Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOL001W (PHO80)6.26ON29329315520.0
Skud_15.1616.26ON29329313610.0
Smik_15.1696.26ON29129313300.0
Suva_15.1746.26ON29529512701e-178
ZYRO0C07634g6.26ON3822577622e-99
TDEL0G044306.26ON3472357559e-99
Kpol_1037.306.26ON3672457543e-98
CAGL0E02541g6.26ON3422647183e-93
Kwal_56.224436.26ON2802437115e-93
TPHA0J003806.26ON3562487123e-92
ACR001C6.26ON3462427053e-91
SAKL0E01408g6.26ON3072347013e-91
KNAG0I017506.26ON3242476982e-90
KLTH0C11110g6.26ON2802456915e-90
Ecym_30296.26ON3512306793e-87
KLLA0D01287g6.26ON3452406532e-83
TBLA0A071606.26ON2682606366e-82
NCAS0D021506.26ON3692295943e-74
NDAI0C026406.26ON4272495575e-68
Smik_9.1407.240ON2852071915e-16
Skud_9.1197.240ON2851821872e-15
YIL050W (PCL7)7.240ON2851871811e-14
Suva_9.1497.240ON2861571748e-14
Ecym_43367.240ON3851101662e-12
KAFR0I018407.240ON3251191652e-12
NCAS0E032207.240ON3411881617e-12
Kwal_23.58077.240ON4651261582e-11
KLTH0A04268g7.240ON5801261583e-11
ADL075W7.240ON2071101524e-11
KNAG0D016307.240ON4381731565e-11
SAKL0F08602g7.240ON4741151548e-11
NCAS0A134807.240ON4481651512e-10
KAFR0L008807.240ON3131211449e-10
CAGL0M12342g7.240ON4571191451e-09
KNAG0L014707.240ON3541371432e-09
TPHA0C010907.240ON3851411432e-09
KLLA0C08305g7.240ON4091331422e-09
NDAI0A025607.240ON5031131362e-08
TDEL0H020207.240ON3631361343e-08
TBLA0D040707.240ON661601334e-08
ZYRO0C08118g7.240ON4051461317e-08
Kpol_1033.137.240ON250761261e-07
Suva_5.1677.240ON424731245e-07
Smik_5.1897.240ON415601237e-07
Skud_5.1737.240ON420601211e-06
NDAI0E047707.240ON303761201e-06
YER059W (PCL6)7.240ON420601211e-06
Kpol_2000.147.289ON3101091155e-06
TBLA0C048507.289ON3681331156e-06
YDL179W (PCL9)7.289ON3041051102e-05
NCAS0A137707.289ON3121771084e-05
TPHA0P008107.289ON247981031e-04
TDEL0H015507.289ON3091331041e-04
Suva_14.503.70ON279961022e-04
Kwal_23.60067.289ON3041091022e-04
Suva_4.687.289ON3051371022e-04
Kpol_1020.163.70ON2821701013e-04
TBLA0J006507.289ON3631011023e-04
Kpol_1020.87.289ON2961501003e-04
SAKL0C12100g3.70ON3141221004e-04
CAGL0E02233g3.70ON26698986e-04
NDAI0A022707.289ON330195996e-04
Smik_14.423.70ON279106978e-04
ZYRO0C09284g7.289ON311116970.001
Skud_14.483.70ON27996960.001
YNL289W (PCL1)3.70ON279106960.001
Smik_4.607.289ON305111960.001
Smik_4.1107.289ON308112960.001
SAKL0F09856g7.289ON335109960.001
KLTH0A05346g7.289ON301140950.002
YDL127W (PCL2)7.289ON308112950.002
Suva_4.1187.289ON309102950.002
AFR159C7.289ON308109950.002
Ecym_80387.289ON314111940.002
Ecym_35353.70ON370105950.002
TBLA0A078903.70ON361112930.003
CAGL0J09328g7.289ON297104920.004
KNAG0B029307.289ON312102920.004
KNAG0A014903.70ON262107900.007
Skud_4.797.289ON30997900.007
TPHA0A005803.70ON289106890.009
YPL219W (PCL8)6.236ON492161900.010
Skud_4.1287.289ON308102890.010
ZYRO0C02068g3.70ON330103880.014
KLLA0E13223g3.70ON282104870.015
TDEL0E007903.70ON254102830.043
NCAS0D040706.236ON473109840.053
Smik_6.4246.236ON492161830.060
Suva_16.876.236ON501179830.066
NCAS0A098703.70ON29487820.071
Skud_16.606.236ON500125820.087
NDAI0A060503.70ON28696800.12
TBLA0B084403.70ON268105780.18
ZYRO0B14410g4.333ON57469790.19
KLLA0F05654g7.289ON311120780.25
KNAG0F018706.236ON483108780.28
KLTH0H03674g6.236ON484103780.28
Kwal_23.52313.70ON25687760.34
TPHA0A032507.289ON28987750.52
AEL195W3.70ON237117730.73
CAGL0J06336g7.289ON314117740.76
KLTH0A01584g3.70ON28187731.0
Kwal_56.241516.236ON480152731.0
KAFR0C015603.70ON26787721.0
KLLA0E20791g7.409ON93365741.0
Suva_7.1306.236ON442160721.2
YDR515W (SLF1)1.36ON44759721.3
KAFR0A082803.70ON24198711.3
NDAI0C031405.117ON70547703.0
NDAI0C019805.347ON226104683.0
Smik_7.1386.236ON437161683.8
NCAS0D016405.117ON68660685.1
Kpol_228.16.236ON560122675.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL001W
         (293 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   602   0.0  
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   528   0.0  
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   516   0.0  
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   493   e-178
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   298   2e-99
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   295   9e-99
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   295   3e-98
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   281   3e-93
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   278   5e-93
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   278   3e-92
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   276   3e-91
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   274   3e-91
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   273   2e-90
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   270   5e-90
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   266   3e-87
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   256   2e-83
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   249   6e-82
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     233   3e-74
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   219   5e-68
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    78   5e-16
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    77   2e-15
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    74   1e-14
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    72   8e-14
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    69   2e-12
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    68   2e-12
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    67   7e-12
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    65   2e-11
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    65   3e-11
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    63   4e-11
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    65   5e-11
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    64   8e-11
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    63   2e-10
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    60   9e-10
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    60   1e-09
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    60   2e-09
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    60   2e-09
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    59   2e-09
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    57   2e-08
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    56   3e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    56   4e-08
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    55   7e-08
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    53   1e-07
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    52   5e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    52   7e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    51   1e-06
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    51   1e-06
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    51   1e-06
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    49   5e-06
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    49   6e-06
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    47   2e-05
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    46   4e-05
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    44   1e-04
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    45   1e-04
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    44   2e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    44   2e-04
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    44   2e-04
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    44   3e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    44   3e-04
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    43   3e-04
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    43   4e-04
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    42   6e-04
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      43   6e-04
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    42   8e-04
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    42   0.001
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    42   0.001
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    42   0.001
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    42   0.001
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    42   0.001
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    42   0.001
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    41   0.002
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    41   0.002
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    41   0.002
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    41   0.002
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    41   0.002
Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar...    41   0.002
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    40   0.003
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    40   0.004
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    40   0.004
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    39   0.007
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    39   0.007
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    39   0.009
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    39   0.010
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    39   0.010
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    39   0.014
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    38   0.015
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    37   0.043
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     37   0.053
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    37   0.060
Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W...    37   0.066
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    36   0.071
Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W...    36   0.087
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    35   0.12 
TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {...    35   0.18 
ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]...    35   0.19 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    35   0.25 
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    35   0.28 
KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly...    35   0.28 
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    34   0.34 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    33   0.52 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    33   0.73 
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    33   0.76 
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    33   1.0  
Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {...    33   1.0  
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    32   1.0  
KLLA0E20791g Chr5 complement(1852522..1855323) [2802 bp, 933 aa]...    33   1.0  
Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W ...    32   1.2  
YDR515W Chr4 (1473429..1474772) [1344 bp, 447 aa] {ON}  SLF1RNA ...    32   1.3  
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    32   1.3  
NDAI0C03140 Chr3 (715356..717473) [2118 bp, 705 aa] {ON} Anc_5.1...    32   3.0  
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    31   3.0  
Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W ...    31   3.8  
NCAS0D01640 Chr4 (309081..311141) [2061 bp, 686 aa] {ON} Anc_5.1...    31   5.1  
Kpol_228.1 s228 (611..2293) [1683 bp, 560 aa] {ON} (611..2293) [...    30   5.5  

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/293 (100%), Positives = 293/293 (100%)

Query: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60
           MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD
Sbjct: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120

Query: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC
Sbjct: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240
           SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK
Sbjct: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240

Query: 241 VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD 293
           VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD
Sbjct: 241 VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD 293

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/293 (88%), Positives = 268/293 (91%)

Query: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60
           ME++  E SE IHE QGIPKVILPA+F KCSRTDLVVLISRMLVSLIAINENS TKK DD
Sbjct: 1   METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120
           QITLTRYHSK+PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQT YPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATTVA KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240
           SIEQKQKKFV DKNA GS DLDSYSYV+RPKSGYNVLDKYYRRIVQLVGSFNASPDKS+K
Sbjct: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 241 VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD 293
           VDYVLP NID  +ESG Q  Q KG+ SPNSH SQKR SEAKD +IY KRSKPD
Sbjct: 241 VDYVLPSNIDKDTESGPQIQQQKGTLSPNSHYSQKRNSEAKDTNIYRKRSKPD 293

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/293 (87%), Positives = 269/293 (91%), Gaps = 2/293 (0%)

Query: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60
           MEST G+ SEN+HEDQGI KVILP DFNKCSRTDLVVLISRMLVSLIAINENS +K  ++
Sbjct: 1   MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQT YPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATT+ATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNI LC
Sbjct: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180

Query: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240
           SIEQKQKKFVIDKNALGS DLDSYSY +RPKSGYNVLDKYYRRIVQLVGSFNASPDKS+K
Sbjct: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 241 VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD 293
           +DYVLP NID  +ESG Q  + +G S PN H SQKR SEAKDA+ Y+KRSKPD
Sbjct: 241 IDYVLPSNIDKDNESGPQINEQRG-SLPN-HYSQKRNSEAKDANTYHKRSKPD 291

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  493 bits (1270), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/295 (81%), Positives = 263/295 (89%), Gaps = 2/295 (0%)

Query: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60
           MES + E SE+  EDQ IPK+ILP++F KCSRTDLVVLISRMLVSLIAINENS+TK+ DD
Sbjct: 1   MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD 60

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120
           QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVL+TSLYYIDLLQT YPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATTVA KGLCDSFSTNAHY+KVGGVRCHELNILENDFLKRVNYRI+PRDHNITLC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180

Query: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240
           SIEQKQK FVIDKNALGS+DL SYSY NR KSGYNVLDKYY+RIVQLVGSF+ASPDKSR+
Sbjct: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240

Query: 241 VDYVLPPNIDIVSESGSQTTQLKGSS--SPNSHSSQKRYSEAKDAHIYNKRSKPD 293
           V+Y LP N D  +E  ++  Q K ++  SP SH SQKR SEAKD + Y+KRSKPD
Sbjct: 241 VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD 295

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  298 bits (762), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 146/257 (56%), Positives = 190/257 (73%), Gaps = 19/257 (7%)

Query: 4   TSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQIT 63
           T+G R +N+++   +P VILP  F++CSRTDLV+LISRML  LI +N++S+T   D    
Sbjct: 31  TTGIRIDNVND---VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTN 87

Query: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFL 123
           LT++HSK+PP IS++NY +RLTK+SSL+HCVLM ++YYIDL+ +VYP FTLNSLT HRFL
Sbjct: 88  LTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFL 147

Query: 124 LTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIE 183
           LTATTVA+KGLCDSF TN HYAKVGGV C ELN+LE + L+R+NYRIIPRD NI  C++E
Sbjct: 148 LTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLE 207

Query: 184 QKQKKFVIDKNALGSLDLDSYSYV------NRPKSGYNVLDKYYRRIVQLVGSFNASPDK 237
            + + FV+D     + D D ++ +      NR  SGYNVLD YY +IVQLVGS  ++ DK
Sbjct: 208 SQHRHFVLD-----TQDGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDK 262

Query: 238 SRKVDYVL-----PPNI 249
           S+ V+Y       P NI
Sbjct: 263 SKLVNYTFANTLKPTNI 279

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  295 bits (755), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 147/235 (62%), Positives = 180/235 (76%), Gaps = 4/235 (1%)

Query: 18  IPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISI 77
           I  + LP  F+KCSRTDL VLISRML  LI IN++ A  K ++   LTR+HS++PP IS+
Sbjct: 30  ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISV 89

Query: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDS 137
           +NY IRLTK+SSLEHCVL+T++YYIDLL +VYP FTL+SLT HRFLLTATTVA+KGLCDS
Sbjct: 90  YNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDS 149

Query: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVI-DKNAL 196
           F TN HYAKVGGV   ELNILE +FLKRVNYRI+PRD NI  C +E K +KF + ++  +
Sbjct: 150 FCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEEPEM 209

Query: 197 GSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPNIDI 251
           G       S  N   SGYNVLD Y+R+IVQLVGS+ +SPDKS+ V+YVL P+  I
Sbjct: 210 GQNSRPQNSLKN---SGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPI 261

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  295 bits (754), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 181/245 (73%), Gaps = 10/245 (4%)

Query: 9   SENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATK--------KSDD 60
           +EN  E + I  + LP  F  CSR+DLV LI+RML  LI +N+N             +  
Sbjct: 34  NENKIEIENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRS 93

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120
            + LTR+HS++PPNIS++NY IRLTK+SSLEHCVL++++YYIDLL +VYP+F +NSLT H
Sbjct: 94  VMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVH 153

Query: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATT+A+KGLCDSF TN+HY+KVGGV C ELNILE +FL+RVNYRIIPRD NI LC
Sbjct: 154 RFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213

Query: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240
            IE +Q KF +D + L  + +   S  N   SG+N+LD YY +IVQLVGSF+AS DKSRK
Sbjct: 214 KIEHQQNKFTMDFSDLSMVGMTVQS--NHQNSGFNILDIYYHKIVQLVGSFSASSDKSRK 271

Query: 241 VDYVL 245
            +Y L
Sbjct: 272 ANYTL 276

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  281 bits (718), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 197/264 (74%), Gaps = 9/264 (3%)

Query: 12  IHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKI 71
           I+ D+ IP + LP DF KC + DLV+LI+RML  +I IN+ S  K+++ +  LTR+HSKI
Sbjct: 8   INTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQIND-SNIKENERKYGLTRFHSKI 66

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVAT 131
            PNIS+FNYF RLTK+S LEH VL++++YYIDLL  VYP F LNSLTAHRFLLTATT+A+
Sbjct: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIAS 126

Query: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVI 191
           KGLCDSF TN HY+KVGGV+C+ELN+LEN+FL++VNYRIIPRD+NIT C +E ++  F++
Sbjct: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFIL 186

Query: 192 DKNALGSLDLD-SYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPNID 250
            ++    L       Y +   +GYNVL +YY +I+++VG +++SPDK++KV+Y    +ID
Sbjct: 187 PESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY----DID 242

Query: 251 IVSES---GSQTTQLKGSSSPNSH 271
           + +++     Q   +K  S+ NS+
Sbjct: 243 MPAKTLHEHQQNDAVKNCSNNNSN 266

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  278 bits (711), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 182/243 (74%), Gaps = 18/243 (7%)

Query: 4   TSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQIT 63
           + GER     E+  +P+V LP DF++CSRTDLV+LISRML  L  IN++      DD   
Sbjct: 19  SPGER----LEEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVP---KDDAKE 71

Query: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFL 123
           LTR+HS++PP IS+++Y +RLT++SSLE  VL+ S+YYIDLL  +YP F+LNSLT HRFL
Sbjct: 72  LTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFL 131

Query: 124 LTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIE 183
           LTATTVA+KGLCDSF TN+HYAKVGGV+C EL++LE++FLK+VNYRI+PRD NI+ C  E
Sbjct: 132 LTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAE 191

Query: 184 QKQKKFVIDKNALGSLDLDSYSYVNR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVD 242
           +K   FV            +YS   R P +G+NVLD YYR+I+++VGSF++SPDK+++  
Sbjct: 192 KKAGLFVT----------PTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAH 241

Query: 243 YVL 245
           YV+
Sbjct: 242 YVM 244

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  278 bits (712), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 141/248 (56%), Positives = 178/248 (71%), Gaps = 19/248 (7%)

Query: 18  IPKVILPADFNKCSRTDLVVLISRMLVSLIAINE--------NSATKKSDDQIT------ 63
           I  ++LP  F KCSR+DLVVLISRML  LI IN+        NSA   +   +       
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 64  ---LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120
              LTR+HS++PPNIS+ NY IRLTK++SLEH VL++SLYYIDLL +VYP+F +NSLT H
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLL ATTVA+KGL DSF TN+HYAKVGGVRC ELNILE DFL+R+NYRIIPRD NI LC
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240
            +E+K  +F +D   L + ++     +  P SGYNVL+ YYR++VQ+VG    S DKS+K
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQ--PELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKK 269

Query: 241 VDYVLPPN 248
           V+Y++  N
Sbjct: 270 VNYIIQTN 277

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  276 bits (705), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 137/242 (56%), Positives = 176/242 (72%), Gaps = 13/242 (5%)

Query: 4   TSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQIT 63
           TS E SE++ E +      LP  F  CSRT LVVLISRML SLI +N+    K     I 
Sbjct: 5   TSHETSESVTEME------LPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSK--PIK 56

Query: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFL 123
           LTR+HS++PP IS++NY IRLTK+SSLEHCVL+ S+YYIDLL  VYP+F L+SLT HRFL
Sbjct: 57  LTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFL 116

Query: 124 LTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIE 183
           LTATTVA+KGLCDSF TN HYAKVGGV+C ELN+LEN+FL+RVNYRI+PRD NI  CS+E
Sbjct: 117 LTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLE 176

Query: 184 QKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDY 243
           ++++ F     +  ++ +D    +    +G+ VL+KYY R++ L+G FN SPDKS  + +
Sbjct: 177 RQERIF-----SYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSF 231

Query: 244 VL 245
            L
Sbjct: 232 TL 233

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  274 bits (701), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 171/234 (73%), Gaps = 12/234 (5%)

Query: 15  DQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPN 74
           +Q   +++LP +F KCSRT LVVLISRML SLI +N++      D  + LTR+HS++PP 
Sbjct: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMC---KDKNLKLTRFHSRVPPG 97

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGL 134
           IS++NY IRL K+SSLE  VL+ ++YYIDLL +VYP FTLNSLT HRFLLTATTVA+KGL
Sbjct: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157

Query: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKN 194
            DSF TN HYAKVGGV+C ELN+LE +FLKRVNYRIIPRD NI  C  E +Q  F+    
Sbjct: 158 SDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPL 217

Query: 195 ALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPN 248
           A           +  P +G+NVLD YY++++QLVG  N+SPDK+ KV YVL P+
Sbjct: 218 A---------DKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPS 262

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  273 bits (698), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 138/247 (55%), Positives = 179/247 (72%), Gaps = 22/247 (8%)

Query: 18  IPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKS------------------D 59
           I  V LP++F+ CSR DL+ LISRMLV LI IN+++A KK+                   
Sbjct: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80

Query: 60  DQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTA 119
            +  LTR+HS +PP IS++NY IRLTK+S+LE  VL+TS+YYIDLL +VYP FT+NSLT 
Sbjct: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140

Query: 120 HRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITL 179
           HRFLLTATTVA+KGLCDSF TNAHYAKVGGV+  ELNILE++FLK++NYR++PRD NIT 
Sbjct: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200

Query: 180 CSIEQKQKKFVI-DKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKS 238
           C  E +  +F I +K AL ++   +++  N   SGYNVL  YY +I+QLVG F++S DKS
Sbjct: 201 CKYEHRAHEFTIYNKAALTNVSKPTHTQRN---SGYNVLQMYYHKIIQLVGKFSSSLDKS 257

Query: 239 RKVDYVL 245
           +K +YV 
Sbjct: 258 KKANYVF 264

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  270 bits (691), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 182/245 (74%), Gaps = 19/245 (7%)

Query: 9   SENIHEDQG---IPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLT 65
           +E+   D G   +P+V LP DF++C RTDLV+LISRML  LI IN+   +   D+   LT
Sbjct: 17  TEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRIND---SIPKDNSSELT 73

Query: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLT 125
           R+HS++PP IS+++Y +RLT++SSLE  VL+ S+YYIDLL  +Y  F+LNSLT HRFLLT
Sbjct: 74  RFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLT 133

Query: 126 ATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK 185
           ATTV +KGLCDSF TN+HYAKVGGV+C EL++LE++FLKRVNYRI+PRD NI  C  E++
Sbjct: 134 ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERR 193

Query: 186 QKKFVIDKNALGSLDLDSYSYVNR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYV 244
           +  FV            +Y+  NR P +G+NVLD YY++I+++VGS+++SPDK+++  YV
Sbjct: 194 EGLFVT----------ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYV 243

Query: 245 L--PP 247
           +  PP
Sbjct: 244 MKTPP 248

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  266 bits (679), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 130/230 (56%), Positives = 170/230 (73%), Gaps = 8/230 (3%)

Query: 16  QGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNI 75
           Q +P+  LP  F  CSRT LVVLISRML SLI +N+        + + LTR+HS++PP+I
Sbjct: 18  QPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLND---AYTESNTLQLTRFHSRVPPSI 74

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLC 135
           S+++Y IRLTK+SSLEHCVL+ S+YYIDLL +V+P+F L+SLT HRFLLTATTVA+KGLC
Sbjct: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLC 134

Query: 136 DSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNA 195
           DSF TN HYAKVGGV+C+ELN+LEN+FL RVNYRI+PRD NI  CS E ++  F    N 
Sbjct: 135 DSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSF-ANI 193

Query: 196 LGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVL 245
               + D  S  NR    ++VL+ YY R++ L+G+ +ASPDKS  +++ L
Sbjct: 194 PADAEQDQKSEENR----FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  256 bits (653), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 136/240 (56%), Positives = 170/240 (70%), Gaps = 19/240 (7%)

Query: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60
           M +   ++  NI   Q IP   LP ++ +CSRT LVV+ISRML  LI IN+  A    + 
Sbjct: 4   MNTIDPQKGSNI--GQIIP---LPEEYLRCSRTHLVVIISRMLSFLIQIND--ANNAGNQ 56

Query: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120
            + LTR+HSK  P+I+++ Y IRLTK+SSLEH VL++++YYIDLL  VYP+FTLNSLT H
Sbjct: 57  TMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVH 116

Query: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATT+A+KGLCDSF TN HY+KVGGV+C ELNILEN+FL+RV YRIIPRD NI  C
Sbjct: 117 RFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENC 176

Query: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNR--PKSGYNVLDKYYRRIVQLVGSFNASPDKS 238
            IEQK          LGS  L      ++  P +G+NVL  YYR+IVQLVG+   SPDK+
Sbjct: 177 KIEQK----------LGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT 226

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  249 bits (636), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 173/260 (66%), Gaps = 21/260 (8%)

Query: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINEN-----SAT 55
           M  +SGE ++          V+L  +F KCS+ DL+ LISRML   I IN++     + T
Sbjct: 1   MGPSSGEEAQ---------LVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVT 51

Query: 56  KKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN 115
                 + LTR+HSK+PPNISIF+Y IRLTK+SSLE  VL+TS+YYIDLL  VYP+F+LN
Sbjct: 52  NNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN 111

Query: 116 SLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDH 175
           SLT HR+LLTATT+A+KGLCDSF TN+HYAKVGG+RC+ELN+LE +FL+RV YR+IPRD+
Sbjct: 112 SLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDN 171

Query: 176 NITLCSIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASP 235
            I LC +E K        N +   D           SGYNVL  YY ++VQLVG+  +S 
Sbjct: 172 TIKLCKLEYKYSPIEDINNDIHIPD-------ELQNSGYNVLSTYYNKMVQLVGNCKSSK 224

Query: 236 DKSRKVDYVLPPNIDIVSES 255
           +  R V+Y+   N D +  S
Sbjct: 225 NSFRNVNYIFSINQDEIYNS 244

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  233 bits (594), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 159/229 (69%), Gaps = 5/229 (2%)

Query: 23  LPADFNKCSRTDLVVLISRMLVSLIAINE---NSATKKSDDQITLTRYHSKIPPNISIFN 79
           +P ++ KCSR+DLVVL+SRMLV LI  N+   N++   SD  + LTR+HS+IPPNISIFN
Sbjct: 31  VPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMHLTRFHSRIPPNISIFN 90

Query: 80  YFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFS 139
           Y  RLTK+  +EHCVL++ +YYIDL    YP FT NSLTAHRFLLTA TVA KGLCDSF 
Sbjct: 91  YLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGLCDSFC 150

Query: 140 TNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSL 199
           T A YAK+GGV+  ELNILE  FL+ VNYRIIPR  N+TL  +E+  + F +D   +   
Sbjct: 151 TTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDHLDMKDP 210

Query: 200 DLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPN 248
            L   SY   P +GY+VL+ YY+ IV++ G+  +S    ++V Y  P N
Sbjct: 211 KLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKRVIYTFPNN 257

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  219 bits (557), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 157/249 (63%), Gaps = 8/249 (3%)

Query: 3   STSGERSENIHEDQGIPK---VILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSD 59
           ST    + N+  D   PK   + LP  F +C R DLVVLISRMLV+LI IN+  A   + 
Sbjct: 36  STQSHSTPNVITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNL 95

Query: 60  DQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTA 119
                TR+HS++ P ISI NY +RLTKF  L+  VL+T++YYIDLL  V+P F+ NSLTA
Sbjct: 96  PSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTA 155

Query: 120 HRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITL 179
           HRF+LTA  VA+K LCDS  +  HYAK GGV+ +EL +LE  FLK + YR++PRD N  L
Sbjct: 156 HRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDL 215

Query: 180 CSIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVG---SFNASPD 236
           CS+E     F ++   +      S+SY   P SGYNVL  YYRRI+ ++G     + SPD
Sbjct: 216 CSMEYHFDTFALNDGQIKESG-TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD 274

Query: 237 KSRKVDYVL 245
            +  VDY L
Sbjct: 275 -AVTVDYFL 282

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 78.2 bits (191), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 98/207 (47%), Gaps = 43/207 (20%)

Query: 2   ESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQ 61
           + T+GE SEN+     +  V  P D       +L++++S +L  +I +N+  AT     Q
Sbjct: 89  DETNGESSENV-----LNIVDFPTD-------ELIIMVSALLNKIITVND--ATTDISQQ 134

Query: 62  IT----------LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVY-- 109
           +           +  ++ K  P I +  Y  R+ K+    + + ++ L Y D +   Y  
Sbjct: 135 VPGDTEEKFLTPILAFYGKNVPEIDVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGH 194

Query: 110 -PD--------FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILEN 160
            P+        F ++S   HR L+T  T+ TK L D F +N+ YAKVGG+   ELN LE 
Sbjct: 195 SPEENGHSKQLFVMDSGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLEL 254

Query: 161 DFLKRVNYRIIPRDHNITLCSIEQKQK 187
            FL   ++++        L S+E+ QK
Sbjct: 255 QFLVLCDFKL--------LVSVEEMQK 273

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 90/182 (49%), Gaps = 30/182 (16%)

Query: 25  ADFNKCSRTDLVVLISRMLVSLIAINENSA------TKKSDDQIT--LTRYHSKIPPNIS 76
           ADF   S  +L+ +IS +L  ++  N+  A      +K + D++   +  ++ K  P IS
Sbjct: 103 ADF---STDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEIS 159

Query: 77  IFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFT-----------LNSLTAHRFLLT 125
           +  Y  R+ K+    + + ++ L Y D +   Y  F+           ++S   HR L+T
Sbjct: 160 VVQYLERIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLIT 219

Query: 126 ATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK 185
             T+ TK L D F +N+ YAKVGG+   ELN LE  FL   ++++        L S+E+ 
Sbjct: 220 GITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKL--------LVSVEEM 271

Query: 186 QK 187
           QK
Sbjct: 272 QK 273

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 30/187 (16%)

Query: 20  KVILPADFNKCSRTDLVVLISRMLVSLIAINENS------ATKKSDDQIT--LTRYHSKI 71
           K++  ADF      +L+++IS +L  +I  N+ +       + +++D++   +  ++ K 
Sbjct: 98  KILNIADF---PTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKN 154

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD-----------FTLNSLTAH 120
            P I++  Y  R+ K+    + + ++ L Y D +   Y             F ++S   H
Sbjct: 155 VPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIH 214

Query: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           R L+T  T+ TK L D F +N+ YAKVGG+   ELN LE  FL   ++++        L 
Sbjct: 215 RLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKL--------LV 266

Query: 181 SIEQKQK 187
           S+E+ QK
Sbjct: 267 SVEEMQK 273

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 71.6 bits (174), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 81/157 (51%), Gaps = 19/157 (12%)

Query: 34  DLVVLISRMLVSLIAINENS------ATKKSDDQIT--LTRYHSKIPPNISIFNYFIRLT 85
           +L++++S +L  ++  N+ +        +  +D++   +  ++ K  P I++  Y  R+ 
Sbjct: 110 ELILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLERIQ 169

Query: 86  KFSSLEHCVLMTSLYYIDLLQTVY---PD--------FTLNSLTAHRFLLTATTVATKGL 134
           K+    + + ++ L Y D +   Y   PD        F ++S   HR L+T  T+ TK +
Sbjct: 170 KYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTKFM 229

Query: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            D F +N+ YAKVGG+   ELN LE  FL   +++++
Sbjct: 230 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 61/110 (55%), Gaps = 5/110 (4%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----QTVYPD-FTLNSLTAHR 121
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +      + P  F ++S   HR
Sbjct: 234 FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHR 293

Query: 122 FLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++ A TV+TK   D F +N+ YA+VGG+  HELN LE  F    ++ +I
Sbjct: 294 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELI 343

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 63/119 (52%), Gaps = 10/119 (8%)

Query: 63  TLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYID-LLQTVYPD---------F 112
           +L  +H K  P+I+I  YF R+ K+    + V +  L   D + +    D         F
Sbjct: 177 SLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLF 236

Query: 113 TLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++S   HRF++   TV TK L D F +N+ YAKVGG+  HE+N LE  FL   ++++I
Sbjct: 237 VMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 66.6 bits (161), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 82/188 (43%), Gaps = 42/188 (22%)

Query: 26  DFNKCSRTDLVVLISRMLVSLIAIN-------ENSATKKSDD----QITLTR----YHSK 70
           D  K S   L+ +IS +L  LI  N       E S   ++DD    +  L R    +  K
Sbjct: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187

Query: 71  IPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVY---------PD---------- 111
             P I +  YF R+ K+    + VL+  L Y D +  V          P+          
Sbjct: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247

Query: 112 --------FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163
                   F L+S   HR +++A TV+TK   D F +N+ YAKVGG+   E+N LE  FL
Sbjct: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

Query: 164 KRVNYRII 171
              N+ +I
Sbjct: 308 LISNFDLI 315

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 64/126 (50%), Gaps = 13/126 (10%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD-----FTLNSLTAHR 121
           +  K  P I++  YF R+ K+    + V ++ L Y D +           F ++S   HR
Sbjct: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHR 383

Query: 122 FLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCS 181
            +++A TV+TK   D F +N+ YA+VGG+   ELN LE  FL   ++ +I         S
Sbjct: 384 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI--------IS 435

Query: 182 IEQKQK 187
           +E+ QK
Sbjct: 436 VEELQK 441

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 64/126 (50%), Gaps = 13/126 (10%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD-----FTLNSLTAHR 121
           +  K  P I++  YF R+ K+    + V ++ L Y D +           F ++S   HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 122 FLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCS 181
            +++A TV+TK   D F +N+ YA+VGG+   ELN LE  FL   ++ +I         S
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI--------IS 546

Query: 182 IEQKQK 187
           +E+ QK
Sbjct: 547 VEELQK 552

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----QTVYPD-FTLNSLTAHR 121
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +      + P  F ++S   HR
Sbjct: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHR 124

Query: 122 FLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++ A TV+TK   D F +N+ YA+VGG+   ELN LE  F    ++ +I
Sbjct: 125 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELI 174

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 80/173 (46%), Gaps = 32/173 (18%)

Query: 34  DLVVLISRMLVSLIAINEN--------SATKKSDDQITL---TRYHSKIPPNISIFNYFI 82
           D++ +++ +L  +++ N+             K  D  T+   T ++ K  P I+I  Y +
Sbjct: 242 DILQMLTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQITIEQYLL 301

Query: 83  RLTKFSSLEHCVLMTSLYYIDLL--------------------QTVYPDFTLNSLTAHRF 122
           R+ K+    + + ++ L + D +                    Q  +  F ++S   HR 
Sbjct: 302 RIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDSYNIHRL 361

Query: 123 LLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYR-IIPRD 174
           L+   TV+TK   D F +NA YA+VGG+   E+N LE  FL   +++ +IP D
Sbjct: 362 LIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLLIPID 414

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 10/115 (8%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----------QTVYPDFTLNS 116
           +  K  P IS+  YF R+ K+    + V ++ L Y D +          +     F ++S
Sbjct: 337 FRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDS 396

Query: 117 LTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
              HR ++ A TV+TK   D F +N+ YA+VGG+   ELN LE  FL   ++ +I
Sbjct: 397 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 75/165 (45%), Gaps = 28/165 (16%)

Query: 35  LVVLISRMLVSLIAINENSATKKSDDQI-------------TLTRYHSKIPPNISIFNYF 81
           L  L+ +++ S   +N +S+  +S D I             ++  +  K  P IS+  YF
Sbjct: 238 LTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRGKHVPQISLHQYF 297

Query: 82  IRLTKFSSLEHCVLMTSLYYIDLL----------QTVYPD-----FTLNSLTAHRFLLTA 126
            R+ K+    + V ++ L Y D +          Q   P      F ++S   HR ++  
Sbjct: 298 QRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAG 357

Query: 127 TTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            TV TK   D F +N+ YA+VGGV   ELN LE  FL   ++ ++
Sbjct: 358 VTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 61/121 (50%), Gaps = 12/121 (9%)

Query: 63  TLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----QTVYPD------- 111
            +  +  K  P I++  YF R+ K+    + V ++ L Y D +     + + +       
Sbjct: 171 AMLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQ 230

Query: 112 -FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRI 170
            F ++S   HR ++   TV+TK L D F +N+ YAKVGG+   ELN LE  FL   ++ +
Sbjct: 231 IFVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNL 290

Query: 171 I 171
           +
Sbjct: 291 L 291

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 58/119 (48%), Gaps = 14/119 (11%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ------------TVYPD--F 112
           +  K  P I+++ YF R+ K+    + V ++ L Y D +             T   D  F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 113 TLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++S   HR ++   TV TK   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 63/137 (45%), Gaps = 24/137 (17%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQT-------------VYPD-- 111
           +  K  P I++  YF R+ K+    + V ++ L Y D +               V  D  
Sbjct: 211 FKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTL 270

Query: 112 -FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRI 170
            F +NS   HR ++    V+TK   D F +NA YAKVGG+   E+N LE  FL   ++ +
Sbjct: 271 LFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSL 330

Query: 171 IPRDHNITLCSIEQKQK 187
                   L S+E+ ++
Sbjct: 331 --------LISVEEMER 339

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 62/141 (43%), Gaps = 36/141 (25%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ-------------------- 106
           +  K  P IS+  YF R+ K+  + + V ++ L Y D +                     
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 107 ---------------TVYPD-FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGV 150
                           V P  F ++S   HR ++TA TV+TK   D F +N+ YA+VGG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 151 RCHELNILENDFLKRVNYRII 171
              ELN LE  FL   +++++
Sbjct: 328 SLQELNHLELQFLILCDFQLM 348

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 62/133 (46%), Gaps = 28/133 (21%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ--------------TVYPD- 111
           +  K  P I++  YF R+ K+    + VL++ L + D +                  PD 
Sbjct: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDK 299

Query: 112 -------------FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNIL 158
                        F ++S   HR ++ A TV+TK + D F +N+ YA+VGG+   ELN L
Sbjct: 300 TTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHL 359

Query: 159 ENDFLKRVNYRII 171
           E  FL   ++R+I
Sbjct: 360 ELQFLILCDFRLI 372

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 14/113 (12%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ---TVYPD-----------FTLNSLT 118
           P I++  YF R+ K+    + V ++ L Y D +       P            F ++S  
Sbjct: 358 PQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMFVMDSYN 417

Query: 119 AHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            HR ++   TV TK   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 418 IHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 59/136 (43%), Gaps = 31/136 (22%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYID-----------------LLQTVY 109
           +  K  P IS+ +YF R+ K+    + V ++ L Y D                  LQ   
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 110 PD--------------FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHEL 155
           P               F ++S   HR L+   TV+TK   D F +N+ YA+VGG+   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 156 NILENDFLKRVNYRII 171
           N LE  FL   ++ ++
Sbjct: 316 NHLELQFLVLCDFELL 331

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TVATK   D F +NA YAKVGG+   ELN LE  FL   +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 62/146 (42%), Gaps = 41/146 (28%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL--------------------- 105
           +  K  P IS+ +YF R+ K+    + V ++ L Y D +                     
Sbjct: 234 FRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAG 293

Query: 106 ----------QTVYPD----------FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYA 145
                     Q V+ +          F ++S   HR ++  TTV+TK   D F +N+ YA
Sbjct: 294 NNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYA 353

Query: 146 KVGGVRCHELNILENDFLKRVNYRII 171
           +VGG+   ELN LE  FL   ++ ++
Sbjct: 354 RVGGISLQELNYLELQFLILCDFELL 379

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 42/76 (55%), Gaps = 8/76 (10%)

Query: 112 FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV+TK   D F +N+ YA+VGG+   ELN LE  FL   ++ + 
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHL- 221

Query: 172 PRDHNITLCSIEQKQK 187
                  L S+E+ Q+
Sbjct: 222 -------LISVEELQR 230

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 102 IDLLQTVYPD---FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNIL 158
           +D+ +T  P    F ++S   HR ++   TV+TK L D F +N+ Y++VGG+   ELN L
Sbjct: 321 MDVEKTFKPHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHL 380

Query: 159 ENDFLKRVNYRII 171
           E  FL   ++ ++
Sbjct: 381 ELQFLVLCDFELL 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV+TK L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV+TK L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 114 LNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIP- 172
           +NS T HR +L   TV++K L D   +N  YA+  G+   ELN LE  FL+  N+ +   
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNLSVS 286

Query: 173 ----RDHNITLCSIEQ 184
                D+   LCS  Q
Sbjct: 287 LNELEDYGTALCSCSQ 302

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 112 FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV+TK L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 5/109 (4%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD--FTLNSLTAHRFLLTATTVATKG 133
           SIF +   L K S+++   LM S  Y+  L+++ P   + + S T HR  L    +A K 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+ K   G +   ++N +E + L  +N+  I +  ++  C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

Query: 34  DLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHC 93
           +++  +S    S I I   S +  +++ I      S IPP   ++ +   L   S+++  
Sbjct: 19  EMIQFLSNCAASAIQIRPTSDSNLTNESI------SNIPP---LYTFIKNLVAHSNVQTP 69

Query: 94  VLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVATKGLCDSFSTNAHYAKV--GGV 150
            LMT++ Y+  L+ + P        T HR  L    +A K L DS   N H+AK   G +
Sbjct: 70  TLMTTVVYLKKLKAIIPSNVYGIETTRHRMFLGCLIIAAKTLNDSSPLNKHWAKYTNGLL 129

Query: 151 RCHELNILENDFL 163
           +  E+N +E + L
Sbjct: 130 QLREVNTIEREIL 142

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 11/105 (10%)

Query: 72  PPNISIF--NYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD--FTLNSLTAHRFLLTAT 127
           PP++SIF  N  I+    S+++   LM +  Y++ L++V P   + +N+ T HR  L   
Sbjct: 46  PPDLSIFIKNVVIQ----SNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCL 100

Query: 128 TVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            +A K L DS   N H+     G +R  E+N +E + L+ +N+ +
Sbjct: 101 ILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV 145

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 82/177 (46%), Gaps = 22/177 (12%)

Query: 27  FNKCSRT-DLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLT 85
           FNK + + +++  ++    S+I +  +S  K +   I        IP   ++ N+   L 
Sbjct: 10  FNKRAVSHEMIQFLASTTASIIQVKPHSEPKTNTAHI--------IP---TLSNFIKALI 58

Query: 86  KFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVATKGLCDSFSTNAHY 144
           K S+++   LM +  Y+  L+++ P        T HR  L    +A K L DS   N H+
Sbjct: 59  KHSNVQTPTLMATTVYLSKLKSIIPCNVYGIETTRHRIFLGCLILAAKTLNDSSPMNKHW 118

Query: 145 AKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC-------SIEQKQKKFVID 192
           A+   G ++  E+N +E + L+  ++ +  +  ++ +C        IEQ  +K  +D
Sbjct: 119 AQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIICLSPLLQPIIEQSLRKNQMD 175

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTA-HRFLLTATTVATKGL 134
           S+ ++   + K+S ++   LM S  +++ L+ + P +     TA HR  L    +A+K L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+ K   G +   E+N +E + L+ +++ +
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 59/133 (44%), Gaps = 14/133 (10%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVAT 131
           P  S+ N+   L   S+++   LM +  Y+  L+++ P        T HR  L    +A 
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIETTRHRIFLGCLILAA 104

Query: 132 KGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC--------- 180
           K L DS   N H+A    G +  HE+N +E + L+  ++ +     ++  C         
Sbjct: 105 KTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLAPFLQPIK 164

Query: 181 --SIEQKQKKFVI 191
              I QKQ+ +++
Sbjct: 165 EQFIRQKQQNYLL 177

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  RL +++++    L+T++ Y++ L+ + P D T    T HR  L    ++ K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
            DS   N H+AK   G     ++N++E   L+ +N+
Sbjct: 114 NDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVATKG 133
           +S+ N+   L   S+++   LM++  Y+  L+++ P   L    T HR  L    +A K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+A    G +   E+N +E + L+  ++ +      + +C
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAIC 153

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 65/137 (47%), Gaps = 12/137 (8%)

Query: 39  ISRMLVSLIAINENS--ATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLM 96
           +S+ ++  +A +  S    +K+D  +     H   PP +SIF    ++   S+++   LM
Sbjct: 15  VSQEMIQFLATSTASIIQIRKNDSPV-----HGCPPPELSIF--IKKVVVQSNVQTPTLM 67

Query: 97  TSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVATKGLCDSFSTNAHYAKV--GGVRCH 153
            +  Y++ L+++ P        T HR  L    +A K L DS   N H+     G ++  
Sbjct: 68  ATTVYLNKLKSIIPKNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLKVR 127

Query: 154 ELNILENDFLKRVNYRI 170
           E+N +E + L+  N+ +
Sbjct: 128 EVNTIERELLEYFNWDV 144

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 76/170 (44%), Gaps = 31/170 (18%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  +L +++++    L+T+  Y+  LQ + P D T    T HR  L    ++ K  
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLACLIISAKYH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITL------------C 180
            DS   N H+A+   G     ++N++E   L  +N+ +   ++++ L             
Sbjct: 114 NDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNWDLRINENDLILDLRHLLEPIMRDL 173

Query: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKS------GYNVLDKYYRRI 224
            I  ++KK +  K+       + + Y+ RP S       YN   K+YR++
Sbjct: 174 EISYQRKKILKSKS-------EQHQYIQRPVSPISPTKSYN---KFYRQV 213

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 5/101 (4%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVAT 131
           P++++F    RL   S+++   LM++L Y+  L+ + P D      T HR  +    +A 
Sbjct: 45  PSLALF--IKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAA 102

Query: 132 KGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           K L DS   N H+ +   G  +  E+N +E + L+  N+ +
Sbjct: 103 KSLNDSSPLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 75/150 (50%), Gaps = 18/150 (12%)

Query: 26  DFNKCSRT-DLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRL 84
           +FNK + T +++  +S +  S+I +      ++S+  I++      +PP   +  +   L
Sbjct: 9   EFNKKTVTKEMIAYLSNITESIIQV------RRSNSMISIA-----LPPP-PLVKFITNL 56

Query: 85  TKFSSLEHCVLMTSLYYIDLLQTVYPD--FTLNSLTAHRFLLTATTVATKGLCDSFSTNA 142
              S+++   LM +  Y+  L+ + P   + + S T HR  L    +A+K L DS   N 
Sbjct: 57  CLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLILASKTLNDSSPLNK 115

Query: 143 HYAKV--GGVRCHELNILENDFLKRVNYRI 170
           H+A+   G ++  E+N +E + L+  ++ I
Sbjct: 116 HWARYTSGILQLREVNTIERELLEYFDWNI 145

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 9/122 (7%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  +L +++++    L+T++ Y+  L+T+ P D T    T HR  L    ++ K  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLK------RVNYRIIPRDHNITLCSIEQKQ 186
            DS   NAH+++   G     ++N++E   L+      R+N   + +D    L  I++  
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALAQDLQWLLLPIKEDL 174

Query: 187 KK 188
           K+
Sbjct: 175 KR 176

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  RL +++++    L+ ++ Y++ L+ + P D T    T HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+A+   G     ++N++E   L+ +N+ I
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDI 151

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 83/195 (42%), Gaps = 19/195 (9%)

Query: 26  DFNKCSRT-DLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRL 84
            FNK S + ++V  ++    S+I + + +    +++ I +     +IPP   + N+   L
Sbjct: 9   QFNKKSVSHEMVHFLATNTASIIQVKKGNNIVTTENGIPI-----EIPP---LSNFIKNL 60

Query: 85  TKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVATKGLCDSFSTNAH 143
              S+++   LM +  Y+  L+ + P        T HR  L    +A K L DS   N H
Sbjct: 61  VMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLILAAKTLNDSSPLNKH 120

Query: 144 YAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC--SIEQKQKKFVIDKNALGSL 199
           + K   G +   E+N +E + L+   + +      +  C     Q  K+ +I +      
Sbjct: 121 WTKYTDGLLHIREVNTIERELLEYFEWNVTITTSELIKCLSPFLQPIKEQIIKRQ----- 175

Query: 200 DLDSYSYVNRPKSGY 214
              +Y + N P  G+
Sbjct: 176 QQQNYMFFNAPTPGH 190

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLL 124
           ++ +++P   S+  +  RL +++++    L+T+  Y++ L+ + P D T    T HR  L
Sbjct: 47  KHMARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFL 103

Query: 125 TATTVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
               ++ K   DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 8/116 (6%)

Query: 69  SKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD--FTLNSLTAHRFLLTA 126
           S  PP   +  +   L  +S+++   LM +  Y+  L+++ P   F + + T HR  L  
Sbjct: 42  SPAPP---LMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGC 97

Query: 127 TTVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
             +A K L DS   N H+A    G +   E+N +E + L+  ++ +      +  C
Sbjct: 98  LILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  RL +++++    L+T+  Y++ L+ + P D T    T HR  L    ++ K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
            DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLL 124
           ++ +++P   S+  +  RL +++++    L+T+  Y++ L+ + P D T    T HR  L
Sbjct: 47  KHLTRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFL 103

Query: 125 TATTVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
               ++ K   DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 53/111 (47%), Gaps = 9/111 (8%)

Query: 72  PPNISIF--NYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATT 128
           PP++S F  N  I+    S+++   LM +  Y++ L+ + P        T HR  L    
Sbjct: 47  PPDLSTFIKNVVIQ----SNVQTPTLMATSVYLNKLRNIIPRNVYGIETTRHRIFLGCLI 102

Query: 129 VATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNI 177
           +A K L DS   N H+     G +R  E+N +E + L+  N+ +    H++
Sbjct: 103 LAAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDVRITTHDL 153

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVA 130
           PP     N   RL K S+++   LM +  Y+  L+++ P        T HR  L    +A
Sbjct: 47  PPLTEFIN---RLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLILA 103

Query: 131 TKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
            K L DS   N H+A+   G +   E+N +E + L+  ++ +     ++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVATKG 133
           +S+ ++   L   S+++   LM+++ Y+  L+++ P        T HR  L    +A K 
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKN 101

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+++   G +   E+N +E + L+  ++++     ++  C
Sbjct: 102 LNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITC 150

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 65/140 (46%), Gaps = 6/140 (4%)

Query: 44  VSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYID 103
           VS+  I   ++T  S  Q+      +K+   +S+ ++   L   S+++   LM++  Y+ 
Sbjct: 15  VSMEMIEFLASTSNSVIQVRTGESSAKV---VSLVDFIKGLVVQSNVQTPTLMSTAVYLS 71

Query: 104 LLQTVYP-DFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKV--GGVRCHELNILEN 160
            L+++ P +      T HR  L    +A K L DS   N H+A    G +   E+N +E 
Sbjct: 72  KLRSIIPANVHGMETTRHRVFLGCLIIAAKNLNDSSPMNKHWASYTNGLLNTREVNTIER 131

Query: 161 DFLKRVNYRIIPRDHNITLC 180
           + L+  ++ +     ++  C
Sbjct: 132 ELLEYFDWNLRISTQDLVTC 151

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVA 130
           PP     N   RL K S+++   LM +  Y+  L+++ P        T HR  L    +A
Sbjct: 47  PPLTKFIN---RLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILA 103

Query: 131 TKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
            K L DS   N H+A+   G +   E+N +E + L+  ++ +     ++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVA 130
           PP +   N   RL K S+++   LM +  Y+  L+++ P        T HR  L    +A
Sbjct: 47  PPLVKFIN---RLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLILA 103

Query: 131 TKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            K L DS   N H+A+   G +   E+N +E + L   ++ +
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDV 145

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTA-HRFLLTATTVATKG 133
           +S+ ++   L K S+++   LM+++ Y+  L+++ P       T+ HR  L    +A K 
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN 102

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+ +   G +   E+N +E + L+  N+ +   + ++  C
Sbjct: 103 LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVAT 131
           P +S+ ++   L   S+++   LM+++ Y+  L+++ P        T HR  L    +A+
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 132 KGLCDSFSTNAHYAKVGG--VRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           K L DS   N H+ +     +   E+N +E + L+  N+ ++  + ++  C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AEL195W
          Length = 370

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  ++ +++++    L+T++ Y++ L+ V P D T    T+HR  L    ++ K  
Sbjct: 115 SLTTFIAKIVRYTNVYTATLLTTVVYLNKLKKVLPKDATGIPSTSHRIFLACLILSAKFH 174

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNI 177
            DS   N H+ +   G     ++N++E   LK  ++ I   +H++
Sbjct: 175 NDSSPLNKHWTEYTDGLFTIQDVNLMERQLLKLFDWNIRVSEHDL 219

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 71  IPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTV 129
           IP   S+  +  R+ ++++++   L+ ++ Y++ L+ + P D      T HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 130 ATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITL 179
           + K   DS   N H+A    G     ++N++E   L  +++ +   +H I L
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNLQLTEHEIIL 166

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 71  IP-PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATT 128
           IP P + +F    +L K+S+++   LM +  ++  L+++ P        T HR  L    
Sbjct: 44  IPAPKLELF--IKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLI 101

Query: 129 VATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           ++ K L DS   N H+A+   G +   E+N +E + L+  ++ +
Sbjct: 102 LSAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVA 130
           PP  ++  +   L   S +    LM S  Y+  L+ + P   +    T HR  L    +A
Sbjct: 44  PPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIA 103

Query: 131 TKGLCDSFSTNAHYAKVGG--VRCHELNILENDFLKRVNYRI 170
            K L D+   N H++K     +   E+NI+E + L  + +R+
Sbjct: 104 AKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 3/107 (2%)

Query: 65  TRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFL 123
           T    K P   S+  +  +L +++++    L+T++ Y++ L+ + P D      T HR  
Sbjct: 48  TELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLF 107

Query: 124 LTATTVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
           L    ++ K   DS   N H+AK   G     ++N++E   L  +N+
Sbjct: 108 LACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNW 154

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 77  IFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVATKGLC 135
           +F +  ++   S+++   LM +  Y++ L+ + P        T HR  L    +A K L 
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIETTRHRIFLGCLILAAKTLN 107

Query: 136 DSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           DS   N H++    G ++  E+N +E + L+  N+ +
Sbjct: 108 DSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 69  SKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSL--TAHRFLLTA 126
           SK+P   S+  +  +L +++++    L+T+  Y+  LQ + P    N L  T HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLAC 108

Query: 127 TTVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
             ++ K   DS   N H+A+   G     ++N++E   L  +N+ I
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDI 154

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 65/161 (40%), Gaps = 8/161 (4%)

Query: 16  QGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNI 75
           + IPK+   +D    S+    + +   L   I  N N+    S+D      +  K PP++
Sbjct: 305 ESIPKIPELSDDEALSKFRENIELILQLSKKINDNANTLAISSEDPQKFVNFVMKNPPSL 364

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDF--------TLNSLTAHRFLLTAT 127
           S  ++  R+         V + + Y + L+     +          L    AHR +++  
Sbjct: 365 SFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMDGPIKLKAKLQEDQAHRIIISTI 424

Query: 128 TVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNY 168
            +ATK L D   +  +  KV G+    L  LE  F+  VN+
Sbjct: 425 RIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNF 465

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVA 130
           PP     N  I   K S+++   LM +  Y+  L+++ P        T HR  L    +A
Sbjct: 47  PPLTKFINGLI---KHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILA 103

Query: 131 TKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            K L DS   N H+A+   G +   E+N +E + L+  ++ +
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDV 145

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 52/103 (50%), Gaps = 6/103 (5%)

Query: 69  SKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTAT 127
           SK+P   S+ ++  RL + +++    L+ +  Y++ L+ + P D +    T HR  L   
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPSTIHRMFLACL 139

Query: 128 TVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
            ++ K   DS   N H+AK   G     ++N++E   ++ +N+
Sbjct: 140 ILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNW 182

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 50/104 (48%), Gaps = 6/104 (5%)

Query: 68  HSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTA 126
           H+ +P   S+  +  RL +++++    L+T++ Y++ L+ + P D      T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 127 TTVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
             ++ K   DS   N H+ K   G     ++N++E   L+   +
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW 153

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 70  KIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATT 128
           K+P   S+ ++  RL + +++    L+T+  Y++ L+ + P D +    T HR  L    
Sbjct: 48  KLP---SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPSTVHRIFLACLI 104

Query: 129 VATKGLCDSFSTNAHYAKVGG--VRCHELNILENDFLKRVNY 168
           ++ K   DS   N H+AK         ++N++E   ++ +N+
Sbjct: 105 LSAKFHNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 47/109 (43%), Gaps = 8/109 (7%)

Query: 59  DDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD------- 111
           D+ I  + +  K PP++S  ++  R+      +  V + + Y +  L  +  +       
Sbjct: 332 DEMIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKL 391

Query: 112 -FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILE 159
            F       HR ++    +ATK L D   ++ ++ KV G+    L+ LE
Sbjct: 392 RFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLE 440

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 64/161 (39%), Gaps = 8/161 (4%)

Query: 16  QGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNI 75
           + IPK+   +D    S+    + +   L   I  N N     S+D      +  K PP++
Sbjct: 305 ESIPKIPNLSDNEALSKFRENIELILQLSKKIDENANILAISSEDPQKFVNFVMKNPPSL 364

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFT--------LNSLTAHRFLLTAT 127
           S  ++  R+         V + + Y + L+     +          L    AHR +++  
Sbjct: 365 SFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMNGPIKLKTKLQEDQAHRIIISTI 424

Query: 128 TVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNY 168
            +ATK L D   +  +  KV G+    L  LE  F+  VN+
Sbjct: 425 RIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMACVNF 465

>Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W
           (REAL)
          Length = 501

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 73/179 (40%), Gaps = 28/179 (15%)

Query: 34  DLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHC 93
           DL++ +S+     I  N N     ++D      +  K PP++S  ++  R+         
Sbjct: 336 DLILQLSKK----IDENANILAISAEDPQKFVNFTMKNPPSLSFKDFIDRIQNKCMFGAI 391

Query: 94  VLMTSLYYIDLLQTVYPDFTLNSLTA-------------HRFLLTATTVATKGLCDSFST 140
           V + + Y   LLQ V+   T + L               HR +++   +ATK L D   +
Sbjct: 392 VYLGATY---LLQLVF--LTRDELDGPIKLKAKLQEDQTHRIIISTIRIATKLLEDFVHS 446

Query: 141 NAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVID-KNALGS 198
             +  KV G+    L  LE  FL  VN+     D  +  C   +K    + D + ALGS
Sbjct: 447 QNYICKVFGISKRLLTKLEISFLASVNF-----DGLMITCEKLEKTSHILDDTRQALGS 500

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  RL +++++    L+T++ Y++ L+ + P D T    T HR  L    ++ K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILE 159
            DS   N H+ K   G     ++N++E
Sbjct: 114 NDSSPLNKHWVKYTDGLFTLEDVNLME 140

>Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W
           (REAL)
          Length = 500

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 51/125 (40%), Gaps = 8/125 (6%)

Query: 52  NSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD 111
           N+    S+D      +  K PP++S  ++  R+         V + + Y + L+     +
Sbjct: 349 NTLAVSSEDPQKFVNFIMKNPPSLSFKDFIDRIQNKCMFGSVVYLGATYLLQLVFLTRDE 408

Query: 112 FT--------LNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163
                     L    AHR +++A  + TK L D   +  +  KV G+    L  LE  F+
Sbjct: 409 MNGPVKLKAKLQEDQAHRVIISAIRITTKLLEDFVHSQNYICKVFGISKRLLTKLEISFM 468

Query: 164 KRVNY 168
             VN+
Sbjct: 469 ASVNF 473

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLT 125
           Y  ++P   S+  +   L +++++    L+T++ Y++ L+ + P D T    T HR  L 
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLA 104

Query: 126 ATTVATKGLCDSFSTNAHYAKV--GGVRCHELNILE 159
              ++ K   DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {ON}
           Anc_3.70 YNL289W
          Length = 268

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  RL  ++++    L+T+  Y++ L+ + P + +    T HR  L    ++ K  
Sbjct: 46  SLQTFITRLVNYTNVPSGTLLTTAVYLNRLKQLLPAEASGIQSTRHRIFLACLILSAKYN 105

Query: 135 CDSFSTNAHYAK-VGGVRC-HELNILENDFLKRVNYRIIPRDHNI 177
            DS   N H+      + C +++N++E   LK +N+ +   +H++
Sbjct: 106 NDSSPLNIHWMNHTNDLFCLNDINLMERQLLKLLNWDLSITEHDL 150

>ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|Q04636 Saccharomyces
           cerevisiae YML069W POB3 facilitates RNA Polymerase II
           transcription elongation
          Length = 574

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 10/69 (14%)

Query: 118 TAHRFLLTATTVAT----KGLCDSF-----STNAHYAKVGGVRCHELNILENDFLKRVNY 168
           T   FLL AT ++T    +G C  F     + N    ++ G    + N+++NDF +R N 
Sbjct: 41  TKQPFLLPATELSTVQWSRG-CRGFELKVNTKNQGVVQLDGFAPDDFNLIKNDFHRRFNV 99

Query: 169 RIIPRDHNI 177
           ++ P++H++
Sbjct: 100 QVEPKEHSL 108

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 54/120 (45%), Gaps = 8/120 (6%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKG 133
           +S+ ++   L + S+++   LM +  Y+  L+++ P D      T HR  +    +A K 
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKN 103

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVI 191
           L DS   N H+     G     ++N +E + L   ++ +     N ++  + Q    F++
Sbjct: 104 LNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL-----NFSMQELVQALSHFLV 158

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 51  ENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----- 105
           ENSA K   D    +R+  K  P++S  ++  R+      +  V +++ Y + +L     
Sbjct: 337 ENSAVKSEHD--LCSRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERS 394

Query: 106 ---QTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGV 150
               ++   F L     HR ++    ++TK L D   ++ +++KV GV
Sbjct: 395 AESNSLELKFKLQRDGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly
           similar to uniprot|P53124 Saccharomyces cerevisiae
           YGL134W PCL10 Pho85p cyclin recruits activates and
           targets Pho85p cyclin-dependent protein kinase to its
           substrate
          Length = 484

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 52/103 (50%), Gaps = 6/103 (5%)

Query: 73  PNISIFNYFIRL-TKFS-----SLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTA 126
           P ++  +Y  RL  KFS      L    L+ +L+   + + ++    L+    HR ++ +
Sbjct: 358 PTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFLTRVDEELHCKHHLDPRQVHRLVIAS 417

Query: 127 TTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYR 169
             +ATK L D   ++++++++ G+    L  LE  FL+ +N+ 
Sbjct: 418 IRLATKLLEDCVHSHSYFSRICGISKKLLTKLEVAFLECLNFE 460

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  RL +++++    L+T+  Y++ L+ + P D      T+HR  L    ++ K  
Sbjct: 59  SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTSHRIFLACLILSAKFH 118

Query: 135 CDSFSTNAHYAK-VGGVRCHE-LNILE 159
            DS   N H+A    G+ C E +N++E
Sbjct: 119 NDSSPQNKHWAAYTDGLFCLEDVNLME 145

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 88  SSLEHCVLMTSLYYIDLLQTVYPD--FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYA 145
           S+++   LM +   ++ L+ + P   + + S T HR  L    ++ K L DS   N H+A
Sbjct: 60  SNVQTPTLMATTVLLEKLKKIIPSNVYGIES-TRHRIFLGCLILSAKSLNDSSPLNKHWA 118

Query: 146 KVGGVRCH--ELNILENDFLKRVNYRI 170
           K      H  E+N +E + L   ++ +
Sbjct: 119 KYTESYIHLREVNTIERELLNYFDWNV 145

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMT-SLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGL 134
           SI  +  RL +++++    L+T ++Y   L   +  D T    TAHR  L    ++ K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLK------RVNYRIIPRDHNITLCSIE 183
            DS   N H+ K   G     ++N++E   L+      RV +R + RD    L  I+
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRDLAPLLAPIK 169

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 57  KSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN- 115
           K++  I + + +S  P  +S+F     L   S ++   LM +  Y+D L  + P      
Sbjct: 37  KTNSMIKIKKTNSPKPVELSLF--VEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGI 94

Query: 116 SLTAHRFLLTATTVATKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
             T HR  L    +++K L DS   N H+ K   G +   E+N +E + L   N+ I
Sbjct: 95  ETTKHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELLSYFNWDI 151

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  RL +++++    L+T+  Y++ L+ + P D      T HR  L    ++ K  
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTGHRIFLACLILSAKYH 146

Query: 135 CDSFSTNAHYAK-VGGVRC-HELNILE 159
            DS   N H+A    G+ C  ++N++E
Sbjct: 147 NDSSPQNKHWAAYTDGLFCLDDVNLME 173

>Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {ON}
           YPL219W (PCL8) - cyclin (Pho85p) [contig 165] FULL
          Length = 480

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 67/152 (44%), Gaps = 7/152 (4%)

Query: 46  LIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL 105
           L+ +++N+     +    L  ++    P ++   Y  RL    S    V +T+ + +  L
Sbjct: 327 LLVLSKNANVPLGNPPPQLATFNMDSTPTLAYEEYLQRLHCKFSFAPIVYLTAAHLLQSL 386

Query: 106 QTVYPD------FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILE 159
                D      + L++   HR ++ +  +ATK L D   ++  ++++ G+    L  LE
Sbjct: 387 FLTRKDNKLCCKYHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLE 446

Query: 160 NDFLKRVNYRIIPRDHNITLCSIEQKQKKFVI 191
             FL  +N+  + +  N +L    Q Q++  +
Sbjct: 447 IAFLNCINFEGL-KITNHSLLQAAQVQQELSV 477

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYP-DFTLNSLTAHRFLLTATTVATKGL 134
           S+  +  RL +++++    L+T++ Y++ L+ + P D      T HR  L    ++ K  
Sbjct: 59  SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLFLACLIISAKFH 118

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILE 159
            DS   N H+ +   G     ++N++E
Sbjct: 119 NDSSPLNKHWTRYTDGLFSLEDINLME 145

>KLLA0E20791g Chr5 complement(1852522..1855323) [2802 bp, 933 aa]
           {ON} some similarities with uniprot|P25302 Saccharomyces
           cerevisiae YER111C SWI4 Involved in cell cycle dependent
           gene expression transcription factor
          Length = 933

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 214 YNVLDKYYRRIVQLVGSFNASPDKSRKVDYV--LPPNIDIVSESGSQTTQLKGSSSPNSH 271
           YN+ +K  +RIV+ +   N  P +  KV  +  L PN  I S S  + T  K + +P   
Sbjct: 184 YNINNKVVKRIVEFIPDPNDMPPRRSKVSQIKKLDPNARITSPSAYKKTPKKNAKTPMKK 243

Query: 272 SSQKR 276
            S +R
Sbjct: 244 KSIRR 248

>Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W
           (REAL)
          Length = 442

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 68/160 (42%), Gaps = 15/160 (9%)

Query: 12  IHEDQGIPKVILPADFNKCSRT-DLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSK 70
           IH D  +P + +    +  S T +L++ +S+      AI  N  T+K         ++ K
Sbjct: 260 IHGDTDVPHISVEEALSNLSGTINLLLELSK--DEKCAIFNNKETEKE-----YANFYMK 312

Query: 71  IPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD-------FTLNSLTAHRFL 123
             P++S  ++  R+      E  V + + + +D +     D         L     HR +
Sbjct: 313 SKPSLSSVDFLKRIQDKCEYESTVYLVATFLMDTIYLTRNDNDVLQLKLKLQEKEIHRMI 372

Query: 124 LTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163
           +    ++TK L D   ++ +++KV GV    L+ LE   L
Sbjct: 373 IATVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEVSLL 412

>YDR515W Chr4 (1473429..1474772) [1344 bp, 447 aa] {ON}  SLF1RNA
           binding protein that associates with polysomes; proposed
           to be involved in regulating mRNA translation; involved
           in the copper-dependent mineralization of copper sulfide
           complexes on cell surface in cells cultured in copper
           salts
          Length = 447

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 152 CHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSLDLDSYSYVNRP 210
             + N LEN F++R N+     + N      E +  K+ I+K  LG  DLD+YSY+  P
Sbjct: 360 ADDFNPLENYFIRRENWAEYAMESNFDENDDETE--KYNIEK-LLGPNDLDNYSYMGYP 415

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/98 (20%), Positives = 45/98 (45%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN-SLTAHRFLLTATTVATKGL 134
           ++  +  +L +++ +    L+ ++ Y++ L+ + P        T HR  L    ++ K  
Sbjct: 55  TLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLHRIFLACLIISAKNH 114

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+ K   G     ++N++E   L  +N+ +
Sbjct: 115 NDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>NDAI0C03140 Chr3 (715356..717473) [2118 bp, 705 aa] {ON} Anc_5.117
           YLR047C
          Length = 705

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 155 LNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSLDL 201
           LNI   +F+KR+ ++IIP  H  T+ ++   +   +I +N  G L L
Sbjct: 308 LNICHKNFIKRIFFKIIPFQHPFTIATLPTDETIKLIIRN--GQLPL 352

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 12/104 (11%)

Query: 76  SIFNYFIRLTKFS-SLEHCVLMTSLYYIDLLQTVY------PDFTLNSLTAHRFLLTATT 128
           SI  Y + + K S S  + V++ S Y+  L  +V       P+F      + R  L+   
Sbjct: 87  SIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEFVH---CSKRIFLSCLI 143

Query: 129 VATKGLCD-SFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           ++ K L D +FS  A ++ + G+   +L+ILE   L R+NY ++
Sbjct: 144 LSHKFLNDKTFSMKA-WSLISGISKRDLSILERWCLMRLNYHLV 186

>Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W
           (REAL)
          Length = 437

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 12  IHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKI 71
           I  D  +P + +        RT  + L+ ++  +   I  NS  +K +       ++ K 
Sbjct: 253 ISGDVEVPHIPVGEALENLKRT--IDLLLKLSNNKSCIGSNSGMEKKE----YANFYMKS 306

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL---------QTVYPDFTLNSLTAHRF 122
            P++S  ++  R+      E  V + +++ I++L           +     L     HR 
Sbjct: 307 KPSLSSVDFLKRIQDKCKYEPTVYLVAMFLIEMLFLTRNKNGDDGLQLKRKLKEKEVHRV 366

Query: 123 LLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163
           ++ A  ++TK L D   ++ +++KV G+    L  LE   L
Sbjct: 367 IIAAVRLSTKLLEDYVHSHEYFSKVCGISKRLLTKLEVSLL 407

>NCAS0D01640 Chr4 (309081..311141) [2061 bp, 686 aa] {ON} Anc_5.117
           YLR047C
          Length = 686

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 148 GGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSLDLDSYSYV 207
           G VR   + I+EN+FLKR  +++IP  H  T+ S+       +I +N    L  +S  Y+
Sbjct: 306 GHVR---IQIVENNFLKRWFHKLIPLQHPYTISSLPTDDTVKLIIRNGNFPLKSNSKYYI 362

>Kpol_228.1 s228 (611..2293) [1683 bp, 560 aa] {ON} (611..2293)
           [1683 nt, 561 aa]
          Length = 560

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 14/122 (11%)

Query: 49  INENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTV 108
           +N+N+ TK+    +    ++ K  P +S  +   R+         + + S Y   LLQ++
Sbjct: 406 VNDNNKTKEEAINLEYNHFNMKSVPTVSYKDLLNRIHTKCMFGSIIYLGSTY---LLQSL 462

Query: 109 Y--PDFTLNSL---------TAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNI 157
               DF  NSL           HR ++ +  VATK L D   ++ +  KV G+    L  
Sbjct: 463 ILERDFEDNSLRIRRKLKSTEIHRVVIASIRVATKLLEDFVHSHEYITKVCGISKKLLTK 522

Query: 158 LE 159
           LE
Sbjct: 523 LE 524

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,112,263
Number of extensions: 1416138
Number of successful extensions: 4952
Number of sequences better than 10.0: 135
Number of HSP's gapped: 5042
Number of HSP's successfully gapped: 137
Length of query: 293
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 184
Effective length of database: 40,982,805
Effective search space: 7540836120
Effective search space used: 7540836120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)