 126/288 (43%), Positives = 186/288 (64%), Gaps = 4/288 (1%)

Query: 21  KTSA--NPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHN 78
           KTS           K   RRLYS+DE+PEWQ+DN+ I  GYV+ET+SF+E  KS+ Y +N
Sbjct: 2   KTSGFVESRRCGHKKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNN 61

Query: 79  ESVNIYSHLIPALGFF--TVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFH 136
           ESVNIY+HL+P++ +F   +L +D     +F  TT  ++++ID +  G F CL+ S+ FH
Sbjct: 62  ESVNIYTHLVPSVTYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFH 121

Query: 137 CLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSI 196
           CLK HS     + +K+DY+GI + I +S+VSILYYG+++  S     +++T++ G+ C  
Sbjct: 122 CLKQHSESHNRIWSKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVT 181

Query: 197 VSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYI 256
             L D+F   ++R  RA  F  FG S ++P+  G+Y +   E   +IQL +VL G + YI
Sbjct: 182 FVLNDRFNAIDYRLLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYI 241

Query: 257 IGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSY 304
            GA++YG R PE + PGKFD  GHSHQ+FH LVV+ ++CH R ++ SY
Sbjct: 242 FGALIYGFRIPEALAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  254 bits (650), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 129/311 (41%), Positives = 192/311 (61%), Gaps = 5/311 (1%)

Query: 5   LERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETS 64
           +  T +++  +  +       P  ++     ++RLY + E+PEWQ+DND I+ GY++ET 
Sbjct: 1   MSATTTIRHRRSISEKLEQLTPVAISST---IKRLYRYSELPEWQQDNDKIITGYIRETK 57

Query: 65  SFIETFKSLFYLHNESVNIYSHLIPALGFFTVL--LLDKSTIKVFATTTWLDHMVIDLFY 122
           S  E  KSLF  HNES+NIYSHL+P + +  +L  L D   +  F  +T +  ++I  F 
Sbjct: 58  SVKECVKSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFL 117

Query: 123 SGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCL 182
            G+  CL  SS FHCLK HS     + +K+DY+GI I+I  S++S+LYYG+ +    F  
Sbjct: 118 LGSVLCLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKC 177

Query: 183 FALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQ 242
           F + TV  G  C++ +L DKF  + +RP+RA  +V FGLS I+PI +G + +   E   +
Sbjct: 178 FTVFTVILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRR 237

Query: 243 IQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLN 302
           +QL +VLL  + YI GAV+YG RFPE + PGKFD  GHSHQ+FH +VV+ ++CH R +L 
Sbjct: 238 VQLKYVLLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILG 297

Query: 303 SYELVHIKMEN 313
           SY  +H  M +
Sbjct: 298 SYVFMHTGMHH 308

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  248 bits (633), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 192/309 (62%), Gaps = 11/309 (3%)

Query: 6   ERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSS 65
           +R+KS +  K       S +  ++ K     R LY + E+P WQ+DND IL GYV+ET+S
Sbjct: 11  KRSKSFRSAKSTITRTRSDSSIKIEK-----RILYHFHELPTWQQDNDKILGGYVRETNS 65

Query: 66  FIETFKSLFYLHNESVNIYSHLIPALGFFTV---LLLDKS---TIKVFATTTWLDHMVID 119
           F +  +SLFYL+NES+NIYSHLIP+L + T+   LL++      I ++ TTT  D + I+
Sbjct: 66  FTKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFIN 125

Query: 120 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSL 179
           +F  GAF CL+ S  FH LK HS       +++DY+GI +LI  SM+ +LYYG+F+   L
Sbjct: 126 IFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVL 185

Query: 180 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEI 239
           F  F  +T++F   CSI+ + + F   ++R  RA +F  FG S +IP+  G   +  S +
Sbjct: 186 FYCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGV 245

Query: 240 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRG 299
           + +I L ++    V Y++GA LYG R PE I PGKFD++G SHQLFH  VVI ++ H + 
Sbjct: 246 FQRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKA 305

Query: 300 LLNSYELVH 308
           ++ SY L+H
Sbjct: 306 VIESYILMH 314

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  246 bits (627), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 189/310 (60%), Gaps = 19/310 (6%)

Query: 6   ERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSS 65
            R+KS+  +  +AA        E  K K     LY+++E+P WQ+DN+ IL GY++ET+S
Sbjct: 18  HRSKSISSILSQAA--------EDVKQKITDTLLYTYEELPSWQQDNEMILTGYIRETNS 69

Query: 66  FIETFKSLFYLHNESVNIYSHLIPA-------LGFFTVLLLDKSTIKVFATTTWLDHMVI 118
           +    +SL + HNE++NIYSH I A       + FFT L+   S    F TTT  D++V+
Sbjct: 70  WKLCLRSLTFFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPS----FPTTTLHDYLVL 125

Query: 119 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFS 178
           D++  GA  CL LSS FHCLK HS   + + +K+DY+GI  LI  S +S+LY+GY + F+
Sbjct: 126 DIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFN 185

Query: 179 LFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSE 238
            F  FA+ T    I C++    +KF  R+W+  RA  F+ F  S +IP+ +G+  + F E
Sbjct: 186 YFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPE 245

Query: 239 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLR 298
           +W ++QL  + L  + Y+IGA+LYG R PE   PGKFD  G+SHQ FH  VV+ +L HLR
Sbjct: 246 VWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLR 305

Query: 299 GLLNSYELVH 308
            L+ SY  +H
Sbjct: 306 ALVGSYYFMH 315

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  233 bits (593), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 187/317 (58%), Gaps = 20/317 (6%)

Query: 12  QELKKRAA--GKTSANPAEVAKAKK---------------VLRRLYSWDEIPEWQRDNDF 54
            EL+KRA   G+T+   A V++  +                  RL  ++E+P WQ+DND 
Sbjct: 3   SELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDNDC 62

Query: 55  ILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFT--VLLLDKSTIKVFATTTW 112
           I  GYV+ET S      SL Y +NESVN+YSHL+PA+ +     L L +  +  F TTTW
Sbjct: 63  IRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTTTW 122

Query: 113 LDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYG 172
            D+++I+ F  GA ACL+ SS FHCLK HS R     +++DY+GI +LI  S + ++Y+G
Sbjct: 123 SDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIYFG 182

Query: 173 YFEKFSLFCLFALITVSFGIACSIVSLKDK-FRKREWRPYRAGLFVCFGLSSIIPIFSGL 231
           YF+      LF  +TV+ G+ACS V L +K F    ++  RA  F+ F  + +IP+ +G 
Sbjct: 183 YFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMATGF 242

Query: 232 YCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVI 291
             +    +  +I L +V    V YI GA+LYG R PE   PGK D+WG+SHQ+FH +VV 
Sbjct: 243 VKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMVVF 302

Query: 292 AALCHLRGLLNSYELVH 308
            +LCHL+ +L SY L+H
Sbjct: 303 GSLCHLKAVLESYSLMH 319

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  152 bits (383), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/284 (30%), Positives = 147/284 (51%), Gaps = 28/284 (9%)

Query: 38  RLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVL 97
           +L +++++P+WQ+DN  I++ YV+ET+S  ++  S+F  H+ES+NI++HLIPAL      
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPAL------ 60

Query: 98  LLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 157
           L  K T     T   + + ++  +      C +LSS FH  K  S++      KLDY+GI
Sbjct: 61  LYAKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 158 CILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREW--------- 208
            +LI  ++VS+   G+ E          +T +  +   ++ L  K   ++          
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 209 ------------RPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYI 256
                       +  RA LF   GLS +IP+ +GLY Y    ++ +I +  V+   + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 257 IGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300
           +G ++Y  + PEK  PG+FD+ G SHQLFH  +V   +CH   +
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  124 bits (312), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/318 (29%), Positives = 163/318 (51%), Gaps = 15/318 (4%)

Query: 1   MSTLLERTK-----SVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRD--ND 53
           M+TL   TK      +Q+  K              +  KVL  L    E+P+WQ+   N 
Sbjct: 1   MATLTSTTKKQTATEIQDADKLTPFNAPKYSVTFPRRPKVLPIL---KELPQWQKQYSNS 57

Query: 54  FILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFATTT 111
            I++GYV+ET+S I+   ++ Y +N++VNI  + + +  +FT+LL   D   I     TT
Sbjct: 58  KIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATT 117

Query: 112 WLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYY 171
             D+++++ +  GAF    L+S F+ L+SHSL    L  KL +L     I TS+++ LYY
Sbjct: 118 MSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYY 177

Query: 172 GYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLS-SIIPIFSG 230
            +F+    F    + T+      +I +L ++F ++  R  R  + + F +S  I+P  S 
Sbjct: 178 TFFDNVFYFKFLTISTLLISSIFAIFTLSEQFLRKN-RSQRNMVSITFIVSLLILPTASL 236

Query: 231 LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVV 290
           ++ ++   I  +++   +LL   LY+    L  ++ PE+     FD  G+S  ++H  ++
Sbjct: 237 MFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDFIGNSENIYHICII 295

Query: 291 IAALCHLRGLLNSYELVH 308
           + +L H + LLNSY  +H
Sbjct: 296 LGSLLHFKMLLNSYFFMH 313

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  117 bits (293), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 147/283 (51%), Gaps = 9/283 (3%)

Query: 32  AKKVLRRLYSWDEIPEWQR--DNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIP 89
           +K   R  Y   E+PEWQR  ++  ++ G++KET+SF +   S  Y HN S+NI  + I 
Sbjct: 26  SKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIA 85

Query: 90  ALGFFTVLLL--DKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIAT 147
           A  +F +L    D   I  F +TT  D++V++L+   A    ++ + F+ +KSHS + A 
Sbjct: 86  ATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAF 145

Query: 148 LGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSF--GIACSIVSLKDKFRK 205
           L  KL+ +G+   I +S+V++LYY YF+    F  F ++T+       CSI+S  D F K
Sbjct: 146 LWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIIS--DSFNK 203

Query: 206 REWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMR 265
                    L     L +++P    +  +  +++  +I L  ++L   +Y  G  +   +
Sbjct: 204 MTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQ 263

Query: 266 FPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308
            PE+     FD  G+S  ++   +++ +  H + L+NSY L+H
Sbjct: 264 LPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMH 305

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 142/295 (48%), Gaps = 24/295 (8%)

Query: 31  KAKKVLRRLYSWDEIPEWQR--DNDFILHGYVKET-SSFIETFKSLFYLHNESVNIYSHL 87
           + K V  ++ + +++P W R   N  I  GY   T ++++   + L   +N+S++IY +L
Sbjct: 2   EKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNL 61

Query: 88  IPAL--GFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGA---FACLILSSSFHCLKSHS 142
           +  L  G   +   D   I    +TT  D+++I+LF       FA + L      LK HS
Sbjct: 62  VCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLG---QLLKGHS 118

Query: 143 LRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDK 202
                L N+   L + +L+  S+V++LYY +F+   LF LF + T       SIV + D+
Sbjct: 119 EYQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQ 178

Query: 203 FRKREWRPYRAGLFVCFGLSSI-IPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGA 259
           +++ +    +    V FG+ SI +PI   +  +   + + + ++ + +L    VLY + A
Sbjct: 179 YKRVQ----KLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSA 234

Query: 260 VLYGMRFPEKICPGK------FDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308
           +L   R PE             D  G+S Q+   + + A + H   ++ +YE+VH
Sbjct: 235 MLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 85/312 (27%), Positives = 145/312 (46%), Gaps = 39/312 (12%)

Query: 9   KSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIE 68
           K+  E    A G  ++N A+V    K  ++ + + ++ +WQ+          K  SS  E
Sbjct: 15  KTATEKYSDATGAVTSN-ADVET--KETKKGFPFHDLAKWQKQ--------YKNKSSRSE 63

Query: 69  TFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWL-DHMVIDLFYSGAFA 127
           +  +L YL   S++ +  LI    FFT    D   I +F TTT + D++V + +    F 
Sbjct: 64  SLVALIYLLG-SMSSFCLLI----FFT----DFYLIPLFPTTTTMTDYIVFNFYLLNVFV 114

Query: 128 CLILSSSFHCLKSHSLRI-ATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALI 186
             ++   +H +K+ SL+    +  K  YL    L+++S ++ILYY +++    F +F L+
Sbjct: 115 FCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLL 174

Query: 187 TVSFGIACSIVSLKDKFRKREWRPYRAGLF------VCFGLSSIIPI--FSGLYCYSFSE 238
               G+A   V L DK     ++ +   +F      VC  L  +  I  F GL       
Sbjct: 175 MTFIGLAAYFVILTDKL--NSYKRFNKTVFFISVSVVCCSLPLLTAIITFDGL-----EN 227

Query: 239 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKIC--PGKFDIWGHSHQLFHFLVVIAALCH 296
           +  +I+L  +    V  ++ +++Y  RFPE +C    K + W HS   FH L+   A  H
Sbjct: 228 LKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYH 287

Query: 297 LRGLLNSYELVH 308
              L+ SY L+H
Sbjct: 288 FFILIQSYILMH 299

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 135/305 (44%), Gaps = 49/305 (16%)

Query: 38  RLYSWD--------------EIPEWQRDNDFILHGYVKETSSFIETFKSL---FYLHNES 80
           + Y+WD              E+P   R+N +I+HGY +   S +++  S+   +  HNE+
Sbjct: 283 QFYNWDNACDLGRQRHLHFYELPFPWRENRYIIHGY-RFYDSHVKSVLSVVNWYGWHNET 341

Query: 81  VNIYSHLIPALGFFTVLLLDKSTIKVFATTT--WLDHMVIDLFYSGAFACLILSSSFHCL 138
           +NI+SHL  A+    +L +   T KVF +        ++I +F      CL+ SS +H L
Sbjct: 342 LNIWSHLFGAVYLAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTL 401

Query: 139 KSH-SLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSL-----FCLFALITVSFGI 192
                L +      +DY GI +LI  S++S  +   +   +        ++  +++  GI
Sbjct: 402 NGTCCLPLRCKFACIDYTGITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGI 461

Query: 193 ACSIVSLKDKFRKREWRPYRAGLFVCF-GLSSI----IPIFSGLYCYS--FSEIWTQIQL 245
             S ++   +F + E RP+R   +V   GL  I    + I  G+   S  F  +W +  L
Sbjct: 462 FGSFMNWSPRFDRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWNR-SL 520

Query: 246 FWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYE 305
            W       Y+IG V YG   PE+        W    +L + +   A LC    +L  ++
Sbjct: 521 IW-------YLIGVVFYGSFIPER--------WRTDVELDYTIPTDAELCSNLDILTKHK 565

Query: 306 LVHIK 310
            VH +
Sbjct: 566 HVHFR 570

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 136/329 (41%), Gaps = 64/329 (19%)

Query: 30  AKAKKVLRRLYSWDEIPEWQRDNDFILHG---YVKETSSFIETFKSLFYLHNESVNIYSH 86
           ++A+ + R L+ W E+P   R+N +I++G   Y     S +    + +  HNE++NI+SH
Sbjct: 96  SRARGLARHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNA-YGWHNETINIWSH 153

Query: 87  LIPA--LGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSH-SL 143
           L+ A  L +       +S +   A    L    I  F +    C+  S ++H       L
Sbjct: 154 LVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHL 213

Query: 144 RIATLGNKLDYLGICILIVTSMVS---ILYYGYFEKFSLFCLFALITVSFGIACSIVSLK 200
           ++ +    +DY GI +L+  S+V+   +  YG      L   + + ++  G A  +++  
Sbjct: 214 KLRSRFVCVDYTGITLLVTASVVTTVAVTLYGLSRP--LMYAYMVASIGLGTAAGVMNWS 271

Query: 201 DKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGG-------V 253
             F + E RP R  ++V  GL+++     GL   SF  +W Q++     L         V
Sbjct: 272 PHFDRPEARPLRIAVYV--GLAAL-----GL--VSFVHVWMQVRWASAHLMAPLVYKSLV 322

Query: 254 LYIIGAVLYGMRFPEK--------ICPGK---------------------------FDIW 278
            Y IG V Y    PE+         C G                             D +
Sbjct: 323 WYGIGVVFYATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYF 382

Query: 279 GHSHQLFHFLVVIAALCHLRGLLNSYELV 307
            HSH L+H  VV+  + H R +L    +V
Sbjct: 383 CHSHFLWHVFVVLGVVGHYRAVLQMSRIV 411

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 113/233 (48%), Gaps = 10/233 (4%)

Query: 44  EIPEWQRDNDFILHGY--VKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDK 101
           ++P   R+N +I+HGY      S  + +  + +  HNE+ NI+SHL+ A+    + + D 
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDF 278

Query: 102 STIKVFATTTWLDHM--VIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGIC 158
              +V+           ++ +F + A  C++ S  +H     S LR+ +    +DY GI 
Sbjct: 279 PQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGIT 338

Query: 159 ILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 218
           ILI  S+++  +   +  +   C +  I+++ G+    ++   +F + E RP R   F+ 
Sbjct: 339 ILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI- 397

Query: 219 FGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEK 269
             L + + + S L+    ++I+   +LF  +     V Y++G V YG   PE+
Sbjct: 398 --LLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSVVWYLVGVVFYGSFIPER 448

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 109/238 (45%), Gaps = 20/238 (8%)

Query: 44  EIPEWQRDNDFILHGYVKETSSFIETFKSLFYL---HNESVNIYSHLIPALGFFTVLLLD 100
           ++P   R+N +I++ Y +   S  ++  S+F     HNES NI++HL+ A+    + + D
Sbjct: 254 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 101 KSTIKVFAT--TTWLDHMVIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGI 157
               ++F +        +++ LF   A  CL+ S  +H     S L++ +    +DY GI
Sbjct: 313 FPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYSGI 372

Query: 158 CILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 217
            ILI  S+++  +   +  F   C++  I++S G+    ++   KF + E RP R   F+
Sbjct: 373 TILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKFFI 432

Query: 218 CFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVL------YIIGAVLYGMRFPEK 269
                 ++      Y        T +Q    LL  V       Y++G V YG   PE+
Sbjct: 433 LLASMGVLSFLHLTYL-------TNLQYATWLLTPVTNKSIVWYLVGVVFYGSFIPER 483

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 67.8 bits (164), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/316 (21%), Positives = 140/316 (44%), Gaps = 28/316 (8%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           ++T+ +     +   ++  G      + V    K +++ + + ++ +WQ+        Y 
Sbjct: 4   LTTVEQSPAKCKTTTEKGNGTGETTNSNVDAETKEIKKGFPFHDLAKWQQQ-------YR 56

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFATTTWL-DHMV 117
            ++S             NES+    +L+ ++  F +L+   D   I +F TTT + D++V
Sbjct: 57  NKSS------------RNESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIV 104

Query: 118 IDLFYSGAFACLILSSSFHCLKSHSLRIATLG-NKLDYLGICILIVTSMVSILYYGYFEK 176
            + +    F   ++   +H +K+ SL+       K  YL    L+++S ++ILYY +++ 
Sbjct: 105 FNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 177 FSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSI-IPIFSGLYCYS 235
              F +F L+    G+      L DK    + R  +   F+   +    +P+ + +  + 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFD 223

Query: 236 -FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKIC--PGKFDIWGHSHQLFHFLVVIA 292
               +  +I++  +    V  +  +++Y  RFPE +     K + W HS  LFH ++   
Sbjct: 224 GLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGT 283

Query: 293 ALCHLRGLLNSYELVH 308
           A  H   L+ SY L+H
Sbjct: 284 AFYHFFILIQSYILMH 299

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 115/238 (48%), Gaps = 20/238 (8%)

Query: 44  EIPEWQRDNDFILHGYV---KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLD 100
           ++P   R+N +I+HGY      + S +  F + +  HNE+ NI+SHL+ A+    + + D
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIF-NWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 101 --KSTI----KVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLD 153
             +S +    KV     W    ++ +F + A  C++ S  +H     S L++ +    +D
Sbjct: 278 FPQSEVWKNPKVPPQARW----IVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVD 333

Query: 154 YLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 213
           Y GI ILI  S+++  +   +  +   C +  I+++ GI    ++   +F + E RP R 
Sbjct: 334 YSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRI 393

Query: 214 GLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEK 269
             F+   L + + + S L+    +++    +LF  +     V Y++G   YG   PE+
Sbjct: 394 RFFI---LLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVVWYLVGVAFYGSFIPER 448

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 138/316 (43%), Gaps = 28/316 (8%)

Query: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60
           ++T+ +         ++    T+   + V    K  ++ + + ++ +WQ           
Sbjct: 4   LTTVEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQ--------Y 55

Query: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFATTTWL-DHMV 117
           K  SS            NESV    +L+ ++  F +L+   D   I +F TTT + D++V
Sbjct: 56  KNKSS-----------RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIV 104

Query: 118 IDLFYSGAFACLILSSSFHCLKSHSLRIATLG-NKLDYLGICILIVTSMVSILYYGYFEK 176
            + +    F   ++   +H +K+ SL+       K  YL    L+++S ++ILYY +++ 
Sbjct: 105 FNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 177 FSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFG-LSSIIPIFSGLYCYS 235
              F +F L+    G+      L DK    + R  +   F+    +   +P+ + +  + 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFD 223

Query: 236 -FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPG--KFDIWGHSHQLFHFLVVIA 292
               +  +I++  +    V  +  +++Y  RFPE    G  K + W HS  LFH ++  A
Sbjct: 224 GLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGA 283

Query: 293 ALCHLRGLLNSYELVH 308
           A  H   L+ SY L+H
Sbjct: 284 AFYHFFILIQSYILMH 299

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 106/231 (45%), Gaps = 8/231 (3%)

Query: 44  EIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLD--K 101
           ++P   R+N +I++ Y +   S  ++  S+F LHNE+ NI+SHL+ A+ F  VL  D   
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 102 STIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGICIL 160
           S I   +       + + LF   +  C++ S+ +H     S L++      +DY GI IL
Sbjct: 256 SIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISIL 315

Query: 161 IVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFG 220
           I +S++SI +   ++  ++   +   +   G+    ++    F   E RP R   F+   
Sbjct: 316 ITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILLS 375

Query: 221 LSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMRFPEK 269
                 +   ++      I+  I +   L     V Y++G V YG   PE+
Sbjct: 376 SCGAFALLHLVFLE--KSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 112/238 (47%), Gaps = 20/238 (8%)

Query: 44  EIPEWQRDNDFILHGYVKETSSFIET-FKSLFYL------HNESVNIYSHLIPALGFFTV 96
           ++P   R+N +I+HGY      F  T +KSL  +      HNE+ NI++HL+ A+    +
Sbjct: 219 QLPFPWRENRYIIHGY-----RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYL 273

Query: 97  LLLDKSTIKVFATTTWLDHM--VIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLD 153
            + D    +V+           ++  F + A  C++ S  +H     S L + +    +D
Sbjct: 274 AVYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVD 333

Query: 154 YLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 213
           Y GI ILI  S+++  +   +  +   C +  I+++ G+    ++   +F + E RP R 
Sbjct: 334 YSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRI 393

Query: 214 GLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMRFPEK 269
             F+   L + + + S L+    +++   I LF  +     V Y++G V YG   PE+
Sbjct: 394 RFFI---LLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPER 448

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 110/246 (44%), Gaps = 35/246 (14%)

Query: 44  EIPEWQRDNDFILHGYVKETSSFIETFKSLFY---LHNESVNIYSHLIPALGFFTVLLLD 100
           E+P   R+N +I+HGY +    F +   S+F    +HNE+ NI++H++ A     +L +D
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 101 -------KSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLK-SHSLRIATLGNKL 152
                    T  V ATT +    +I +F      C+  S  +H    + S+R+      +
Sbjct: 307 FQKTFIVLDTEHVPATTKY----IIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCV 362

Query: 153 DYLGICILIVTSMVSILY---YGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWR 209
           DY GI +LI  S++S  Y   Y Y +  S + + + I   FG+    ++   KF   E R
Sbjct: 363 DYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGL---YLNWSPKFDSPEAR 419

Query: 210 PYRAGLFVCF----GLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGAVLYG 263
           P R   FV      GLS     F  L C     +   I LF  +     + YIIG   YG
Sbjct: 420 PLRIKFFVLLAAVGGLS-----FVNLVC--LEGLSRAIWLFSPVTNKSVIYYIIGVFFYG 472

Query: 264 MRFPEK 269
              PE+
Sbjct: 473 SFIPER 478

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 125/276 (45%), Gaps = 29/276 (10%)

Query: 8   TKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFI 67
           TK  +E+K            E+ K + +     ++ ++P   R+N +I++ Y +   S  
Sbjct: 189 TKPSEEVKNLICSYNHEVAYEIGKTEHL-----NYYQLPFPWRENRYIIYNY-RFYDSHK 242

Query: 68  ETFKSLFYL---HNESVNIYSHLIPALGFFTVLLLDKSTIKVF-----ATTTWLDHMVID 119
           ++  S+F     HNE+ NI++HLI  L    + + D    ++F      TT     +++ 
Sbjct: 243 KSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYDFPRSEIFLSDKIPTTA---KLIVY 299

Query: 120 LFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFS 178
           LF   A  CL  S  +H      +L++ +    +DY GI ILI  S+++  +   +  + 
Sbjct: 300 LFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGISILITASILTTEFVTLYSSYR 359

Query: 179 LFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSE 238
             C++  I++S GI    ++   KF + E RP R   FV   L + + + S L+  +F  
Sbjct: 360 AMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFV---LLASMGVLSFLHL-TFLT 415

Query: 239 IWTQIQLFWVLL-----GGVLYIIGAVLYGMRFPEK 269
            W      W+L        V Y IG V YG   PE+
Sbjct: 416 DWKYAT--WLLAPVTNKSIVWYCIGVVFYGSFIPER 449

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 108/243 (44%), Gaps = 16/243 (6%)

Query: 37  RRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYL--HNESVNIYSHLIPALGFF 94
            +L  + E+P   R+N +I+H Y    S+      ++ +   HNE+ NI+SH    LGFF
Sbjct: 214 EKLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHF---LGFF 270

Query: 95  TVLLL-----DKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHS-LRIATL 148
            V+ L      +S +            V+ +F   A  CLI S+ +H     + L++   
Sbjct: 271 YVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRR 330

Query: 149 GNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREW 208
              +DY GI ILI  S+++  +    +   +  L+  I+++ GI    ++   +F   E 
Sbjct: 331 FACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPEA 390

Query: 209 RPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMRF 266
           RP R   F+      ++   +  Y  S++     + L   +     V Y++G V YG   
Sbjct: 391 RPLRIRFFMLLAAMGVLSFINASYLESWA---YAVDLLSPITNKSIVWYLVGVVFYGSFI 447

Query: 267 PEK 269
           PE+
Sbjct: 448 PER 450

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/319 (21%), Positives = 131/319 (41%), Gaps = 64/319 (20%)

Query: 44  EIPEWQRDNDFILHGYV---KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLD 100
           ++P   R+N +I+HGY      + S +  F + +  HNE+ NI+SHL+ A+    + + D
Sbjct: 220 QLPFPWRENRYIIHGYRFYNTHSKSLLSIF-NWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 101 KSTIKVFATTTWLDHM--VIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGI 157
               +V+  +        ++ +F + A  C++ S  +H     S L++ +    +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 158 CILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 217
            ILI  S+++  +   +  +     +  I+++ G+    ++   +F + E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 218 CFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEKI----- 270
              L + + + S L+    +++     LF  +     V Y++G V YG   PE+      
Sbjct: 399 ---LLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPERFRSDVQ 455

Query: 271 --------------------------------------CPGK---------FDIWGHSHQ 283
                                                 CP            D +G SH 
Sbjct: 456 VDKTIPTNYELSTDLEIITKQREIHFREVPTAHSKCSSCPSHAKSFKSLWWVDYFGCSHT 515

Query: 284 LFHFLVVIAALCHLRGLLN 302
            +HF VV+  + H R +L+
Sbjct: 516 FWHFFVVLGVIGHYRAILD 534

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 113/239 (47%), Gaps = 9/239 (3%)

Query: 78  NESVNIYSHLIPALGFFTVLLL--DKSTIKVFATTTWL-DHMVIDLFYSGAFACLILSSS 134
           NES+    +L+ ++  F +L+   D   I +F TTT + D++V + +    F   ++   
Sbjct: 62  NESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 135 FHCLKSHSLRIATLG-NKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIA 193
           +H +K+ SL+       K  YL    L+++S ++ILYY +++    F +F L+    G+ 
Sbjct: 122 YHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 194 CSIVSLKDKFRKREWRPYRAGLFVCFGLSSI-IPIFSGLYCYS-FSEIWTQIQLFWVLLG 251
                L DK    + R  +   F+   +    +P+ + +  +     +  +I++  +   
Sbjct: 182 AYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWE 240

Query: 252 GVLYIIGAVLYGMRFPEKIC--PGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308
            V  +  +++Y  RFPE +     K + W HS  LFH L+   A  H   L+ SY L+H
Sbjct: 241 LVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMH 299

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 104/237 (43%), Gaps = 18/237 (7%)

Query: 44  EIPEWQRDNDFILHGY--VKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLD- 100
           ++P   R+N +I++GY    + S  + +  + +  HNE+ NI+SHL+ A+ F  ++L + 
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 101 -KSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGIC 158
            KS I            ++ LF      C++ S  +H      S+++      +DY GI 
Sbjct: 315 PKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGIT 374

Query: 159 ILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 218
           ILI  S+++  +   ++  S+  ++  +++ FG     ++   KF   E RP R   F+ 
Sbjct: 375 ILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFIL 434

Query: 219 FGLSSIIPIFSGLYCYSFS-EIW-----TQIQLFWVLLGGVLYIIGAVLYGMRFPEK 269
                 +  F   Y    +   W     T   + W       Y+IG   YG   PE+
Sbjct: 435 LAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVW-------YLIGVFFYGSFIPER 484

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 109/252 (43%), Gaps = 18/252 (7%)

Query: 33  KKVLRRLYSWDEIPEWQRDNDFILHGYV---KETSSFIETFKSLFYLHNESVNIYSHLIP 89
           K  L R   + E+P   R+N FI+HGY      T S +    + +  HNE+ NI++HL  
Sbjct: 225 KTGLSRHLHYYELPFPWRENRFIIHGYRFYHSHTKSLLSIL-NWYGWHNETTNIWTHLFG 283

Query: 90  AL--GFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSH-SLRIA 146
           +L   +       +S++ +          ++ LF    F CL+ S ++H       L + 
Sbjct: 284 SLYIAYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLR 343

Query: 147 TLGNKLDYLGICILIVTSMVSILY---YGYFEKFSLFCLFALI---TVSFGIAC--SIVS 198
           +    +DY GI +LI  S+++  +   YG  +  +    F+LI    VS  + C    ++
Sbjct: 344 SKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMN 403

Query: 199 LKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVL-YII 257
              +F + E RP R   ++       +         +F+     I+   VL   V  Y+I
Sbjct: 404 WSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRP--VLDKSVCWYLI 461

Query: 258 GAVLYGMRFPEK 269
           G + YG   PE+
Sbjct: 462 GVIFYGSFIPER 473

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 121/275 (44%), Gaps = 20/275 (7%)

Query: 9   KSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIE 68
           +S+Q   +  A     +  EVA      R L+ + E+P   R+N FI+HGY +  +S+ +
Sbjct: 185 QSIQNDAEAVAASIKFHNYEVALQLGQQRHLHYY-ELPFPWRENRFIIHGY-RFYNSYSK 242

Query: 69  TFKSLFYL---HNESVNIYSHLIPALGFFTVLLLDKSTIKVFAT---TTWLDHMVIDLFY 122
           +  S+F     HNE+VNI++HL  AL F  ++    S   V+ +    T    M   +F 
Sbjct: 243 SLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKGFSQTTVYQSELVPTAAKFMAF-VFL 301

Query: 123 SGAFACLILSSSFHCLKS-HSLRIATLGNKLDYLGICILIVTSMVS---ILYYGYFEKFS 178
           +    C + S  +H       L+  +    +DY GI +L+  S+++   +   G  +   
Sbjct: 302 TAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGITVLVTASILTTEFVTLSGSSDATF 361

Query: 179 LFCL--FALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSF 236
            + L  F   + + G     ++   KF + E RP R   ++   L +    FS L+   F
Sbjct: 362 TWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLRIAFYL---LLASFGFFSYLHSRLF 418

Query: 237 SEIWTQIQLFWVLLGGVL--YIIGAVLYGMRFPEK 269
           +       L   +    L  YIIG V YG   PE+
Sbjct: 419 NTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFIPER 453

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 110/239 (46%), Gaps = 22/239 (9%)

Query: 44  EIPEWQRDNDFILHGYVKETSSFIETFKSL---FYLHNESVNIYSHLIPALGFFTVLL-- 98
           ++P   R+N +I+HGY +  +S  ++F S+   +  HNE+ NI++HL+  L    +    
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 99  LDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLK-SHSLRIATLGNKLDYLGI 157
              S I +          ++ +F + A  C+  S  +H    +H LR+ +    +DY GI
Sbjct: 268 FPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGI 327

Query: 158 CILIVTSMVSILYYGYFE-KFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLF 216
            ILI  S++++ +   ++ K SL   + + +++ GI    ++   KF + E RP R   F
Sbjct: 328 TILITASILTVEFVTMYDYKISLL-FYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFF 386

Query: 217 V---CFGLSSIIPIF---SGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEK 269
           +     G SS I +    +  Y        T   + W       Y+IG   YG   PE+
Sbjct: 387 ILLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVVW-------YLIGVFFYGSFIPER 438

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 108/247 (43%), Gaps = 33/247 (13%)

Query: 44  EIPEWQRDNDFILHGYVKETSSFIETFKSLFYL---HNESVNIYSHLIPALGFFTVLLLD 100
           E+P   R+N FI+HGY +  +S+ ++  S+F     HNE+VNI++HL  AL    +L   
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 101 KSTIKVFAT---TTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK-----L 152
            S   V+ +    T    M      SG   C + S  +H        I  L  +     +
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSG-LECFLFSVVWHTFNG----ICHLQQRSNCACV 352

Query: 153 DYLGICILIVTSMVS---ILYYGYFE-KFSLFCLFALITVS-FGIACSIVSLKDKFRKRE 207
           DY GI IL+  S+++   +   G  E  F+   LF   T S  G+    ++   KF + E
Sbjct: 353 DYTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPE 412

Query: 208 WRPYRAG---LFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVL--YIIGAVLY 262
            RP R     L   FG       FS L+   F    +  +L   +L   L  Y+IG V Y
Sbjct: 413 SRPLRIAFYLLLASFGF------FSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVFY 466

Query: 263 GMRFPEK 269
           G   PE+
Sbjct: 467 GTFIPER 473

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 115/255 (45%), Gaps = 25/255 (9%)

Query: 30  AKAKKVLR-RLYSWDEIPEWQRDNDFILHGYVKETSSF--IETFKSLFYLHNESVNIYSH 86
           A+A ++ R R   + ++P   R+N FI+HGY    S +  + +  + +  HNE+ NI++H
Sbjct: 121 AQANELGRERHLHYYQLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYGWHNETANIWTH 180

Query: 87  LIPALGFFTVLLLDKSTIKVFAT--TTWLDHMVIDLFYSGAFACLILSSSFHCLKSH-SL 143
           L  AL    + + D     V+ +     +   ++ +F + A  C++ S   H       L
Sbjct: 181 LGGALYVLWLAVYDFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCL 240

Query: 144 RIATLGNKLDYLGICILIVTSMVS---ILYYGYFEKFSLFCLFALITVSFGIACSIVSLK 200
            + +    +DY GI +LI  S+++   +  Y Y   +SL    A+ TV  GI   I++  
Sbjct: 241 ALRSKFACVDYSGITMLITASILTTEFVTMYNY--PWSLRFYLAVSTV-LGIFGVIMNWS 297

Query: 201 DKFRKREWRPYRAGLFVCF----GLSSIIPIFSGLYCYS--FSEIWTQIQLFWVLLGGVL 254
            KF + E RP R   F+      GLS +     G + Y+       T   L W       
Sbjct: 298 PKFDRPEARPLRIKFFILLAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSLVW------- 350

Query: 255 YIIGAVLYGMRFPEK 269
           Y++G   YG   PE+
Sbjct: 351 YLLGVAFYGSFVPER 365

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 108/247 (43%), Gaps = 37/247 (14%)

Query: 44  EIPEWQRDNDFILHG---YVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLD 100
           E+P+  R+N +I++G   Y     S +    +++  HNE++NI+SH+  A+    ++L  
Sbjct: 244 ELPQPWRENPYIIYGHRFYHSHKKSLLSIL-NVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 101 KSTIKVFATTT--WLDHMVIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGI 157
                VF +T    +    I +F      C++ S  +H       L + +  + +DY GI
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGI 362

Query: 158 CILIVTSMVSILYYGYFEKFSLFC-------LFALITVSFGIACSIVSLKDKFRKREWRP 210
            ILI  S+++       E F+L+        L+  I++  G+  +  +   +F   + R 
Sbjct: 363 TILITASVMTT------EAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRI 416

Query: 211 YRAGLFVCFGLSSIIPIFSGLYCYSFSEI-----WTQIQLFWVLLGG---VLYIIGAVLY 262
           +R   +V         I +GL   SF  +     W+  +L    L     V Y+IG V Y
Sbjct: 417 FRVAFYV---------ILAGLGLISFVHLTVHSDWSSSRLMITPLINKSIVWYLIGVVFY 467

Query: 263 GMRFPEK 269
               PE+
Sbjct: 468 ATLVPER 474

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 103/243 (42%), Gaps = 30/243 (12%)

Query: 44  EIPEWQRDNDFILHGYVKETSSF--IETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDK 101
           ++P   R+N +I+ GY    S+   + +  + +  HNE++NI+SHL   L    + +   
Sbjct: 118 QLPFPWRENRYIIKGYRFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFVY 177

Query: 102 STIKVFAT----TTWLDHMVIDLFYSGAFACLILSSSFHCLK---SHSLRIATLGNKLDY 154
              +V+ +    TT    M++ +F      C++ S  +H      S++LR       +DY
Sbjct: 178 PNTEVYQSELIPTT--AKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--VDY 233

Query: 155 LGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAG 214
            GI ILI  S+++  Y           ++  ++++ G     ++   KF   E RP R  
Sbjct: 234 TGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIK 293

Query: 215 LFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLF---WVLL-----GGVLYIIGAVLYGMRF 266
            FV           S + C SF  +     L    W+L        + Y+IG   YG   
Sbjct: 294 FFVT---------LSAMGCLSFVHLIFTTSLRHACWLLAPIISKSTIWYVIGVFFYGSFI 344

Query: 267 PEK 269
           PEK
Sbjct: 345 PEK 347

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 100/237 (42%), Gaps = 18/237 (7%)

Query: 44  EIPEWQRDNDFILHGY--VKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDK 101
           E+P   R+N  I++GY         + +  + +  HNE+ NI++HL+  L    ++    
Sbjct: 218 ELPFPWRENRCIINGYRFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQF 277

Query: 102 STIKVFATTTWLD--HMVIDLFYSGAFACLILSSSFHCLKSHSL-RIATLGNKLDYLGIC 158
            + +VF +        ++  +F   A  CL  S  +H     SL R+      +DY GI 
Sbjct: 278 PSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGIS 337

Query: 159 ILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 218
           ILI  S+++  +   ++       +  ++ + GI    ++   KF + E RP R   F+ 
Sbjct: 338 ILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFIL 397

Query: 219 FGLSSIIPIFSGLYCYSFSE-IW-----TQIQLFWVLLGGVLYIIGAVLYGMRFPEK 269
                I+      +  S S   W     T+  + W       Y++G V YG   PE+
Sbjct: 398 LASMGILSFLHLTFITSLSHSTWLLSPITKKSVVW-------YLVGVVFYGSFIPER 447

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 101/225 (44%), Gaps = 18/225 (8%)

Query: 91  LGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLR--IATL 148
           L FFT + L    +    +TT  D++++++F         L+++F C   H ++    T 
Sbjct: 110 LVFFTDVYL----VPRHVSTTMTDYVLLNVF---------LATAFQCAACHMVQCFTTTA 156

Query: 149 GNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGI---ACSIVSLKDKFRK 205
           G+ L  + +      S V++LYY Y++    F L AL T ++ +   A ++ S      K
Sbjct: 157 GSVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPK 216

Query: 206 REWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMR 265
           R+W   R  L V   +   +P+  GL  +  +++  ++    +L    +Y+I  V YG  
Sbjct: 217 RQWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGT 276

Query: 266 FPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIK 310
             + +    F +  H+  L H  +++ A   +R   N   LV  K
Sbjct: 277 EKDTLPKLPFYVAFHTASLIHLQLLLNAFHLMRAGTNKPTLVSFK 321

>KLTH0D09174g Chr4 (762443..765796) [3354 bp, 1117 aa] {ON} similar
           to uniprot|Q12271 YOR109w Saccharomyces cerevisiae INP53
           Phosphatidylinositol 4,5-bisphosphate 5- phosphatase
          Length = 1117

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 15/110 (13%)

Query: 144 RIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKF 203
            + T  N+LD LG  +L     ++ +  G+ E F        +T    +  S+  +  + 
Sbjct: 192 EVITFRNRLDDLGRQVLDDEGFLTTVIRGFAETF--------VTYIKQLKVSLTVISKQS 243

Query: 204 RKREWRPYRA------GLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFW 247
            KR    Y A      G    F  + ++ +FS  YCY+F++I   I +FW
Sbjct: 244 WKRAGTRYNARGVDDEGNVANFVETELL-MFSKEYCYAFTQIRGSIPIFW 292

>Suva_14.232 Chr14 complement(417816..421373) [3558 bp, 1185 aa]
           {ON} YNL106C (REAL)
          Length = 1185

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 20/81 (24%)

Query: 185 LITVSFGIACSIVSLKDKFR-------KREWRPYRAGL-----------FVCFGLSSIIP 226
           L TV  G A ++ S  DK R       ++ W+  RAG            +V   + + + 
Sbjct: 238 LTTVIRGFAETVFSYIDKLRVGLTIISRQSWK--RAGTRFNARGIDDEGYVANFVETEMI 295

Query: 227 IFSGLYCYSFSEIWTQIQLFW 247
           +FS  YCY+F++I   I +FW
Sbjct: 296 MFSSQYCYAFTQIRGSIPIFW 316

>CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]
           {ON} similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117w CYK3
          Length = 880

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 164 SMVSILYYGYFEKFSLFCLFALITVSFGIACSIV 197
           ++ S+LY  Y   + L CLF  + VS  I C +V
Sbjct: 508 NLESVLYQKYCTPYELTCLFKRLAVSLSIQCEVV 541

>Skud_5.169 Chr5 complement(262759..264360) [1602 bp, 533 aa] {ON}
           YER056C (REAL)
          Length = 533

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 21/91 (23%)

Query: 158 CILIVTSMVSILYYGY-----FEKFSLFCLFALITVSFGIACSIVSLKDKFRKREW--RP 210
           C++I+   V + ++GY     +EK+S    FA+    F +  + +S   KF+  EW   P
Sbjct: 206 CVIIIGGTVLVTFFGYRVIHTYEKWSWVPNFAV----FLVIIAQLSRSGKFKGGEWIGGP 261

Query: 211 YRAGLFVCFGLSSIIPIFSGLYCYSFSEIWT 241
             AG  + FG S           Y F+  WT
Sbjct: 262 TTAGSVLSFGSS----------IYGFAAGWT 282

>TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4.45
            Scer_YGOB_SDC25
          Length = 1394

 Score = 30.8 bits (68), Expect = 5.1,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 9/66 (13%)

Query: 35   VLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFF 94
            + R   +WD IP++ RD+   L+  +  T +FI   K L  + N         +P + FF
Sbjct: 1215 IFRLKKTWDIIPQYVRDSLASLNRLMDSTKNFINYRKLLQSVSN---------VPCIPFF 1265

Query: 95   TVLLLD 100
             V L D
Sbjct: 1266 GVFLSD 1271

>NDAI0E04780 Chr5 (1074922..1076529) [1608 bp, 535 aa] {ON} 
          Length = 535

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 158 CILIVTSMVSILYYGY-----FEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWR--P 210
           CI+I+ + V + ++GY     +EK+S    FA+    F +  + + +   F+  EW   P
Sbjct: 208 CIIIIGATVLVTFFGYRVIHTYEKWSWVPNFAV----FLVIIARLKMSGNFKGGEWTSGP 263

Query: 211 YRAGLFVCFGLSSIIPIFSGLYCYS 235
             AG  + FG SS+    SG   Y+
Sbjct: 264 TTAGEVLSFG-SSVFGFASGWTTYA 287

>YER060W Chr5 (274567..276153) [1587 bp, 528 aa] {ON}  FCY21Putative
           purine-cytosine permease, very similar to Fcy2p but
           cannot substitute for its function
          Length = 528

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 68/168 (40%), Gaps = 33/168 (19%)

Query: 93  FFTVL-LLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILS--SSFHCL---------KS 140
           FF +L L+  +   VF     L  M++  +  G  A  I S  +   C+          S
Sbjct: 124 FFNLLGLVSVAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASS 183

Query: 141 HSLRIATLGNKLDYLGICILIVTSMVSILYYGY-----FEKFSLFCLFALITVSFGIACS 195
             L +   G++      CI+I+ + V + ++GY     +EK++    FA+    F +  +
Sbjct: 184 QVLNMVNPGHQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAV----FLVIIA 239

Query: 196 IVSLKDKFRKREWR--PYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWT 241
            ++   KF   EW   P  AG  + FG +           Y F+  WT
Sbjct: 240 RLARSKKFVLGEWTSGPTTAGNVLSFGST----------VYGFAAGWT 277

>Suva_5.169 Chr5 (251694..253274) [1581 bp, 526 aa] {ON} YER060W-A
           (REAL)
          Length = 526

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 68/168 (40%), Gaps = 33/168 (19%)

Query: 93  FFTVL-LLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILS--SSFHCL---------KS 140
           FF ++ L+  +   VF     L  MV+  +  G  A  I S  +   C+          S
Sbjct: 122 FFNLMGLVSVAFFSVFGAELGLRQMVLSRYLVGNVAARIFSLINFIACIGWGIVNTVASS 181

Query: 141 HSLRIATLGNKLDYLGICILIVTSMVSILYYGY-----FEKFSLFCLFALITVSFGIACS 195
             L +   G++      CI+I+ + V + ++GY     +EK++    FA+    F +  +
Sbjct: 182 QVLNMVNPGHQCPLWAGCIVIIGATVIVTFFGYNVIHSYEKWAWVPNFAV----FLVIIA 237

Query: 196 IVSLKDKFRKREWR--PYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWT 241
            ++   KF   EW   P  AG  + FG +           Y F+  WT
Sbjct: 238 RLARSGKFVLGEWTSGPTTAGNVLSFGST----------VYGFAAGWT 275

>NDAI0A02570 Chr1 (573728..575047) [1320 bp, 439 aa] {ON} 
          Length = 439

 Score = 29.6 bits (65), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 63/162 (38%), Gaps = 24/162 (14%)

Query: 93  FFTVL-LLDKSTIKVFATTTWLDHMVIDLFYSGA-----------FACLILSSSFHCLKS 140
           FF +L LL  +   VF     L  M++  F  G             AC+          +
Sbjct: 35  FFNILGLLSVAFFSVFGAEFGLRQMILSRFLLGNVTARIFALINIIACVGWGIVNTVASA 94

Query: 141 HSLRIATLGNKLDYLGICILIVTSMVSILYYGY-----FEKFSLFCLFALITVSFGIACS 195
             L +   GN       C++IV   V + ++GY     +EK+S    FA+    F +  +
Sbjct: 95  QLLNMVNQGNSCPLWAGCLVIVGCTVLVTFFGYNIIHAYEKWSWIPNFAV----FLVIIA 150

Query: 196 IVSLKDKFRKREWR--PYRAGLFVCFGLSSIIPIFSGLYCYS 235
            + +   F   EW   P  AG  + FG S++    +G   Y+
Sbjct: 151 RLKMSGNFSGGEWTSGPTTAGGVLSFG-SAVFGFATGWTTYA 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,548,566
Number of extensions: 1375044
Number of successful extensions: 5122
Number of sequences better than 10.0: 97
Number of HSP's gapped: 5171
Number of HSP's successfully gapped: 97
Length of query: 317
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 208
Effective length of database: 40,982,805
Effective search space: 8524423440
Effective search space used: 8524423440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)