Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YNL270C (ALP1)1.83ON57357327460.0
Smik_14.671.83ON57357324590.0
Skud_14.701.83ON57357324540.0
Suva_14.731.83ON49748022440.0
Suva_5.41.83ON59053919080.0
CAGL0J08184g1.83ON57253918910.0
Smik_5.241.83ON59052318830.0
YEL063C (CAN1)1.83ON59052618720.0
Skud_5.261.83ON59054018530.0
NDAI0A006101.83ON56554018240.0
NCAS0B085701.83ON53252818130.0
KNAG0C007901.83ON57950917990.0
TDEL0C061801.83ON58351217890.0
SAKL0C02662g1.83ON54854417770.0
TPHA0B044801.83ON60351217690.0
Kpol_2000.651.83ON59552417650.0
NCAS0A006001.83ON54453417400.0
SAKL0C02640gsingletonON54854717380.0
SAKL0C02684gsingletonON58855517420.0
NDAI0F042001.83ON56651817310.0
KNAG0C05920singletonON59951217330.0
TBLA0A054501.83ON60651217090.0
KLLA0C02343g1.83ON58153217060.0
KAFR0D007001.83ON57455016870.0
Kpol_2000.641.84ON61053716860.0
Smik_14.681.84ON61150616850.0
YNL268W (LYP1)1.84ON61153616830.0
Skud_14.711.84ON61250816790.0
Suva_14.751.84ON61150816650.0
KAFR0D039401.83ON59753616620.0
Kwal_33.134011.83ON55954416520.0
TDEL0C061701.84ON57354616460.0
KLTH0F02398g1.83ON55552316410.0
NDAI0F041901.84ON59950516410.0
CAGL0J08162g1.84ON59750916400.0
ZYRO0F16654g1.83ON58053816370.0
SAKL0C02728g1.84ON56254916320.0
NCAS0A006101.84ON60750516350.0
Ecym_10871.83ON57053216300.0
TPHA0B044701.84ON59953416270.0
KLTH0F02420g1.84ON62153316160.0
Ecym_10881.84ON56755116070.0
KNAG0F004801.84ON59754816080.0
TBLA0A054601.84ON60852616050.0
Kwal_33.134111.84ON56053715960.0
KLLA0C02365g1.84ON57953215920.0
AFR668W1.83ON55653515340.0
AFR667C1.84ON56352214910.0
ZYRO0F16632g1.84ON60754014900.0
Kpol_358.3na 1ON5755068791e-110
CAGL0A01199gna 1ON6135048781e-110
SAKL0G14916gna 1ON5815218471e-105
KNAG0L02470singletonON6384908431e-104
TBLA0A07060na 1ON6254838371e-103
TPHA0M00130singletonON6114868361e-103
Kwal_33.15545na 1ON5765118331e-103
NCAS0D02260na 1ON5975078341e-103
KAFR0B06430singletonON5934998311e-103
KLLA0E16281gna 1ON6055158291e-102
Kwal_26.69407.44ON5705078241e-102
Suva_16.40na 1ON6064928151e-100
NDAI0I02660na 1ON5945138101e-100
YPL265W (DIP5)na 1ON6084928082e-99
Smik_6.473na 1ON6064928031e-98
Skud_16.12na 1ON6074998003e-98
KNAG0E003907.44ON5995647976e-98
SAKL0C01232gsingletonON6134867987e-98
KNAG0L02460singletonON5884997881e-96
KLTH0D01474g7.44ON6244847911e-96
NDAI0E038007.44ON6215247891e-96
Kpol_367.77.44ON5845067862e-96
KLTH0B01166gna 1ON5774827852e-96
CAGL0E05632g7.44ON5984787863e-96
TPHA0H028507.44ON6015157863e-96
TPHA0B010901.244ON6064797838e-96
TDEL0C00930singletonON5954927802e-95
Ecym_2480na 1ON5864787757e-95
SAKL0B10956g7.44ON5725227747e-95
KAFR0D00510na 2ON6175127778e-95
Ecym_60211.244ON6004897741e-94
ZYRO0D03762g1.244ON6004827742e-94
CAGL0B01012g1.50ON6235307691e-93
ZYRO0D17908gna 1ON5184967602e-93
KNAG0C02140singletonON5985267621e-92
Kwal_27.126811.244ON5934797611e-92
KAFR0D005001.50ON6175027612e-92
TDEL0H040707.44ON5775017582e-92
SAKL0C01650g1.50ON6134867612e-92
NCAS0B085801.50ON6275487603e-92
YOR348C (PUT4)7.44ON6275177595e-92
AFR156W7.44ON5584907521e-91
NDAI0G060301.368ON5994817551e-91
Smik_15.5327.44ON6315177571e-91
Ecym_80357.44ON5635097521e-91
KLTH0E15642g1.244ON5964757541e-91
SAKL0F09790gsingletonON5585137468e-91
TDEL0A08030singletonON5144917411e-90
NDAI0B052201.244ON6115297491e-90
KLTH0F01584g1.50ON5964937453e-90
NCAS0E022607.44ON5935147453e-90
TBLA0C01240singletonON6295077464e-90
Kpol_543.791.244ON6055027436e-90
Smik_4.7901.50ON6634887461e-89
Suva_2.6881.50ON6614927451e-89
Suva_8.4027.44ON6835187462e-89
Kpol_2000.921.50ON6375027413e-89
YDR508C (GNP1)1.50ON6634907433e-89
SAKL0D00836gna 3ON6014587341e-88
Skud_15.5157.44ON6265177361e-88
Skud_11.2751.244ON6025647341e-88
Skud_3.381.50ON6334977352e-88
TPHA0E036601.50ON6474847352e-88
Kwal_33.132041.50ON6075017297e-88
Skud_4.7841.50ON6634887339e-88
Kwal_23.4026singletonON5344777231e-87
Ecym_26643.285ON5754977261e-87
KAFR0A011203.284ON5924887271e-87
CAGL0L03267g1.244ON5975017262e-87
Kwal_33.154075.158ON5874967243e-87
Smik_3.531.50ON6335167264e-87
Suva_2.716singletonON6035057244e-87
Ecym_47895.158ON5884817234e-87
TBLA0A051801.50ON6765187286e-87
Suva_4.3073.284ON6095107211e-86
Suva_3.1891.50ON6335167231e-86
KLLA0A11770g5.158ON5815177191e-86
SAKL0G14014g5.158ON6055057201e-86
YCL025C (AGP1)1.50ON6335167221e-86
TDEL0C065101.50ON6425027222e-86
NCAS0A089201.368ON5994897192e-86
CAGL0H08393g3.284ON6125127192e-86
NDAI0C029505.158ON6095167193e-86
YBR068C (BAP2)3.284ON6095037193e-86
NDAI0A006401.50ON6415047213e-86
KAFR0D04120na 4ON6485147195e-86
KLLA0C01606g1.50ON6205237185e-86
KAFR0C051607.44ON5845327139e-86
YKR039W (GAP1)1.244ON6025627141e-85
TBLA0A05190na 4ON6675177191e-85
KAFR0C004003.284ON5824897121e-85
SAKL0D04664g1.244ON5934957122e-85
Smik_11.3021.244ON5534737092e-85
SAKL0D02970g3.284ON6014967122e-85
Skud_2.1913.284ON6094927105e-85
Kwal_8.590na 5ON6295057125e-85
KAFR0D00520na 4ON5985287088e-85
KNAG0J022003.284ON6075117081e-84
Suva_15.1481.368ON5925127061e-84
AFR230C1.244ON6044917071e-84
KLLA0F23419g7.44ON5735247041e-84
KLTH0B02046g5.158ON5895017043e-84
Suva_11.2731.244ON6014797043e-84
CAGL0K05753g1.50ON6604857083e-84
NDAI0D021605.158ON5874947034e-84
NCAS0A071105.158ON5924967034e-84
YOL020W (TAT2)1.368ON5924917034e-84
Skud_15.1381.368ON5925197025e-84
NCAS0A004201.50ON6795287085e-84
KLTH0F01606gna 4ON6045097027e-84
ACL135Wna 1ON5885077008e-84
CAGL0D02178g1.368ON5775106981e-83
YDR046C (BAP3)3.284ON6044626992e-83
ZYRO0A00308gsingletonON5644896944e-83
Smik_15.1461.368ON5935126964e-83
KNAG0H011503.284ON6174896951e-82
TBLA0C012101.368ON6005076922e-82
AFR698C1.50ON6094826922e-82
KLTH0C05170g3.284ON5984926912e-82
NCAS0B079001.244ON6194986932e-82
Kwal_33.14276na 3ON5965216912e-82
CAGL0B03773g5.158ON6055036912e-82
Suva_2.2033.284ON6044966895e-82
Kpol_543.78singletonON6054826896e-82
SAKL0D02926g3.285ON5834996868e-82
KLTH0H13398g1.368ON5874656869e-82
Kpol_534.221.368ON5925176879e-82
Kpol_2002.441.50ON6275146899e-82
TDEL0F02830na 6ON5614906841e-81
Skud_7.5255.158ON6034666871e-81
KLLA0A06886gsingletonON5874796851e-81
AGR319W5.158ON6265076881e-81
Sklu_YGOB_Anc_1.3681.368ON5414536812e-81
Smik_4.2843.284ON6044986852e-81
NCAS0A106803.284ON5935056842e-81
Smik_2.2013.284ON6095076853e-81
Kpol_1010.325.158ON5995146843e-81
TBLA0G031203.284ON6734926884e-81
KLLA0F27093gsingletonON5634946804e-81
KLLA0A10813g1.368ON5844906814e-81
Ecym_26623.284ON5894956816e-81
Kwal_26.9612singletonON5434706777e-81
KAFR0D041401.50ON6375176847e-81
YGR191W (HIP1)5.158ON6034616817e-81
NDAI0A074903.284ON5965066809e-81
AGR039Cna 7ON5865086781e-80
KAFR0E018505.158ON5604766761e-80
KNAG0C005901.50ON6345156812e-80
AEL030W1.368ON5824856763e-80
NCAS0D018705.158ON5954996763e-80
NDAI0F043901.50ON6675196814e-80
Kwal_34.16254singletonOFF4814476674e-80
Smik_16.1155.158ON6034866755e-80
NCAS0J00140na 8ON5584996725e-80
AGR038C3.284ON5804836745e-80
TPHA0M012003.284ON6074526756e-80
Kwal_YGOB_34.162541.368ON4914476676e-80
TPHA0A002405.158ON6034896748e-80
KLLA0A06930g1.244ON5875086738e-80
TPHA0A047005.158ON5695096728e-80
Suva_7.4855.158ON6035156731e-79
KNAG0F002701.50ON6344916732e-79
KNAG0G009005.158ON6135096712e-79
SAKL0C13992gsingletonON5524966672e-79
KLTH0B00154gna 5ON5564936673e-79
TBLA0B077605.158ON6584866725e-79
NDAI0A056203.284ON5714866665e-79
TBLA0I020103.285ON6285026698e-79
NCAS0I015303.284ON5954776661e-78
Skud_4.3003.284ON6044596661e-78
ZYRO0G07172gna 6ON5674896631e-78
Kwal_23.2817na 9ON5805166641e-78
SAKL0D02948gna 7ON5945206633e-78
ZYRO0F17446g1.50ON6335256653e-78
TDEL0E05750singletonON5485446594e-78
Ecym_10561.50ON6064906624e-78
Kwal_27.105383.284ON6024906582e-77
KLTH0F04048gsingletonON5835146562e-77
TPHA0A025001.368ON5905296553e-77
SAKL0H08184gna 10ON5985086545e-77
TPHA0B047501.50ON6395196575e-77
YFL055W (AGP3)na 8ON5584816508e-77
Smik_13.1singletonON5234696471e-76
Skud_6.2na 8ON5584786491e-76
Smik_6.482na 11ON5585166482e-76
NDAI0A01340singletonON5545016472e-76
Ecym_2663na 7ON5894986492e-76
Ecym_27161.368ON5925026484e-76
CAGL0M00154gsingletonON5504856455e-76
SAKL0F16544gsingletonON5675046455e-76
AGR040C3.285ON5735086458e-76
Ecym_8297na 10ON5695036449e-76
Kpol_1065.133.284ON5965096442e-75
Skud_16.2na 11ON4965016362e-75
Suva_13.517singletonON5475056392e-75
Kwal_33.13215na 4ON5984806424e-75
Skud_2.1923.285ON6195016434e-75
Smik_2.2023.285ON6175126417e-75
Kwal_26.8097na 12ON5444946359e-75
ADL272Wna 10ON5644996333e-74
Suva_4.3083.285ON6185056373e-74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL270C
         (573 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...  1062   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   951   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   949   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   868   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   739   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   733   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   729   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   725   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   718   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   707   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            702   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              697   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   693   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   689   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   686   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   684   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   674   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   674   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   675   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            671   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            672   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   662   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   661   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   654   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   654   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   653   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   652   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   651   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   645   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   644   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   640   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   638   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   636   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   636   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   636   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   635   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   633   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              634   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   632   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   631   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   627   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   623   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                624   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   622   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   619   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   617   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   595   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   578   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   578   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   343   e-110
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   342   e-110
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   330   e-105
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             329   e-104
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   327   e-103
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     326   e-103
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   325   e-103
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              325   e-103
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   324   e-103
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   323   e-102
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   322   e-102
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   318   e-100
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   316   e-100
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   315   2e-99
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   313   1e-98
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   312   3e-98
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   311   6e-98
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   311   7e-98
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             308   1e-96
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   309   1e-96
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     308   1e-96
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   307   2e-96
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   306   2e-96
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   307   3e-96
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   307   3e-96
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   306   8e-96
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   305   2e-95
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   303   7e-95
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   302   7e-95
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      303   8e-95
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   302   1e-94
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   302   2e-94
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   300   1e-93
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   297   2e-93
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   298   1e-92
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   297   1e-92
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      297   2e-92
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   296   2e-92
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   297   2e-92
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   297   3e-92
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   296   5e-92
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   294   1e-91
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   295   1e-91
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   296   1e-91
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   294   1e-91
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   295   1e-91
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   291   8e-91
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            290   1e-90
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   293   1e-90
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   291   3e-90
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     291   3e-90
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   291   4e-90
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   290   6e-90
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   291   1e-89
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   291   1e-89
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   291   2e-89
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   290   3e-89
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   290   3e-89
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   287   1e-88
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   288   1e-88
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   287   1e-88
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   287   2e-88
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   287   2e-88
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   285   7e-88
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   286   9e-88
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   283   1e-87
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   284   1e-87
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   284   1e-87
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   284   2e-87
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   283   3e-87
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   284   4e-87
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   283   4e-87
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   283   4e-87
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   285   6e-87
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   282   1e-86
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   283   1e-86
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   281   1e-86
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   281   1e-86
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   282   1e-86
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   282   2e-86
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   281   2e-86
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   281   2e-86
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    281   3e-86
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   281   3e-86
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   282   3e-86
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   281   5e-86
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   281   5e-86
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   279   9e-86
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   279   1e-85
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   281   1e-85
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                278   1e-85
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   278   2e-85
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   277   2e-85
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   278   2e-85
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   278   5e-85
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   278   5e-85
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   277   8e-85
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   277   1e-84
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   276   1e-84
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   276   1e-84
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   275   1e-84
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   275   3e-84
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   275   3e-84
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   277   3e-84
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    275   4e-84
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   275   4e-84
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   275   4e-84
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   275   5e-84
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   277   5e-84
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   275   7e-84
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   274   8e-84
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   273   1e-83
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   273   2e-83
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   271   4e-83
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   272   4e-83
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              272   1e-82
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   271   2e-82
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   271   2e-82
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   270   2e-82
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   271   2e-82
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   270   2e-82
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   270   2e-82
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   270   5e-82
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   270   6e-82
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   268   8e-82
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   268   9e-82
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   269   9e-82
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   270   9e-82
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   268   1e-81
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   269   1e-81
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   268   1e-81
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   269   1e-81
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   266   2e-81
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   268   2e-81
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   268   2e-81
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   268   3e-81
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   268   3e-81
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              269   4e-81
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   266   4e-81
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   266   4e-81
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   266   6e-81
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   265   7e-81
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              268   7e-81
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   266   7e-81
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   266   9e-81
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   265   1e-80
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   265   1e-80
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   266   2e-80
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   265   3e-80
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   265   3e-80
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   266   4e-80
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   261   4e-80
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   264   5e-80
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      263   5e-80
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   264   5e-80
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   264   6e-80
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   261   6e-80
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   264   8e-80
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   263   8e-80
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   263   8e-80
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   263   1e-79
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   263   2e-79
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   263   2e-79
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   261   2e-79
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   261   3e-79
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   263   5e-79
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            261   5e-79
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   262   8e-79
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              261   1e-78
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   261   1e-78
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   259   1e-78
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   260   1e-78
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   259   3e-78
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   260   3e-78
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            258   4e-78
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   259   4e-78
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   258   2e-77
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   257   2e-77
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   256   3e-77
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   256   5e-77
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   257   5e-77
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   254   8e-77
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    253   1e-76
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      254   1e-76
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   254   2e-76
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              253   2e-76
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   254   2e-76
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   254   4e-76
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   253   5e-76
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   253   5e-76
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   253   8e-76
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   252   9e-76
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   252   2e-75
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   249   2e-75
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   250   2e-75
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   251   4e-75
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   252   4e-75
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   251   7e-75
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   249   9e-75
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   248   3e-74
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   249   3e-74
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   248   4e-74
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   248   4e-74
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   246   1e-73
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   248   2e-73
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   246   2e-73
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              248   3e-73
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              246   6e-73
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   244   7e-73
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                244   1e-72
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   243   5e-72
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   241   2e-71
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              240   3e-71
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   241   5e-71
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   240   1e-70
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   239   1e-70
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   238   5e-70
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   234   4e-69
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   236   5e-69
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   235   5e-69
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   235   6e-69
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   233   9e-69
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   234   1e-68
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   233   3e-68
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   231   5e-68
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   230   3e-67
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   229   3e-67
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   230   4e-67
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   233   7e-67
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    229   9e-67
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   228   1e-66
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   228   2e-66
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   228   2e-66
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   227   3e-66
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   227   5e-66
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      227   5e-66
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   226   1e-65
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                225   2e-65
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   225   2e-65
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   224   6e-65
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   224   7e-65
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   223   1e-64
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   223   2e-64
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   222   2e-64
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   221   7e-64
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   219   8e-64
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              220   2e-63
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   218   1e-62
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   218   1e-62
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   218   1e-62
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   218   2e-62
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   217   2e-62
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   216   2e-62
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   216   3e-62
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   215   9e-62
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   214   1e-61
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   214   2e-61
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   214   2e-61
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   213   6e-61
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              213   7e-61
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   214   1e-59
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   209   2e-59
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   208   4e-59
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                207   9e-59
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   200   2e-56
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   204   4e-56
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   200   6e-55
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   200   7e-55
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   197   7e-54
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   197   9e-54
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   196   4e-53
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   191   5e-53
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   194   7e-53
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   193   2e-52
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     184   3e-52
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     183   5e-52
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   190   3e-51
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   186   3e-51
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   190   4e-51
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   189   1e-50
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   186   2e-50
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   186   7e-50
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   181   8e-50
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   186   1e-49
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   186   1e-49
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   184   6e-49
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   183   7e-49
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   181   4e-48
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         136   4e-35
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   127   5e-33
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          99   5e-23
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      96   3e-21
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     97   5e-21
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      83   1e-18
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    84   2e-18
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          79   2e-16
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    67   8e-12
Suva_14.74 Chr14 complement(131968..132087,132069..132167) [219 ...    57   1e-09
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      50   1e-06
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    44   7e-04
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    43   0.002
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    42   0.004
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    42   0.004
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    42   0.005
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    41   0.009
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    39   0.042
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    39   0.048
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    38   0.054
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    36   0.35 
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              34   0.44 
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    35   0.66 
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    35   0.74 
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    35   0.78 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    35   0.79 
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    33   1.3  
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    33   1.6  
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    33   1.6  
TDEL0E01790 Chr5 (343205..344911) [1707 bp, 568 aa] {ON} Anc_4.1...    33   1.8  
TPHA0B01060 Chr2 complement(241062..242822) [1761 bp, 586 aa] {O...    33   1.9  
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    33   3.2  
Smik_9.143 Chr9 complement(239206..241914) [2709 bp, 902 aa] {ON...    32   3.8  
NDAI0F01140 Chr6 (275800..276717) [918 bp, 305 aa] {ON}                32   3.9  
KLTH0A03278g Chr1 (283065..284783) [1719 bp, 572 aa] {ON} highly...    32   5.8  
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...    32   6.9  
KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa] ...    31   9.4  
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    31   9.9  

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/573 (92%), Positives = 530/573 (92%)

Query: 1   MDETVNIQMSKEGQYXXXXXXXXXXXXFVDEQYSGENVTKAITTERKVEDDAAKETESSP 60
           MDETVNIQMSKEGQY            FVDEQYSGENVTKAITTERKVEDDAAKETESSP
Sbjct: 1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSP 60

Query: 61  QERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQ 120
           QERREVKRKLKQRH                   PPLAHAGPVGALISYLFMGTVIYSVTQ
Sbjct: 61  QERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 121 SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA 180
           SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA
Sbjct: 121 SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA 180

Query: 181 VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP 240
           VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP
Sbjct: 181 VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP 240

Query: 241 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL 300
           IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL
Sbjct: 241 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL 300

Query: 301 PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDI 360
           PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDI
Sbjct: 301 PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDI 360

Query: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA 420
           FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA
Sbjct: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA 420

Query: 421 FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF 480
           FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF
Sbjct: 421 FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF 480

Query: 481 LAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLX 540
           LAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 
Sbjct: 481 LAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQ 540

Query: 541 XXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                      EELVWIEPECKTRWQRVWDVLS
Sbjct: 541 DIDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/573 (80%), Positives = 500/573 (87%)

Query: 1   MDETVNIQMSKEGQYXXXXXXXXXXXXFVDEQYSGENVTKAITTERKVEDDAAKETESSP 60
           M+E+V+++MSK  QY             +  +Y G++  +A+  +  + +D+AKETE+SP
Sbjct: 1   MNESVDMRMSKVSQYEINSISTIKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSP 60

Query: 61  QERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQ 120
           ++  EVKRKLKQRH                   PPLAHAGPVGALISYLFMGTVIYSVTQ
Sbjct: 61  RKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 121 SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA 180
           SLGEM TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLG++IQYWT+A
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDA 180

Query: 181 VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP 240
           VPL AWIVIFWCLLT MNMFPVKYYGEFEFCIASIKVIALLGFI FSFC+VCGAGQS GP
Sbjct: 181 VPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGP 240

Query: 241 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL 300
           IGFRYWRNPGAWGPGIIS +KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR+A+
Sbjct: 241 IGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAV 300

Query: 301 PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDI 360
           PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS+G FVSSSPFMISIENSGTKVLPDI
Sbjct: 301 PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDI 360

Query: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA 420
           FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT+GGVPYF+VLSTS FGFLA
Sbjct: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLA 420

Query: 421 FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF 480
           FLE SAGSGK FNWLLNITGVAGFFAWLLIS SHIRFMQAI+KRGISRDDLPY+A+MMPF
Sbjct: 421 FLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPF 480

Query: 481 LAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLX 540
           LAYYASFFIALIVLIQGFTAFAPTFQPIDF+AAYIS+FLF+AIWL FQVWFKCR +WKL 
Sbjct: 481 LAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQ 540

Query: 541 XXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                      EE VWIEPECKTRWQ VWD+LS
Sbjct: 541 DVDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/573 (81%), Positives = 496/573 (86%)

Query: 1   MDETVNIQMSKEGQYXXXXXXXXXXXXFVDEQYSGENVTKAITTERKVEDDAAKETESSP 60
           M+E V+I  SKEG+              VD QY  ++ + AI     +E+D AK TE+SP
Sbjct: 1   MNENVDICTSKEGKREANSAPTIKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSP 60

Query: 61  QERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQ 120
           + R EV+RKLK+RH                   PPLAHAGPVGALISYLFMGTVIYSVTQ
Sbjct: 61  RSRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 121 SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA 180
           SLGEM TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLG++IQYWT A
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHA 180

Query: 181 VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP 240
           VPLAAWIVIFWCLLT MNMFPVKYYGEFEFCIASIKVI LLGFIIFSFC+VCGAGQ DGP
Sbjct: 181 VPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGP 240

Query: 241 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL 300
           IGFRYWRNPGAWGPGIISS+KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA+
Sbjct: 241 IGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 300

Query: 301 PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDI 360
           PRAIKKVV+RILVFYILSLFFIGLLVPYNDPKLDSDG FVS+SPFMISIENSGTKVLPDI
Sbjct: 301 PRAIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDI 360

Query: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA 420
           FNAVVLITI SAGNSNVYIGSRVLYSLSKNSLAP+ LSNVTRGGVPY +VL TS+FGFLA
Sbjct: 361 FNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLA 420

Query: 421 FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF 480
           FLE SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAI+KRGISRDDLPYKA+MMPF
Sbjct: 421 FLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPF 480

Query: 481 LAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLX 540
           LAYYASFFIALIVLIQGFTAFAPTFQP+DFVAAYIS+FLF  IWLSFQ+WFKCRL+ KL 
Sbjct: 481 LAYYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQ 540

Query: 541 XXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                      EE VWIEPECKTRWQRVWD+LS
Sbjct: 541 DIDIDSDRREIEEQVWIEPECKTRWQRVWDILS 573

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/480 (88%), Positives = 453/480 (94%)

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
           PPLAHAGPVGALISY+FMGTVIYSVTQSLGEM TFIPVTSSFSVFAQRFLSPALGATNGY
Sbjct: 18  PPLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGY 77

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
           MYWLSWCFTFALELSVLG++IQYWT+AVPL+AWIVIFWCLLT MNMFPVKYYGEFEFCIA
Sbjct: 78  MYWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIA 137

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
           SIKVIALLGFII+SFC+VCGAGQ DGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL
Sbjct: 138 SIKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 197

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           INAAFTYQGTELVGITAGEAANPRKA+PRAIKKVVVRILVFYI+SLFFIGLLVPYNDPKL
Sbjct: 198 INAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL 257

Query: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393
           DSDG FVS+SPFMISIENSGTKVLPDIFNAVVLITI+SAGNSNVYIGSRVLYSLSKN LA
Sbjct: 258 DSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453
           PRFLS VT+GGVPYF+VL+TSVFGFLAFLE SAGSGKAFNWLLNITGVAGFFAWLLISFS
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA 513
           HIRFMQAI KRGISR+DLPYKA+MMP+LAYYASFFIALIVLIQGFTAFAP+FQP+DFVAA
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAA 437

Query: 514 YISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           YIS+FLF+AIW SFQ+WFKC ++ KL            EE VWIEP  KT+WQ VWDVL+
Sbjct: 438 YISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/539 (66%), Positives = 430/539 (79%), Gaps = 6/539 (1%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           +G N     + E  ++D+   E +++     EVKR+LKQRH                   
Sbjct: 57  NGVNGQDTFSMEEDIQDEDEGEVQNA-----EVKRELKQRHIGMIALGGTIGTGLFIGLS 111

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
            PL +AGPVGALISYLFMG++ YSVTQSLGEM TFIPVTSSF+VF+QRFLSPA GA NGY
Sbjct: 112 TPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGY 171

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
           MYW SW  TFALELSV+G+VIQ+WT AVPLAAWI IFW ++T+MNMFPVKYYGEFEF +A
Sbjct: 172 MYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVA 231

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
           SIKVIA++GF+I+ FC+VCGAG + GP+GFRYWRNPGAWGPGIIS +KNE RFLGWVSSL
Sbjct: 232 SIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSL 290

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           INAAFT+QGTELVGITAGEAANPRK +PRAIKKVV RIL FYI SL FIGLLVPYNDPKL
Sbjct: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350

Query: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393
            S   +VS+SPF+I+IENSGTKVLP IFNAV+L TI+SA NSN+Y+GSRVL+ LSK+ LA
Sbjct: 351 TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410

Query: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453
           P+F S  T+GGVPY +V +TS+FG LA++E S G GK F WLLNITGVAGFFAWL IS S
Sbjct: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470

Query: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA 513
           HIRFMQA++ RGISRD+LP+KA++MP LAYYA+FF+ +I+LIQGFT+F PTF  ++F+AA
Sbjct: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAA 530

Query: 514 YISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVL 572
           YIS+FLFLAIW+ F++ F+CR +WK+            E +VW EPE KT W + W+V+
Sbjct: 531 YISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/539 (66%), Positives = 429/539 (79%), Gaps = 3/539 (0%)

Query: 35  GENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXP 94
           G    K   +  + ED A ++ E    E  +VKR LKQRH                    
Sbjct: 37  GRRKRKTSVSSTQYEDLATEKDEL--LEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIAT 94

Query: 95  PLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYM 154
           PLA+AGPVGAL++YLFMGTV++SVTQSLGEM TFIPVTSSFSVFAQRFLSPALGA NGYM
Sbjct: 95  PLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYM 154

Query: 155 YWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIAS 214
           Y+LSWCFTFALELSV+G++IQ+WT  VPLAAWI IFW LLT+ NMFPVK+YGEFEF IAS
Sbjct: 155 YFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIAS 214

Query: 215 IKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 274
           IKV+AL+GF+I+S C+VCGAG++ GPIGFRYWRNPGA GPGIISS+  E RFLGWVSSLI
Sbjct: 215 IKVLALMGFLIYSLCIVCGAGKT-GPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLI 273

Query: 275 NAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLD 334
           NAAFTYQGTELVGITAGEAANPRKA+PRAI+KV++RIL+FYI SLFFIGL VPYNDPKL 
Sbjct: 274 NAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT 333

Query: 335 SDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAP 394
           S   +VSSSPF+I+I+N+GT+VLP IFNAV+L TI+SAGNSNVY+GSR+L+S++KN LAP
Sbjct: 334 STDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP 393

Query: 395 RFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSH 454
           +FL+  T  GVPY SVL+ S FG L+++E+S G  KAFNWLLNITGVAGFFAWLLIS SH
Sbjct: 394 KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSH 453

Query: 455 IRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAY 514
           +RFMQA++ RGISRDDLPYKA  MP+LAYYA FF+ +I+LIQGFT+FAP F   DFVAAY
Sbjct: 454 VRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAY 513

Query: 515 ISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           IS+ LFL  W  FQ++F+CR++WKL            E +VW +   KT W + WD ++
Sbjct: 514 ISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/523 (67%), Positives = 419/523 (80%), Gaps = 1/523 (0%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D  ++ +       EVKR+LKQRH                    PLA+AGPVGALISYLF
Sbjct: 69  DVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLF 128

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
           MG++ YSVTQSLGEM TFIPVTSSF+VF+QRFLSPA GA NGYMYW SW  TFALELSV+
Sbjct: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188

Query: 171 GKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCV 230
           G+VI++WT  VPLAAWI IFW ++T MN+FPVKYYGEFEF +ASIKV+A++GF+I+ FC+
Sbjct: 189 GQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM 248

Query: 231 VCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITA 290
           VCGAG + GP+GFRYWRNPGAWGPGIIS DKNEGRFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 249 VCGAGVT-GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITA 307

Query: 291 GEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIE 350
           GEAANPRK +PRAIKKVV RIL FYI SL FIGLLVPYNDPKL +   +VS SPF+I+IE
Sbjct: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIE 367

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
           NSGTKVLP IFNAV+L TI+SA NSN+Y+GSR+L+ LSKN LAP+FLS  T+GGVPY +V
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAV 427

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
             T+VFG LA++E S G  K F WLLNITGVAGFFAWLLIS SHIRFMQA++ RGISRD+
Sbjct: 428 FITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDE 487

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVW 530
           LP+KA++MP LAY+A+ F+ +I+LIQGFTAFAP F  IDF+AAYISIFLFLAIW+ F++ 
Sbjct: 488 LPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEII 547

Query: 531 FKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           F+CR +WK+            E +VW + E KT W + W+V++
Sbjct: 548 FRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/526 (66%), Positives = 416/526 (79%), Gaps = 2/526 (0%)

Query: 48  VEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALIS 107
           +ED    E E   Q   EVKR+LKQRH                    PL +AGPVGALIS
Sbjct: 67  MEDGIGDEDEGEVQNA-EVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIS 125

Query: 108 YLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 167
           YLFMG++ YSVTQSLGEM TFIPVTSSF+VF+QRFLSPA GA NGYMYW SW  TFALEL
Sbjct: 126 YLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALEL 185

Query: 168 SVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFS 227
           SV+G+VIQ+WT  VPLAAWI IFW ++T MN+FPVKYYGEFEF +ASIKV+A++GF+I+ 
Sbjct: 186 SVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYC 245

Query: 228 FCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 287
           FC+VCGAG + GP+GFRYWRNPGAWGPGIIS DKNEGRFLGWVSSLINAAFT+QGTELVG
Sbjct: 246 FCMVCGAGVT-GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVG 304

Query: 288 ITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMI 347
           ITAGEAANPRK++PRAIKKVV RIL FYI SL FIGLLVPYNDPKL     +VS+SPF+I
Sbjct: 305 ITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFII 364

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           +IENSGTKVLP IFNAV+L TI+SA NSN+Y+GSR+L+ LSKN LAP+FLS  T+GGVPY
Sbjct: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPY 424

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
            +V  T+ FG LA++E S G  K F WLLNITGVAGFFAWL IS SHIRFMQA++ RGIS
Sbjct: 425 IAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSF 527
           RD+LP+KA++MP LAYYA+ F+ +I++IQGFTAFAP F  + F AAYISIFLFLA+W+ F
Sbjct: 485 RDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILF 544

Query: 528 QVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           Q  F+CR +WK+            E +VW + E KT W + W+V++
Sbjct: 545 QCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/540 (64%), Positives = 426/540 (78%), Gaps = 6/540 (1%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           +G N     + E  ++D+   E +++     EVKR+LKQRH                   
Sbjct: 57  TGVNGQDTFSMEENLQDEDEGEVQNA-----EVKRELKQRHIGMIALGGTIGTGLFIGLS 111

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
            PLA+AGPVGALI+YLFMG++ +SVTQSLGEM TFIPVTSSF+VF+QRFLSPA GA NGY
Sbjct: 112 TPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGY 171

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
           MYW SW  TFALELSV+G+VIQ+WT  VPLAAWI IFW L+T MN+FPVKYYGEFEF +A
Sbjct: 172 MYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVA 231

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
           SIKVIA++GF+I+ FC+VCGAG + GP+GFRYWRNPGAWGPGIIS +KNEGRFLGWVSSL
Sbjct: 232 SIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSL 290

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           INAAFT+QGTELVGITAGEAANPRK +PRAIKKVV RIL FYI SL FIGLLVPYNDPKL
Sbjct: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350

Query: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393
                +VS+SPF+++I+NSGTKVLP IFNAV+L TI+SA NSN+Y+GSR+L+ LSKN LA
Sbjct: 351 TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLA 410

Query: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453
           P+FLS  ++GGVPY +V +T+VFG LA++E S G  K F WLLNITGVAGFFAWL IS S
Sbjct: 411 PKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISIS 470

Query: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA 513
           HIRFMQA++ RGISRD+LP+KA++MP LAYY+SFF+ +I++IQGFTAFAP F    F+AA
Sbjct: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAA 530

Query: 514 YISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           YISIFLF+A+W+ F+  F+CR +WK+            E +VW + E KT W + W+V++
Sbjct: 531 YISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/540 (63%), Positives = 421/540 (77%), Gaps = 6/540 (1%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           S  ++   IT E + E+ A  +   +     EVKR+LKQRH                   
Sbjct: 32  SVHSIPSQITIESQEEEIANGQIREA-----EVKRELKQRHIGMIALGGTIGTGLFIGLS 86

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
            PL +AGPVGALI+YLFMGT++YSVTQSLGEM TFIPVTSSF+VF+QRFLSP+ GA NGY
Sbjct: 87  TPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGY 146

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
           MYW SW  TFALELSV+G++IQ+WT AVP+ AWI IFW LL +MNMFPV++YGEFEF +A
Sbjct: 147 MYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVA 206

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
           SIKV+A++GF+I+  C+VCGAG + GP+GFRYWRNPG  GPGII+ + NE +FLGWVSSL
Sbjct: 207 SIKVLAIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSL 265

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           INAAFTYQGTELVGITAGEAANPRK++PRAIKKVV RIL FYI SLFFIGLLVPYNDPKL
Sbjct: 266 INAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL 325

Query: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393
            SD  +V++SPF+ISI+NSGT +LP IFNAV+L TI+SA NSNVY+GSR+++ LSK+ LA
Sbjct: 326 TSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLA 385

Query: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453
           PR LS   + GVP+ SV+ T +FG LA++E S G   AFNWLLNITGVAGFF+WL IS S
Sbjct: 386 PRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISIS 445

Query: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA 513
           H+RFMQA+  RGISRDDLP+KA+ MP LAYYA FF+ LI++IQGFT+F P+F  IDF+AA
Sbjct: 446 HVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAA 505

Query: 514 YISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           YIS FLF+AIW+ FQ+WF+CRL+WK+            EE+VW +P   T W + W+V++
Sbjct: 506 YISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/528 (65%), Positives = 414/528 (78%), Gaps = 5/528 (0%)

Query: 49  EDDAAKETE---SSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGAL 105
           +D   KE     S   E   V+R+LKQRH                    PL +AGPVGAL
Sbjct: 7   QDSKMKEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGAL 66

Query: 106 ISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
           I+YLFM T+ YSVTQSLGEM TFIPVTSSF+VF+QRF+SPA GA NGYMYW SWC TFAL
Sbjct: 67  IAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           ELSV+G+VIQ+WT AVPLAAWI IFW LLT MNMFPVKYYGEFEF +A +KV+A++GF+I
Sbjct: 127 ELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTEL 285
           + FC+VCGAG + GP+GFRYWR+PGA+GPGII+ DKN+ RFLGWVSSLINAAFT+QGTEL
Sbjct: 187 YCFCMVCGAGVT-GPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245

Query: 286 VGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPF 345
           VGITAGEAANPRK +PRAIKKVV RIL FYILSLFFIGLLVPY+D KL S   +VS+SPF
Sbjct: 246 VGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPF 305

Query: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGV 405
           +I+IENSGT VLP IFNAV++ TI+SAGNSN+Y+GSR++Y LS + LAP  LS  T+ GV
Sbjct: 306 IIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGV 365

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           P+ +VL TS+FG LA++E S G  KAFNWLLNITGVAGFF WL IS SHIRFMQA+  RG
Sbjct: 366 PWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRG 425

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWL 525
           ISRDDLP+KA+ MP LAYY  FF+ LI++IQGFT+F P +  IDF+ AYIS+F+F+AIW+
Sbjct: 426 ISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWI 484

Query: 526 SFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           +FQ WF+CRL+W++            EE VWIE E +  W + W+V++
Sbjct: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/509 (66%), Positives = 401/509 (78%), Gaps = 1/509 (0%)

Query: 65  EVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124
           EVKR+LKQRH                    PL  AGPVGALISY+FMGT++YSVTQSLGE
Sbjct: 72  EVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGE 131

Query: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLA 184
           M TFIPVTSSF+VFAQRFLSP++GA  GYMYW SW  TFALELSV+G+VIQYWT AVPLA
Sbjct: 132 MATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVPLA 191

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244
           AWI IFW ++T+ NMFPVKYYGE EF IA IKVIA++GF+++  C+VCGAG + GP+GFR
Sbjct: 192 AWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVT-GPVGFR 250

Query: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304
           YWRNPG WGPGIIS DKNE RFLGWVSSLIN AFTYQGTELVGI+AGEAANPRKA+PRAI
Sbjct: 251 YWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRAI 310

Query: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAV 364
           KKVV RIL FYI SLFFIGLLVPYND  L++   +V+SSPF+I+I+NSGT VLP IFNAV
Sbjct: 311 KKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHIFNAV 370

Query: 365 VLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEV 424
           +  TI+SAGNSNVY+GSR+L+ LSKN LAP+ LS  T+GGVP+ +VL TSV G LA++E 
Sbjct: 371 IACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYMET 430

Query: 425 SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYY 484
           S G   AFNWLLNIT VAGFF WL IS SHIRFMQA++ RGISRDDLP+KA +MP LAYY
Sbjct: 431 STGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLAYY 490

Query: 485 ASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXX 544
           ASF + +I++IQGFTAFAP F   DF AAYISIFLF+ IW  FQ+ F+CR + K+     
Sbjct: 491 ASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVEDVDI 550

Query: 545 XXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                  E +VW + E KT W + W++++
Sbjct: 551 DTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/512 (66%), Positives = 402/512 (78%), Gaps = 1/512 (0%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
              EVKR LKQRH                    PL++AGPVG LI+YLFM T++YSV QS
Sbjct: 73  HEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQS 132

Query: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181
           LGEM TFIPVTS+F+VF+ RFLSPA GA +GYMYW SW  TFALELSV+G++I++WT AV
Sbjct: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
           P+AAWI IFW LLT  N+FPVKYYGEFEF IA IKVIAL+GFII+  C+VCGAG + GP+
Sbjct: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT-GPV 251

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           GFRYWRNPGAWGPGIIS DKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK++P
Sbjct: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361
           RAIKKVV RILVFY     FIGLLVPYNDPKL+S   +VSSSPF+I+IENSGTKVLP IF
Sbjct: 312 RAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIF 371

Query: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421
           NAVVL TI+SAGNSNVY+GSR++Y L+K  LAP F       GVPYF+V  TS FG LA+
Sbjct: 372 NAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAY 431

Query: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481
           +E+S G   AFNWLLNITGVAGFF W+LIS  HIRFMQA++ RGISRDDLP+KA+ MP+L
Sbjct: 432 MELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWL 491

Query: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXX 541
           AYYA FF+ +I+LIQGFTAFAPTF  +DF AAY+S+FLF+AIWL  Q+WF+CR+  +L  
Sbjct: 492 AYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDE 551

Query: 542 XXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                     E +VW +   KT W + W++++
Sbjct: 552 VDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/544 (61%), Positives = 414/544 (76%), Gaps = 1/544 (0%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           D + + E     +  +  + +DA         +  +VKR LK RH               
Sbjct: 6   DYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLF 65

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                PL++AGPVGALI+Y+F+GT+ YSVTQSLGEM TFIPVTSSF+VF QRFLSPALG+
Sbjct: 66  ISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGS 125

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
            NGY+YWLSW  TFALELSV+G++IQ+WT+AVPL AWI IFW +LT  N+FPVKYYGE E
Sbjct: 126 ANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVE 185

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F IA IKV+A++GFII++F +VCGAG++ GP+GFRYWRNPG WGPGIIS D NEGRFLGW
Sbjct: 186 FWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGW 244

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
           VSSLI+AAFTYQGTELVGITAGEAANPRK +PRAI KV  RIL FYILSL FIGLLVP+N
Sbjct: 245 VSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFN 304

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           DPKL S+  ++SSSPF+I+IENSGTKVLP IFNAV+L TI+SAGNSNVY+GSR+ YS++ 
Sbjct: 305 DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
           N LAP++L+  T+ G+PY +VL+TSV GFLA+LE S+G+   FNWLLNIT VAGFF W+L
Sbjct: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPID 509
           IS SHIRFMQA++ +GISRDDLP+KA+ MP+ AYYA+FFI +I++IQGFTAFAP F+  D
Sbjct: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSD 484

Query: 510 FVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVW 569
           F  AYIS+ LF   W+ FQ+WF+  L  K             +++VW E + +  W++ W
Sbjct: 485 FFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFW 544

Query: 570 DVLS 573
             ++
Sbjct: 545 AAIA 548

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/512 (66%), Positives = 412/512 (80%), Gaps = 1/512 (0%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
           +  EVKR+LKQRH                    PL +AGPVGALI+YLFM T+++SVTQS
Sbjct: 93  KEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQS 152

Query: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181
           LGEM TFIPVTSSF+VF+ RFLSPA+GA NGYMYW SW  TFALELSV+G++IQ+WT AV
Sbjct: 153 LGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAV 212

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
           PL+AWIVI+W +LT MN+FPVK+YGEFEF +ASIKV+A++GF+I+  C+VCGAG + GP+
Sbjct: 213 PLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT-GPV 271

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           GFRYWRNPG WGPGIIS D NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK +P
Sbjct: 272 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 331

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361
           RAIKKV  RIL+FYILSLFFIGLLVPY+D KL S   ++S+SPF+I+IENSGTK+LP IF
Sbjct: 332 RAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILPHIF 391

Query: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421
           NAV+L TI+SAGNSNVY+GSR+L+ L+K  LAP++    +RGGVPY+SV  TS FG LAF
Sbjct: 392 NAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAF 451

Query: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481
           LEVS+G  KAFNWLLNI  VAGFFAWLLIS +H+RFMQA++ RGISRDDLP+KA+ MP L
Sbjct: 452 LEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHL 511

Query: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXX 541
           AYY+ FF+ +I++IQGFTAFAPTF   DFVAAYISIFLF  +WL FQ++F+ +LLW +  
Sbjct: 512 AYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEE 571

Query: 542 XXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                     + ++W +   KT W + WDV++
Sbjct: 572 VDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/524 (65%), Positives = 417/524 (79%), Gaps = 1/524 (0%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           D+     +    +  EVKR+LKQRH                    PL +AGPVG+LI+YL
Sbjct: 73  DEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYL 132

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
           FM T+++SVTQSLGEM TFIPVTSSF+VF+ RF+SP++GA NGYMYW SW  TFALELSV
Sbjct: 133 FMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSV 192

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
           +G++IQ+WT+AVPL+AWIVI+W +LT MNMFPVK+YGEFEF +ASIKVIA++GF+I+  C
Sbjct: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252

Query: 230 VVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289
           +VCGAG + GP+GFRYWRNPG WGPGIISS   EGRFLGWVSSLINAAFTYQGTELVGIT
Sbjct: 253 MVCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311

Query: 290 AGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI 349
           AGEAANPRK +PRAIKKV  RIL+FYILSLFFIGLLVP++DPKL SD  +VSSSPF+I+I
Sbjct: 312 AGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAI 371

Query: 350 ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFS 409
           +NSGTKVLP IFNAV+L TI+SAGNSN+Y+GSRV++ L+K  LAPR+    T+ GVPY +
Sbjct: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431

Query: 410 VLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRD 469
           VL TS FG LAFLEVS+G  KAFNWLLNI GVAGFFAWLLIS +H+RF+Q +  RGISRD
Sbjct: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491

Query: 470 DLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQV 529
           DLP+KA +MP+LAYYA FF+ +I++IQGFTAFAPTF   DFVAAYIS+FLF  +W+SFQ+
Sbjct: 492 DLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQL 551

Query: 530 WFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           +F+C+L W L            + ++W +   KT W R WDV++
Sbjct: 552 YFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/534 (63%), Positives = 415/534 (77%), Gaps = 12/534 (2%)

Query: 43  TTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPV 102
           TT   ++DD  K+        ++VKR+LK+RH                    PL  AGP+
Sbjct: 20  TTISTLDDDQEKQ--------QDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPI 71

Query: 103 GALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFT 162
           GALI+YLFMGTV++SVTQSLGEM TFIPVT+SF+VFAQRFLSPA GA NGYMYW SW  T
Sbjct: 72  GALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMT 131

Query: 163 FALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLG 222
           FALELSV+G++IQ+WT AVPLAAWI I W LLT  N+FPV+ YGE EF IAS+KV+A+LG
Sbjct: 132 FALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILG 191

Query: 223 FIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQG 282
           FII+  C++CGAG + GP+GFRYW+NPG WG GIISS+ NE RF GWVSSLINAAFT+QG
Sbjct: 192 FIIYGICIICGAGVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250

Query: 283 TELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSS 342
           TELVGITAGE   PRK +P+AIKKVV RILVFYI SL  IGLLVPYNDPKL S+  +VSS
Sbjct: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSS 310

Query: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402
           SPF+I+I+N+GTK+LP IFNAV+LITI+SAGNSNVYIGSR+LY L+KN  AP+F +N ++
Sbjct: 311 SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSK 370

Query: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462
            GVPY +VL TS+FG LA++E + G  KAF WLLNI GVAGFFAWLLIS SHIRFM+A++
Sbjct: 371 AGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALK 430

Query: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLA 522
           +RGISR+DLPYKA +MP+LAYYA FF+ +I++IQGFT+FAP F+  +F AAYIS+FLF+ 
Sbjct: 431 QRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFII 490

Query: 523 IWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVW---IEPECKTRWQRVWDVLS 573
            W++FQ+WFKCRL+WKL            EE VW   +E + K  W R W+ ++
Sbjct: 491 FWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/547 (60%), Positives = 415/547 (75%), Gaps = 5/547 (0%)

Query: 30  DEQYSGE---NVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXX 86
            + +S E   N  + ++   + +D  + E+  S +E  +VKR LK RH            
Sbjct: 4   QQHHSSEKEKNSEELVSEFSRSKDVVSLESLGSVKET-QVKRALKPRHISMIALGGTIGT 62

Query: 87  XXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPA 146
                   PL++AGPVGALI+Y+F+GT+ Y V+QSLGEM TFIPVTSSF VF QRFLSPA
Sbjct: 63  GLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPA 122

Query: 147 LGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYG 206
           LGA NGYMY+LSW  TFALELSV+G+VIQ+WT+AVPL AWI+I W +L S N+ PVK+YG
Sbjct: 123 LGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYG 182

Query: 207 EFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRF 266
           E EF IA IKV+A++GFII++F +VCGAG++ GP+GFRYWRNPG WGPGIIS D NEGRF
Sbjct: 183 EVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRF 241

Query: 267 LGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV 326
           LGWVSSLI+AAFTYQGTELVGITAGEAANPRK +PRAI KV  RIL FYILSL FIGLLV
Sbjct: 242 LGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLV 301

Query: 327 PYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYS 386
           P+NDPKL S+  ++SSSPF+I+IENSGTKVLP IFNAV+L TI+SAGNS+VYI SRVLYS
Sbjct: 302 PFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYS 361

Query: 387 LSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFA 446
           +  N LAP++L+  T+ G+PY +VL+TS+ GFLA+LE S G+   F+WLLNIT VAGFFA
Sbjct: 362 MGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFA 421

Query: 447 WLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQ 506
           W+LIS +HIRFMQA++ +GISRDDLP+KA+ MP+ AYYA+FFI +I++IQGFTAFAP F 
Sbjct: 422 WMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFN 481

Query: 507 PIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQ 566
             DF  AY+S+ LF A+W+ FQ+WF+  L  K             +  VW E E K  W+
Sbjct: 482 VSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWE 541

Query: 567 RVWDVLS 573
           + W  ++
Sbjct: 542 KFWSAVA 548

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/555 (60%), Positives = 407/555 (73%), Gaps = 12/555 (2%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQ-----------ERREVKRKLKQRHXXXX 78
            E+  G   TK+   + +V    +     SP            +  EVKR LK RH    
Sbjct: 35  SEEPFGCKDTKSTDEKTRVVSQVSPMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMI 94

Query: 79  XXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVF 138
                           PLA AGPVGALI+Y+FMGT+ Y VTQSLGEM TFIPVTSSF+VF
Sbjct: 95  ALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVF 154

Query: 139 AQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMN 198
            QRFLSPA G  NGY+YW SWC TFALELSV+G++IQ+WT AVPL AWI IFW +LT+ N
Sbjct: 155 TQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSN 214

Query: 199 MFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIIS 258
           +FPVKYYGE EF IA IKV+A++GFII++F +VCGAG++ GP+GFRYWRNPG WGPGIIS
Sbjct: 215 LFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIIS 273

Query: 259 SDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILS 318
            D NEGRFLGWVSSLINAAFTYQGTELVGITAGE+ NPR+ +PRAI KV  RIL FYILS
Sbjct: 274 KDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILS 333

Query: 319 LFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVY 378
           L FIGLLVP+NDPKL S+  ++SSSPF+I+IENSGTKVLP IFNAV+L TI+SAGNSN+Y
Sbjct: 334 LLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIY 393

Query: 379 IGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNI 438
           +GSRVLY L+KN LAP+  +  T+ GVPY SVL T+ FGFLA+L +S  + K F+WLLNI
Sbjct: 394 VGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNI 453

Query: 439 TGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGF 498
           T +AGFFAWL IS +HIRFMQ ++ R +SR+DLP+KA+ MP+ AYY++FFI+LI++IQGF
Sbjct: 454 TAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGF 513

Query: 499 TAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIE 558
           TAFAP F   +F AAYIS+FLFLAIW+ FQ+ F+ R +               + +VW E
Sbjct: 514 TAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEE 573

Query: 559 PECKTRWQRVWDVLS 573
              K  W + W  ++
Sbjct: 574 ETPKNAWDKFWAAMA 588

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/518 (62%), Positives = 398/518 (76%), Gaps = 1/518 (0%)

Query: 56  TESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVI 115
           +E+   E  EVKR L +RH                    PL  +GPVG+LI+YLF+GTV+
Sbjct: 50  SENEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVV 109

Query: 116 YSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQ 175
           YSVTQSLGEM TFIPVT+SF++F+ RFLSPALGA NGYMYW SW  TFALELSV+G++IQ
Sbjct: 110 YSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQ 169

Query: 176 YWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAG 235
           +WT AVPL AWI IFW +LT  N+FPV+ YGE EF IA +KV A+LGFII+ FC+VCGAG
Sbjct: 170 FWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG 229

Query: 236 QSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 295
           ++ GP+GFRYWRNPG WG GIISS+  E RFLGW SSLINAAFT+QGTELVGITAGEAAN
Sbjct: 230 KT-GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAAN 288

Query: 296 PRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTK 355
           PR+ +P+AI+KVV RILVFYILSLFFIGLLVPY+D KL S+  +VSSSPF+I+IENSGTK
Sbjct: 289 PRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTK 348

Query: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSV 415
           +LP IFN V+L+TI+SAGNSNVYIGSR+L+ L+KN   P+  +  T+ GVP F+V+ TS+
Sbjct: 349 ILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSL 408

Query: 416 FGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKA 475
           FG LAF+E S G  +AF WLLN+ GVAGFF+WLLISF+HIRFMQ ++ RGISR+DLP+KA
Sbjct: 409 FGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKA 468

Query: 476 QMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRL 535
           + MP+LAYYA+  + +I+  QGFTAFAP F  ++F A+YIS+FLF   W SFQ+WFKCR 
Sbjct: 469 KFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRY 528

Query: 536 LWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           +WKL            E+ VW +      W + WD ++
Sbjct: 529 VWKLVDIDIDKDRREIEDRVWQDTTPANLWGKFWDFVA 566

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/512 (64%), Positives = 397/512 (77%), Gaps = 1/512 (0%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
           + R VKR LK RH                    PL +AGPVGALI+Y+F+GT+I+SVTQS
Sbjct: 89  KHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQS 148

Query: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181
           LGEMVTFIPVTSSF+VF+ RFLSPA GA NGYMYW SW  TFA+ELSVLGKVIQ+WT AV
Sbjct: 149 LGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTAV 208

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
           PLAAWIVIFW LLT  NMFPVKYYGE EF IA +KV++L+GF+IF  C+  GAG   GP 
Sbjct: 209 PLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGP-HGPF 267

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           GFRYWR+PGAWGPGII+ D++E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA+P
Sbjct: 268 GFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 327

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361
           +AIKKV++RIL FY+ SLFFIG+LVP+NDPKL S   FVSSSPF+I+I+NSG  +LP IF
Sbjct: 328 KAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSIF 387

Query: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421
           N V+LITI+SAGNSNVY+GSR+L+ L+ ++LAP+F +  T+ GVP+ +VL TS+FG LAF
Sbjct: 388 NGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAF 447

Query: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481
           LE++    K FNWLL+I  +AGFFAWLLIS SHIRFM+A+  RGISR+ LP+KA  MP+L
Sbjct: 448 LELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWL 507

Query: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXX 541
           AYYA+ FI LI+LIQGFTAFAP F   DFVA+YIS+ LF+ IW  FQ   KCR+ WK+  
Sbjct: 508 AYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVED 567

Query: 542 XXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                     E++ W +   KT W +VW  L+
Sbjct: 568 IDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/512 (64%), Positives = 393/512 (76%), Gaps = 3/512 (0%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
           E  +VKR+LK RH                    P+ +AGPVG+LI+Y+FMGT+++SVTQS
Sbjct: 98  EEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQS 157

Query: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181
           LGEM TFIPVTSSF+VFA RF+S   GA  GYMYW SW  TFALELSV+G+VI++WT  V
Sbjct: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
           PLAAWI IFW L+  MN FPVK YGEFEF +ASIKVIA++GFII+  C+VCGAG + GP+
Sbjct: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPV 276

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           GFRYWR+PG WGPGIIS DKNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK++P
Sbjct: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361
           RAIKKV VRIL+FYILSLFFIGLLVPYNDPKL S   +VS+SPF+I+I+NSGTKVLP IF
Sbjct: 337 RAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIF 396

Query: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421
           NAV+L TI+SA NSNVY+GSR+LY LS   LAP+F    TR GVP+ +VL T+ FG LA+
Sbjct: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455

Query: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481
           +E SAG   AFNWLLNITGVAGFFAWL IS SHIRFMQ ++ RG+SRDDLPYKA +MP L
Sbjct: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515

Query: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXX 541
           AYY +FF+ LI+LIQGFTAFAP F    F+ AYIS FLFL I++  Q +F+ RL   L  
Sbjct: 516 AYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDD 575

Query: 542 XXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                     + ++W E   +T W + W V++
Sbjct: 576 VDIDTDRRDIDTVIW-EEGPQTFWDKFWAVIA 606

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/532 (61%), Positives = 403/532 (75%), Gaps = 6/532 (1%)

Query: 44  TERKVEDDAAK--ETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGP 101
           T   ++DD+++  + E S  +  EVKR LK RH                    PL +AGP
Sbjct: 50  TLEAIDDDSSRMFDPEGSIGQA-EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGP 108

Query: 102 VGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161
           VG+LI+++ +GT+ YSVTQSLGEM TFIPVTSSF+VF+QRF+SPA+GA NGYMYW SW  
Sbjct: 109 VGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAI 168

Query: 162 TFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221
           TFALELS++G++IQYWT+AVPL AWI IFW LL S NMFPVK+YGEFEF +ASIKVIA++
Sbjct: 169 TFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAII 228

Query: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281
           GF+I+S C+VCGAG  +GPIGFRYWR PG WG GII+ + N+ RFLGWVSSLI+AAFTYQ
Sbjct: 229 GFLIYSLCMVCGAG-PEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQ 287

Query: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLD--SDGIF 339
           GTELVGITAGE  NPRKA+PRAI KV  RIL+FYI SLFFIGLLVPYNDPKL+   +G +
Sbjct: 288 GTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY 347

Query: 340 VSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN 399
           ++ SPF+I+I N  T VLP IFNAV+L TI+SAGNSNVY+GSR+L+ LSKN+LAP+F S 
Sbjct: 348 IAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSK 407

Query: 400 VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQ 459
            T+ GVP+ +VL T+VFGFLA+L VS  + + F+WLLNIT +AGF  WLLIS SHIRFMQ
Sbjct: 408 TTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQ 467

Query: 460 AIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFL 519
            ++ RGISRDDLPYKA+ MP+ AYYA+FFI +I++IQGFTAFAP F   DF AAYIS+FL
Sbjct: 468 TLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFL 527

Query: 520 FLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDV 571
           F  +W  FQ  ++ +L   L            + ++W E E K  W++ W V
Sbjct: 528 FFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAV 579

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/550 (59%), Positives = 415/550 (75%), Gaps = 9/550 (1%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           D+     N+ +        ED+  +   S      EVKR+LKQRH               
Sbjct: 28  DDDMKKINIIQQTDASSTTEDE--EMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLF 85

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                PL  +GPVG+LI+Y+F+GT+ Y+VTQSLGEM TFIPVTSSF+VFA RFLSP++GA
Sbjct: 86  IGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGA 145

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
             GYMYW SW  TFALELSV+G+++ YWT AVP+AAWI IFW +LT++NMFPVK+YGE E
Sbjct: 146 AVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIE 205

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGI------ISSDKNE 263
           F +A++KV+A++GF+I+  C+VCGAG + GP+GFRYWRNPG WG G+      IS +KN 
Sbjct: 206 FWVAAVKVVAIVGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGDGLTSNGVEISKNKNT 264

Query: 264 GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIG 323
           GRFLGW +SLINAAFTYQGTELVGITAGEAANPRK +PRAIKKVV RIL+FYI SLFFIG
Sbjct: 265 GRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIG 324

Query: 324 LLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRV 383
           LLVP++DPKL SD  +VSSSPF+I+IENSGTK+LPDIFNA++LITI+SAGNSN+Y+GSR+
Sbjct: 325 LLVPFDDPKLSSDDSYVSSSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRI 384

Query: 384 LYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAG 443
           L+SL+K  LAP+ LS  T+ GVP+ SVL+T+VFG LA++E + G    F+WL+NIT +AG
Sbjct: 385 LFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAG 444

Query: 444 FFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
           F+AWL I  SHIRFMQ ++ RGISRDDLP+KA +MP LAYYA F + +I++ QGFTAF P
Sbjct: 445 FWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTP 504

Query: 504 TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKT 563
           TF   DF AAYIS+ LF  IW +FQ+WFKCR +WKL            E+++W +PE KT
Sbjct: 505 TFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKT 564

Query: 564 RWQRVWDVLS 573
            W + W+V++
Sbjct: 565 FWDKFWNVVA 574

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/537 (58%), Positives = 398/537 (74%), Gaps = 3/537 (0%)

Query: 33  YSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXX 92
           +SG N+ +  TT   + DD   +TE +  +   VKR LKQRH                  
Sbjct: 73  HSGSNLHQHGTTS--LHDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGI 130

Query: 93  XPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNG 152
             PL++AGPVG+LI+Y+FMG+V+Y VTQSLGEM TFIPVTSS +VF++RFLSPA G  NG
Sbjct: 131 ATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANG 190

Query: 153 YMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCI 212
           YMYW +W  T+A+E+SV+G+VIQYWT+AVPLAAWI IFW ++T MN FPVK YGEFEF I
Sbjct: 191 YMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWI 250

Query: 213 ASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSS 272
           ASIKV+A++G++I++  +VCG G   GPIGFRYWRNPG WGPGIIS    E RFLGWVSS
Sbjct: 251 ASIKVLAIMGYLIYALIIVCG-GSHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSS 309

Query: 273 LINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPK 332
           LINAAFTYQGTELVGITAGEAANPRK++PRAI KVV RI +FYI+SLFFIGLLVP+ND +
Sbjct: 310 LINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDR 369

Query: 333 LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392
           L +D   ++SSPF+ISI+N+GT+ LPDIFNAVVL+TI+SA NSNVY+GSRVLY+L+    
Sbjct: 370 LANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGN 429

Query: 393 APRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISF 452
           AP+  S VT+ GVPY  V+ T+  G LAFL V+  +  AFNWL+NI+ +AG  AWL IS 
Sbjct: 430 APKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISL 489

Query: 453 SHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVA 512
           SHIRFMQA++ RGISRDDLP+KA++MP+ AYYASFF+ +I+ IQGF AF P F    F  
Sbjct: 490 SHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFT 549

Query: 513 AYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVW 569
           +YIS+ L   ++   Q++++CR +WK+            E ++W E E K  W++ W
Sbjct: 550 SYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDSDRREIEAIIWEEDEPKNLWEKFW 606

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/506 (61%), Positives = 392/506 (77%), Gaps = 2/506 (0%)

Query: 64  REVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLG 123
           + VKR LKQRH                    PL++AGPVG+LI+Y+FMGTVIY +TQSLG
Sbjct: 104 KHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLG 163

Query: 124 EMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPL 183
           EM TFIPVTSS +VF++RFLSPA G +NGYMYW +W  T+A+E+SV+G+VIQYWT+ VPL
Sbjct: 164 EMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPL 223

Query: 184 AAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGF 243
           AAWI IFW L+T MN FPVK YGEFEF +AS+KV+A++G++I++  +VCG G   GPIGF
Sbjct: 224 AAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCG-GSHQGPIGF 282

Query: 244 RYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRA 303
           RYWRNPGAWGPGIIS +K+EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK +PRA
Sbjct: 283 RYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 342

Query: 304 IKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNA 363
           I KVV RI++FYI+SLFFIGLLVPYN+P+L      ++SSPF+ISI+N+GT  LPDIFNA
Sbjct: 343 INKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNA 402

Query: 364 VVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLE 423
           VVLIT++SA NSNVY+GSRVLYSL+++  AP+    VT+ GVPY  VLST+  G LAFL 
Sbjct: 403 VVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLV 462

Query: 424 VSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAY 483
           V+  +  AFNWL++I+ +AG  AWL IS +HIRFMQA+++RGISRDDLP+KA++MP+ AY
Sbjct: 463 VNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAY 522

Query: 484 YASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXX 543
           YASFF+ +I+ IQGF AF P F   +F  +YIS+ L   +++S Q+++KCR +WKL    
Sbjct: 523 YASFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDID 581

Query: 544 XXXXXXXXEELVWIEPECKTRWQRVW 569
                   E ++W + E K  W++ W
Sbjct: 582 IDSDRREIEAIIWEDDEPKNLWEKFW 607

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/536 (58%), Positives = 405/536 (75%), Gaps = 4/536 (0%)

Query: 36  ENVTKAITTERKV--EDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
            ++T ++T  + V  E D  ++ E +  E + VKR LKQRH                   
Sbjct: 74  NSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGIS 133

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
            PL++AGPVG+LI+Y+FMGT++Y VTQSLGEM TFIPVTSS +VF++RFLSPA G +NGY
Sbjct: 134 TPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGY 193

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
           MYW +W  T+A+E+SV+G+VI+YWT+ VPLAAWI IFW ++T MN FPVK YGEFEF +A
Sbjct: 194 MYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVA 253

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
           S+KV+A++G++I++  +VCG G   GPIGFRYWRNPGAWGPGIISSDK+EGRFLGWVSSL
Sbjct: 254 SVKVLAIMGYLIYALIIVCG-GSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSL 312

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           INAAFTYQGTELVGITAGEAANPRK +PRAI KVV RI++FYI+SLFFIGLLVPYND +L
Sbjct: 313 INAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRL 372

Query: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393
            +    ++SSPF+ISI+N+GT  LPDIFNAVVLIT++SA NSNVY+GSRVLYSL++   A
Sbjct: 373 SASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNA 432

Query: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453
           P+    VTR GVPY  V+ T+  G LAFL V+  +  AFNWL+NI+ +AG  AWL IS +
Sbjct: 433 PKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLA 492

Query: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA 513
           HIRFMQA++ RGISRDDLP+KA++MP+ AYYA+FF+ +I+ IQGF AF P F+  +F  +
Sbjct: 493 HIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTS 551

Query: 514 YISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVW 569
           YIS+ L   +++  Q+++KCR +WKL            E ++W + E K  W++ W
Sbjct: 552 YISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFW 607

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/508 (61%), Positives = 389/508 (76%), Gaps = 2/508 (0%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
           E + VKR LKQRH                    PL+ AGPVG+LISY+FMGTV+Y +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181
           LGEM TFIPVTSS +VF++RFLSPA G  NGYMYW +W  T+A+E+SV+G+VIQYWT+ V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
           PLA WI IFW L+T MN FPVK YGEFEF +AS+KV+A++G++I++  +VCG G   GPI
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCG-GSHQGPI 281

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK +P
Sbjct: 282 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 341

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361
           RAI KVV RI++FYI+SLFFIGLLVPYN+P+L +    ++SSPF+ISI+N+GT  LPDIF
Sbjct: 342 RAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIF 401

Query: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421
           NAVVLIT++SA NSNVY+GSRVLYSL++   AP+    VT+ GVPY  VLST+  G LAF
Sbjct: 402 NAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAF 461

Query: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481
           L V+  +  AFNWL+NI+ +AG  AWL IS +HIRFMQA+ +RGISRDDLP+KA++MP+ 
Sbjct: 462 LVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYG 521

Query: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXX 541
           AYYA+FF+ +I+ IQGF AF P F+  DF  +YIS+ L   ++   Q+++KCR +WKL  
Sbjct: 522 AYYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLED 580

Query: 542 XXXXXXXXXXEELVWIEPECKTRWQRVW 569
                     E ++W + E K  W++ W
Sbjct: 581 IDIDTDRREIEAIIWEDDEPKNLWEKFW 608

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/508 (60%), Positives = 387/508 (76%), Gaps = 2/508 (0%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
           E + V+R LKQRH                    PL++AGPVG+LI+Y+FMGTV+Y VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181
           LGEM TFIPVTSS +VF++RFLSPA G +NGYMYW +W  T+A+E+SV+G+VI+YWT  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
           PL  WI IFW L+T MN FPVK YGEFEF +AS+KV+A++G++I++  +VCG G   GPI
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCG-GSKQGPI 280

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK +P
Sbjct: 281 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 340

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361
           RAI KVV RI++FYI+SLFFIGLLVPY DP+L +    ++SSPF+ISI+N+GT  LPDIF
Sbjct: 341 RAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIF 400

Query: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421
           NA+VLIT++SA NSNVY+GSRVLYSL++   AP+    VT+ GVPY  VLST+  G LAF
Sbjct: 401 NAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAF 460

Query: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481
           L V+  +  AFNWL+NI+ +AG  AWL IS SHIRFMQA+ +RGISRDDLP+KA+ MP+ 
Sbjct: 461 LVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYG 520

Query: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXX 541
           AYYASFF+ +I+ IQGF +F P F+  DF  +YIS+ L   ++   Q+++KCR +WKL  
Sbjct: 521 AYYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLED 579

Query: 542 XXXXXXXXXXEELVWIEPECKTRWQRVW 569
                     E ++W + E K  W++ W
Sbjct: 580 IDIDSDRREIEAIIWEDDEPKNLWEKFW 607

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/536 (56%), Positives = 396/536 (73%), Gaps = 6/536 (1%)

Query: 44  TERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVG 103
           +  +VE +  ++ E +  E ++VKR+LKQRH                    PLA AGPVG
Sbjct: 62  SRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVG 121

Query: 104 ALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTF 163
           ALI+Y+FMG+++Y VTQ+LGEM TFIPVTSS +VF+QRFLSPA G  NGYMYW +W  TF
Sbjct: 122 ALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITF 181

Query: 164 ALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGF 223
           A+E+SV+G+VIQYWT+AVPLAAWI IFW L+T MN FPVK YGE EF +A +KVIA++G+
Sbjct: 182 AVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGY 241

Query: 224 IIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIIS------SDKNEGRFLGWVSSLINAA 277
           ++++  +VCG  +  GPIGFRYWRNPGAWG G+ S      S K EGRFLGWV+SLINAA
Sbjct: 242 LLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAA 301

Query: 278 FTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDG 337
           FTYQGTELVGITAGEAANPRK +PRAI KVV RI++FYI+SLFFIGLLVP+ D +L  D 
Sbjct: 302 FTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDT 361

Query: 338 IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL 397
             ++SSPF+ISIEN+GTK+LPDIFNA+V++T+LSA NSNVY+GSRVLYSL+   +AP+  
Sbjct: 362 TVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIF 421

Query: 398 SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457
           + VTR GVP+  V+ TS+ G LAFL V   +  AFNWL++I+ +AG  AWL IS +H+RF
Sbjct: 422 ARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRF 481

Query: 458 MQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISI 517
           MQ +++RGISRDDLP+KA+ MP+ +YYA+F++ +I+ +QGF AF+P F    F   YIS+
Sbjct: 482 MQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISL 541

Query: 518 FLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
            L   +++  Q++++CR LWKL            E+ +W + E KT W + W  ++
Sbjct: 542 ILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/544 (57%), Positives = 398/544 (73%), Gaps = 4/544 (0%)

Query: 31  EQYS-GENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           E Y  G    +A+  E +   D+  +  SS   R  V+R+LK RH               
Sbjct: 19  EDYEMGSFAEEALDQEAQSSQDS--QLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLF 76

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                PL +AGPVGALISYLFMG++ Y VTQSLGEM TFIPVTSSF+VF +RFLS  LGA
Sbjct: 77  IGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRFLSLPLGA 136

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
            NGYMY  SW  T+ALELS++G++I+YWT AVP AAWI IFW  +T  N+ PVK+YGEF+
Sbjct: 137 ANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQ 196

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F IA IKV+A++GF+++  C+VCGAG++ GP+GFRYWRNPG WG GIIS D +EGRFLGW
Sbjct: 197 FWIALIKVVAIIGFLVYCLCMVCGAGKT-GPVGFRYWRNPGPWGDGIISHDIHEGRFLGW 255

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
           VSSL+NAAFTYQGTELVGI+AGE+ANPRK +P+AI KV  RIL+FY+ SLFFIGLLVP+N
Sbjct: 256 VSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFN 315

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           D KL S   + + SPF+I+I+NSGTK+LPDIFNAV+L TI+SA NSNVY+GSRVLY L+K
Sbjct: 316 DEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAK 375

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
             LAPRF +   R GVP  +VL  + FGFL +L VS G+ KAF+WLLNIT +AGFF+WL 
Sbjct: 376 ERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLF 435

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPID 509
           IS  H+RFMQA++ +GISRDDLP+KA++MP+ AYY++FFI LI++IQGFT+ APTF   +
Sbjct: 436 ISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPTFNVSN 495

Query: 510 FVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVW 569
           F AAYIS+F+FL IW  FQ W++ R++ ++            +   W   E  T W + W
Sbjct: 496 FFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQWDNTEPTTLWGKFW 555

Query: 570 DVLS 573
             ++
Sbjct: 556 AAMA 559

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/546 (57%), Positives = 408/546 (74%), Gaps = 4/546 (0%)

Query: 31  EQYSGENVTKAIT--TERKVEDDAAKE-TESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           E +  + VT+ +T  T   V D   +E  E +      VKR LKQRH             
Sbjct: 29  ELHPLDPVTQQVTLRTVTNVCDGLEEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTG 88

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPAL 147
                  PL++AGPVG+LI+YLFMG+++Y +TQSLGEM TFIPVTSS +VF++RFLSPA 
Sbjct: 89  LFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAF 148

Query: 148 GATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGE 207
           G  NGYMYW +W  T+A+E+SV+G+VIQ+WT AVPLAAWI IFW  ++ +N FPVK YGE
Sbjct: 149 GVANGYMYWFNWAITYAVEISVIGQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGE 208

Query: 208 FEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFL 267
            EF +ASIKVIA++G++I++  +VCG G S GPIGFRYWRNPG WGPGIIS DKNEGRFL
Sbjct: 209 IEFWVASIKVIAIVGYLIYALVIVCG-GSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFL 267

Query: 268 GWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVP 327
           GWVSSLINAAFTYQGTELVGITAGEAANPRK++PRAI KVV RI++FYI+SLFF+G+LVP
Sbjct: 268 GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVP 327

Query: 328 YNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           +NDP+L S+   ++SSPF+ISI+N+GT+VLP IFNAVV++TI+SA NSNVY+GSRVLY+L
Sbjct: 328 FNDPRLASNVAVIASSPFVISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYAL 387

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           S+   AP+    VTR GVPY  V++TS+ G LAFL V+  +  AFNWL+NI+ +AG  AW
Sbjct: 388 SQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAW 447

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP 507
           L IS SHIRFMQA++ RGISRDDLP+KA++MP+ AYYA+FF+ +I+ IQGF AF+P F  
Sbjct: 448 LFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDV 507

Query: 508 IDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQR 567
             F  AYIS+ + + + +  Q++++CR LWKL            E ++W E E +  W++
Sbjct: 508 SGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWEK 567

Query: 568 VWDVLS 573
            W +++
Sbjct: 568 FWSIMA 573

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/523 (60%), Positives = 398/523 (76%), Gaps = 1/523 (0%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           +   + +++  + R ++R LK RH                    PL  AGPVG+LISYLF
Sbjct: 34  EQQSQIDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLF 93

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
           MG++ + VTQSLGEM TFIPV SSF+VF +RFLSPALGA NGYMY  SWC TFALELS++
Sbjct: 94  MGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIV 153

Query: 171 GKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCV 230
           G++IQYWT  VP AAWI+IFW  ++  N+  VK+YGEF+F IA IKVIA++GF+I+  C+
Sbjct: 154 GEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCM 213

Query: 231 VCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITA 290
           VCGAG++ GP+GFRYWRNPG WG GIIS  K+EGRFLGWVSSL+NAAFTYQGTELVG++A
Sbjct: 214 VCGAGKT-GPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSA 272

Query: 291 GEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIE 350
           GE+ANPRK +P+AI+KV +RIL+FY+ SLFFIGLLVP+NDPKLDS   + +SSPF+I+I+
Sbjct: 273 GESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQ 332

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
           NSGT+ LPDIFNAV+L TI+SA NSNVY+GSRVLY L+K  LAP+ +  + R GVPY  V
Sbjct: 333 NSGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICV 392

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
              S+FGFL +L VS+GS KAF+WLLNIT +AGFFAWL IS  HIRFMQA++ +GISRDD
Sbjct: 393 GIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDD 452

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVW 530
           LP+KA++MP+ AYYA+FFI LI++IQGFTAFAP F   +F AAY+S+FLF+A+W+ FQV 
Sbjct: 453 LPFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVI 512

Query: 531 FKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           FK RL+ K+            E  VW + E    W + W  ++
Sbjct: 513 FKSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/505 (59%), Positives = 383/505 (75%), Gaps = 1/505 (0%)

Query: 65  EVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124
           +VKR LKQRH                    PL ++GPVG+LI+YLFMG++IY +TQSLGE
Sbjct: 92  QVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSLGE 151

Query: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLA 184
           M TFIPVTSS +VF++RFLSPA G  NGYMYW +W  TFA+E+SV+G+VI+YWT+ VPLA
Sbjct: 152 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKVPLA 211

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244
           AWI IFW L+T +N FPVK YGE EF IA IKV+A++G+++++  +VCG G S GPIGFR
Sbjct: 212 AWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCG-GSSQGPIGFR 270

Query: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304
           YWRNPG WGPGIIS D N GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK +PRAI
Sbjct: 271 YWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 330

Query: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAV 364
            KVV RI +FYI+SLFFIG+LVPYND +L S    ++SSPF+ISI+N+GTKVLPDIFNA+
Sbjct: 331 NKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFNAI 390

Query: 365 VLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEV 424
           V+ITI+SA NSNVY+GSRVLY+L+ +  AP+  + VTR GVPY  V+ TS  G LAFL V
Sbjct: 391 VMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFLVV 450

Query: 425 SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYY 484
           +  +  AFNWL+NI+ +AG  AWL IS SHIRFMQA++ RGISRDDLP+KA++MPF AYY
Sbjct: 451 NNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGAYY 510

Query: 485 ASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXX 544
           A+FF+ +I+ IQGF AF+P +    F  +YIS+ +   +++  Q++++CR  W++     
Sbjct: 511 ATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDIDI 570

Query: 545 XXXXXXXEELVWIEPECKTRWQRVW 569
                  E ++W + E KT W + W
Sbjct: 571 DSDRREIEAVIWEDDEPKTLWDKFW 595

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/509 (60%), Positives = 390/509 (76%), Gaps = 1/509 (0%)

Query: 65  EVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124
            VKR LKQRH                    PL+++GPVGALI+Y+FMGT+IY VTQSLGE
Sbjct: 90  RVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGE 149

Query: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLA 184
           M TFIPVTSS +VF++RFLSPA G  NGYMYW +W  T+A+E+SV+G+VIQYWT  VPLA
Sbjct: 150 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLA 209

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244
           AWI IFW L+T MN FPVK YGEFEF +ASIKVIA++G++I++  +VCG G   GPIGFR
Sbjct: 210 AWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCG-GSHQGPIGFR 268

Query: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304
           YWRNPGA G GIISSD  E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK++PRAI
Sbjct: 269 YWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 328

Query: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAV 364
            KVV RI++FYI+SLFF+GLLVPYNDP+L +    ++SSPF+ISI+N+GTKVLPDIFNAV
Sbjct: 329 NKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIFNAV 388

Query: 365 VLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEV 424
           VL+T++SA NSNVY+GSRVLY+L+++  AP+  + VTR GVPY  V+ T++ G LAFL V
Sbjct: 389 VLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLVV 448

Query: 425 SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYY 484
           +  +  AFNWL+NI+ +AG  AWL IS +HIRFMQA++ RGISRDDLP+KA+ MP+ AYY
Sbjct: 449 NHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAYY 508

Query: 485 ASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXX 544
           ASFF+ +I+ IQGF AFAP F   +F  AYIS+ L + ++   Q++++CR LWKL     
Sbjct: 509 ASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLEDIDI 568

Query: 545 XXXXXXXEELVWIEPECKTRWQRVWDVLS 573
                  + +VW + E +  W++ W  ++
Sbjct: 569 DSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/538 (57%), Positives = 395/538 (73%), Gaps = 1/538 (0%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
           EN       + + + D + + E       EVKR LK RH                    P
Sbjct: 44  ENDGYGYRVDNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEP 103

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMY 155
           L +AGPVG LI+YLFM T+ +SV QSLGEM T+IPVTS+FSVF+QRFLSPA GA NGYMY
Sbjct: 104 LQNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMY 163

Query: 156 WLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASI 215
           W SW  TFALELSV+G+++QYWT  VP+AAWI IFW L+  +N  PVK+YGEFEF IA I
Sbjct: 164 WFSWSITFALELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFI 223

Query: 216 KVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLIN 275
           KV+A++GFII+ F +VCGAG++ GP+GFRYWR+  A+G GIIS +KNE RFLGWVSSLIN
Sbjct: 224 KVVAIVGFIIYCFIMVCGAGKT-GPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLIN 282

Query: 276 AAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS 335
           AAFTYQGTELVGITAGEAANPRK +P++IK+ + RIL+FYI SL F+GLLVP+ND  L  
Sbjct: 283 AAFTYQGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQD 342

Query: 336 DGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPR 395
              + +SSPF+++I+NSGTK LPDIFNAV+L T++SA NS+VY+GSRV+YS+++N LAP 
Sbjct: 343 SRSYAASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPP 402

Query: 396 FLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 455
            L+  ++GGVPY +VL TS  G LA+LE S+     FNWL+NITGVAGFF+W LIS+SH+
Sbjct: 403 ILAKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHL 462

Query: 456 RFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYI 515
           RFM+A+++RGISR+DLP+KA  MP++A Y+ FF+ LI+L+QGFT F P FQ  DFVA+YI
Sbjct: 463 RFMKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYI 522

Query: 516 SIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           S+ LF  IW  FQ+WF+C LL  +            +  VW +   KT W + W++++
Sbjct: 523 SVGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/549 (56%), Positives = 403/549 (73%), Gaps = 18/549 (3%)

Query: 36  ENVTKAITTERKVEDDAAKET--------ESSPQER-------REVKRKLKQRHXXXXXX 80
           EN   +++  +K+ED  + ET        +++P E+        EVKR LK RH      
Sbjct: 13  ENTKPSVS--KKLEDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIAL 70

Query: 81  XXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQ 140
                         PL+ +GPVGALI+Y+F+G+++Y VTQSLGEM TFIPVTSS +VF++
Sbjct: 71  GGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSK 130

Query: 141 RFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMF 200
           RFLSPA G  NGYMYW +W  T+A+E++V+G+VIQYWT+AVPLAAWI IFW L+T  N F
Sbjct: 131 RFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFF 190

Query: 201 PVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSD 260
           PVK+YGE EF +AS+KVIA++G++I++  +VCG G   GPIGFRYWRNPG WGPGIIS D
Sbjct: 191 PVKFYGEVEFWVASVKVIAIVGYLIYALVIVCG-GSHQGPIGFRYWRNPGPWGPGIISKD 249

Query: 261 KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLF 320
            NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK +PRAI KV  RIL FYILSLF
Sbjct: 250 VNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLF 309

Query: 321 FIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIG 380
           FIGLLVPY+D +L +    ++SSPF+ISI+N+GTKVLP IFNA+V+ITI+SA NSNVY+G
Sbjct: 310 FIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVG 369

Query: 381 SRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITG 440
           SRVLYSL+ +  AP+    VT+ GVPY  V+ T++ G LAFL V+  + +AFNWL+NI+ 
Sbjct: 370 SRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNIST 429

Query: 441 VAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTA 500
           +AG  AWL IS SH+RFMQ ++ RGISR+DLP+KA++MP+ AYYA+FFI +I++IQGF A
Sbjct: 430 LAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKA 489

Query: 501 FAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPE 560
           F P F+  DF  +YIS+ L   ++L  Q++++CR +W L            + +VW + E
Sbjct: 490 FTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDE 549

Query: 561 CKTRWQRVW 569
            K  W++ W
Sbjct: 550 PKNLWEKFW 558

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/505 (60%), Positives = 384/505 (76%), Gaps = 1/505 (0%)

Query: 65  EVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124
           EVKR LKQRH                    PL ++GPVG+LI+YLFMG++IYS+TQSLGE
Sbjct: 100 EVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGE 159

Query: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLA 184
           M TFIPVTSS +VF++RFLSPA G  NGYMYW +W  T+A+E+SV+G+VI+YWT+ VPLA
Sbjct: 160 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVPLA 219

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244
           AWI IFW  +T MN FPVK YGE EF IA +KV+A+ G+++++  +VCG G S GPIGFR
Sbjct: 220 AWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCG-GSSQGPIGFR 278

Query: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304
           YWRNPG WG GIIS DKN  RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK++PRAI
Sbjct: 279 YWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 338

Query: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAV 364
            KVV RI +FYI+SLFFIGLLVPY+DP+L SD   V+SSPF+ISI+N+GTK+LPDIFNA+
Sbjct: 339 NKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDIFNAI 398

Query: 365 VLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEV 424
           V+IT++SA NSNVY+GSRVLY+L++   AP+  + VTR GVPY  VL T+  G LAFL V
Sbjct: 399 VMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFLVV 458

Query: 425 SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYY 484
           +  +  AFNWL+NI+ +AG  AWL IS SHIRFMQA++ RGISRDDLP+KA+ MP+ AYY
Sbjct: 459 NNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAAYY 518

Query: 485 ASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXX 544
           A+FF+ +I+ IQGF AF+P F    F  AYIS+ +   +++  Q++++CR  WKL     
Sbjct: 519 ATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDIDI 578

Query: 545 XXXXXXXEELVWIEPECKTRWQRVW 569
                  EE++W + E KT W + W
Sbjct: 579 DTDRREIEEVIWEDDEPKTYWDKFW 603

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/532 (58%), Positives = 396/532 (74%), Gaps = 10/532 (1%)

Query: 48  VEDDAAKETES-SPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           +  +   E ES    +  +VKR LK RH                    P+  AGPVG+L+
Sbjct: 43  INQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLL 102

Query: 107 SYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALE 166
           +YLFMGT+ + VTQSLGEM TFIPVTSSF+++ QRFLSPALGA NGY+YW SWC TFALE
Sbjct: 103 AYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALE 162

Query: 167 LSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIF 226
           LS++G++IQYWT AVPL+ WIV+FW LLT+ NM PV++YGE EF IA++KV+++ GF+I+
Sbjct: 163 LSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIY 222

Query: 227 SFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELV 286
           +  +VCG G S+G +GFRYW+NPG WG G+ISS+K E RFLGWVSSLI AAFTYQGTELV
Sbjct: 223 ALVMVCG-GSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281

Query: 287 GITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL----DSDGIFVSS 342
           GITAGE+ NPRK +P+AI KV  RIL FYILSLFF+GLLVPY DP+L    DSD   +++
Sbjct: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSD---INT 338

Query: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402
           SPF+++I+NSGTKVLP +FN V+L+TILSAGNSN+YIGSRVLY LSK+ LAP       +
Sbjct: 339 SPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNK 398

Query: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462
            GVP+++VL++S+FG LA+L +S  + K F+WLL IT VAGFFAWLLIS SHIRFMQ ++
Sbjct: 399 QGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLK 458

Query: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLA 522
            RGISR+DLP+KA+ MP+ AYYA+FFI +I+LIQGF +FAP F   +F+A YIS+FLF+ 
Sbjct: 459 DRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIV 518

Query: 523 IWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVW-IEPECKTRWQRVWDVLS 573
            WL FQV FK RL+ +             + LVW  + E KT  Q++W   S
Sbjct: 519 CWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSFS 570

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/534 (57%), Positives = 394/534 (73%), Gaps = 3/534 (0%)

Query: 37  NVTKAITTERKVED-DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
           NV+ A  +     D D +   E+   +   VKR LKQRH                    P
Sbjct: 64  NVSVADNSSAANGDLDLSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTP 123

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMY 155
           L +AGPVGALI+Y+FMG++IY +TQSLGEM TFIPVTSS +VF++RFLSPA G TNGYMY
Sbjct: 124 LGNAGPVGALIAYIFMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMY 183

Query: 156 WLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASI 215
           W +W  T+A+E+SV+G+VIQYWT+AVPLAAWI IFW  +T +N FPVK YGE EF +ASI
Sbjct: 184 WFNWAITYAVEISVVGQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASI 243

Query: 216 KVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLIN 275
           KV+A++G++I++  +VCG G S GPIGFRYWRNPG WGPGIIS D NEGRFLGWVSSLIN
Sbjct: 244 KVLAIIGYLIYALVIVCG-GSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLIN 302

Query: 276 AAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS 335
           AAFTYQGTELVGITAGEAANPRK++PRAI KVV RI +FYI+SLFFIGLLVPYND  L S
Sbjct: 303 AAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSS 362

Query: 336 DGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPR 395
              +++SSPF+ISI+N+GT  LPDIFNAVV++TI+SA NSNVY+GSRVLY+L++   AP+
Sbjct: 363 GDSYIASSPFVISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPK 422

Query: 396 FLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 455
             + VT+ GVP+  V+ T+  G LAFL V+  +  AFNWL+NI+ +AG  AW  I+ SHI
Sbjct: 423 QFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHI 482

Query: 456 RFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYI 515
           RFMQA++ RGISRDDLP+KA++MP+ AYY++FF+ +I+ IQGF AF P +    F  +YI
Sbjct: 483 RFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYI 541

Query: 516 SIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVW 569
           S+ L + +++  Q++++CR L K+            E ++W + E K  W++ W
Sbjct: 542 SLILLVVVFIGCQLYYRCRFLLKVEDIDIDTDRREIEAIIWEDDEPKNLWEKFW 595

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/533 (56%), Positives = 391/533 (73%), Gaps = 3/533 (0%)

Query: 43  TTERKVEDDAAKETESSPQERRE--VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAG 100
           + +    D    +TES   + +E  VKR LK RH                    PL+++G
Sbjct: 90  SQDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSG 149

Query: 101 PVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 160
           PVGALI+Y+FMGTV+Y VTQS+GEM TFIPVTSS +VF+ RFLSPA G  NGYMYW +W 
Sbjct: 150 PVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWA 209

Query: 161 FTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIAL 220
            TFA+ELSV G+VI+YWTEAVP AAWI IFW L+T  N FPV++YGE EF +ASIKV+A+
Sbjct: 210 ITFAVELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAI 269

Query: 221 LGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY 280
           +G++I++  +VCG G   GPIGFRYWRNPG WG GIIS DK+EGRFLGWV+SLINA+FTY
Sbjct: 270 VGYLIYALVIVCG-GSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTY 328

Query: 281 QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFV 340
           QGTELVGITAGEAANPR+ +PRAI KV  RIL FYILSLFF+GLLVPYN   LD     +
Sbjct: 329 QGTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVI 388

Query: 341 SSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNV 400
           +SSPF+ISI+N+GT+ LPDIFNAVVL+TI+SA NSNVY+GSRVL+SL+   +AP+  S+V
Sbjct: 389 ASSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSV 448

Query: 401 TRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQA 460
           T  GVP+  V+ TS+ G LAFL V+  + +AFNWL+NI+ +AG  AWL IS SHIRFMQ 
Sbjct: 449 TPQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQC 508

Query: 461 IRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLF 520
           +++RGISRDDLP+K+++MP+ AYYA+F++ +I+ +QGF AF+P F+  +F  +YIS+ L 
Sbjct: 509 LKQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLL 568

Query: 521 LAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           + ++   Q++++CR   +L            + L+W + E  T W + W  ++
Sbjct: 569 VVVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/551 (55%), Positives = 391/551 (70%), Gaps = 9/551 (1%)

Query: 31  EQYSGE---NVTKAITTERKVEDDAAKETESSPQE----RREVKRKLKQRHXXXXXXXXX 83
           E+YS +   N    I  E    D   +  E   QE      EVKR LK RH         
Sbjct: 18  ERYSKKAKGNNGSEIALESITPDSGDEFPEEHEQEGDYHETEVKRALKARHISMIALGGT 77

Query: 84  XXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFL 143
                      PL  AGPVG+LI+Y+FMGTV+YS+TQSLGEM TFIPVTSS +VF++RFL
Sbjct: 78  IGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTVFSKRFL 137

Query: 144 SPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVK 203
           SPA G  NGYMYW +W  TFA+ELSV+G++I YWT  VPL AWI IFW ++T +N FPV+
Sbjct: 138 SPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFPVR 197

Query: 204 YYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNE 263
           +YGE EF IAS+KVI ++G++I++F VVCG G S GPIGFR WRNPG WG G+ISS++ E
Sbjct: 198 FYGEIEFWIASVKVITIVGYLIYAFIVVCG-GSSQGPIGFRNWRNPGPWGTGVISSNQTE 256

Query: 264 GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIG 323
            RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK +P+AI KV  RIL FYILSLFF+G
Sbjct: 257 ARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVG 316

Query: 324 LLVPYNDPKLD-SDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSR 382
           LLVPYNDP++D +    V++SPF+ISI N+GTK+LPDIFNAVVL+T++SA NSNVYIGSR
Sbjct: 317 LLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSR 376

Query: 383 VLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVA 442
           V+YSL+++  AP+    V R GVP   V+ T++ G +AFL V+  +  AFNWL+NI+ +A
Sbjct: 377 VIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLA 436

Query: 443 GFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFA 502
           G  AWL IS +HIRFMQ +++RGISRD LP+KA+ MP+ AYYA+ F+ +I+ IQG+TAF+
Sbjct: 437 GLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAFS 496

Query: 503 PTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECK 562
           P F    F  AYIS+ L L +++  Q+++KCR LWKL            + +VW + E K
Sbjct: 497 PKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDTNRREIDAIVWEDDEPK 556

Query: 563 TRWQRVWDVLS 573
             W + W  ++
Sbjct: 557 NLWDKFWSTIA 567

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/548 (56%), Positives = 400/548 (72%), Gaps = 10/548 (1%)

Query: 29  VDEQYSGENVTKAITTER---KVED----DAAKETESSPQERREVKRKLKQRHXXXXXXX 81
           V  Q    +VT ++T  R   +V+D    D + E E+   E + VKR LKQRH       
Sbjct: 49  VSTQADVHSVTGSLTRSRLNSRVDDGAESDGSDELEAEVHETK-VKRALKQRHIGMIALG 107

Query: 82  XXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQR 141
                        PL+ AGPVG+LI+Y+FMGT+IY VTQSLGEM TFIPVTSS +VF++R
Sbjct: 108 GTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKR 167

Query: 142 FLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP 201
           FLSPA G  NGYMYW +W  T+A+E+SV+G+VIQYWT+AVPLAAWI IFW L+T MN FP
Sbjct: 168 FLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFP 227

Query: 202 VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDK 261
           VK YGE EF IA +KV+A++G++I++  +VCG G   GPIGFRYWR+PGA+GPGIIS +K
Sbjct: 228 VKVYGEVEFWIAFVKVLAIVGYLIYALVIVCG-GSHQGPIGFRYWRHPGAFGPGIISKNK 286

Query: 262 NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFF 321
           N G+FLGWV+SLINAAFTYQGTELVGITAGEAANPRK +PRAI KVV RI++FYI+SLFF
Sbjct: 287 NTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFF 346

Query: 322 IGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGS 381
           IG+L+PYND +L +    ++SSPF+ISI+N+ TKVLPDIFNAVV++T++SA NSNVY+GS
Sbjct: 347 IGMLLPYNDKRLSAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGS 406

Query: 382 RVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGV 441
           RVLY+L+    AP+  S VTR GVPY  V+ T+  G LAFL V+  +  AFNWL+NI+ +
Sbjct: 407 RVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTL 466

Query: 442 AGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF 501
           AG  AWL IS +HIRFMQA++ RGISRDDLP+KA++MP+ AYYA+FF+ +I+ IQG+ AF
Sbjct: 467 AGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAF 526

Query: 502 APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPEC 561
            P +    F  +YIS+ L   + +  Q++++ R L KL            E +VW + E 
Sbjct: 527 CP-WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEP 585

Query: 562 KTRWQRVW 569
           KT W + W
Sbjct: 586 KTLWDKFW 593

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/526 (56%), Positives = 390/526 (74%), Gaps = 2/526 (0%)

Query: 44  TERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVG 103
           +E ++  D     E+  ++ + VKR LK RH                    PL  +GPVG
Sbjct: 81  SEARISSDEYDHQEAEFKDTK-VKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVG 139

Query: 104 ALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTF 163
           +LI+Y+FMGTV+Y VTQ+LGEM TFIPVTSS +VF+ RFLSPA G +NGY+YW +W  T+
Sbjct: 140 SLIAYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITY 199

Query: 164 ALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGF 223
           A+E+SV+G+VI++WT  VPLAAWI IFW L+T++N FPV  YGE EF +AS+KV+A++G+
Sbjct: 200 AVEISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGY 259

Query: 224 IIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGT 283
           +I++  +VCG G   GPIGFRYWR+  A G G+IS DKNE RFLGWV+SLINAAFTYQGT
Sbjct: 260 LIYALVIVCG-GSKQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGT 318

Query: 284 ELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSS 343
           ELVGITAGEAANPRK++PRAI KVV RI++FYILSLFFIGLLVPYNDPKL+S   +++SS
Sbjct: 319 ELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASS 378

Query: 344 PFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRG 403
           PF+ISIEN+GT+ LP IFNA+++ITI+SA NSNVY+ SRVLYSL+ +  AP+  + VT  
Sbjct: 379 PFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQ 438

Query: 404 GVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRK 463
           GVP+  V+ T++ G LAFL V+  + +AFNWL+NI+ +AG  AWL IS SH+RFM+A++ 
Sbjct: 439 GVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKY 498

Query: 464 RGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAI 523
           RGISRDDLP+KA+ MP+ +YYA FFI +I+ IQGFTAF+P F    F  AYIS+ L   +
Sbjct: 499 RGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVL 558

Query: 524 WLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVW 569
           ++  Q++++CR  WK+            +E+VW + E KT W + W
Sbjct: 559 FIGCQLYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKTAWDKFW 604

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/537 (55%), Positives = 384/537 (71%), Gaps = 7/537 (1%)

Query: 33  YSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXX 92
           YS E            EDD     E       +VKR LK RH                  
Sbjct: 27  YSNETQNGGSGHNSSFEDDEGDLQEG------QVKRALKPRHVSMIALGGTIGTGLFVGI 80

Query: 93  XPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNG 152
             PL+ AGPVGALI+Y+FMG+++Y VTQS+GEM TFIPVTSS +VF+ RFLSPA G  NG
Sbjct: 81  ASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANG 140

Query: 153 YMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCI 212
           YMYW +W  T+A+E+SV+G+VIQYWT+AVPLAAWI IFW  +T  N FPV++YGE EF +
Sbjct: 141 YMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWV 200

Query: 213 ASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSS 272
           ASIKVIA++G+++++  +VCG G   GPIGFRYWRNPG WG GIIS DK++GRFLGWV+S
Sbjct: 201 ASIKVIAIVGYLLYALIIVCG-GSKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVAS 259

Query: 273 LINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPK 332
           LINA+FTYQGTELVGITAGEAANPRK +P+AI KV  RIL FYILSLFF+GLLVPYN P 
Sbjct: 260 LINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPG 319

Query: 333 LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392
           LD     ++SSPF+ISI+++GT++LPDIFNAVVL+TI+SA NSNVY+GSR+L+SL+   +
Sbjct: 320 LDKHTSVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGI 379

Query: 393 APRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISF 452
           AP+  S VT  GVPY  V+ T++ G LAFL V   + + FNWL+NI+ +AG  AWL IS 
Sbjct: 380 APKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISI 439

Query: 453 SHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVA 512
           SHIRFMQ +++RGISRDDLP+K+++MP+ AYYA+F++A+I+ +QGF AF P F+  +F  
Sbjct: 440 SHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFT 499

Query: 513 AYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVW 569
            YIS+ L   ++   Q++++CR   +L            + L+W E E  T W + W
Sbjct: 500 GYISLILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDALIWEEEEPTTLWGKFW 556

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/532 (57%), Positives = 393/532 (73%), Gaps = 1/532 (0%)

Query: 42  ITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGP 101
           +    ++ D A  E         EVKR LK RH                    PL+ +GP
Sbjct: 49  VQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGP 108

Query: 102 VGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161
           VG+LI+Y+FMG+V+Y VTQSLGEM TFIPVTSS +VF++RFLSPA G  NGYMYW +W  
Sbjct: 109 VGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAI 168

Query: 162 TFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221
           T+A+ELSVLG++I YWT+AVPLAAWI IFW LLT+ N FPVK+YGEFEFC+ASIKVIA++
Sbjct: 169 TYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIV 228

Query: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281
           G+++++  +VCG G S GPIGFRYWRNPG WG G I+ + N+ RFLGWV SL+NA+FTYQ
Sbjct: 229 GYLLYALIIVCG-GSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQ 287

Query: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVS 341
           GTELVGITAGEA+NPRK +P+AI KV  RILVFYI SLFF+GLLVPYN P+L+S+   ++
Sbjct: 288 GTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIA 347

Query: 342 SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT 401
           SSPF+ISI+N+GTKVLPDIFNAVVL+TILSAGNSNVY+GSRVLYSL+ +  AP+  S VT
Sbjct: 348 SSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVT 407

Query: 402 RGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAI 461
           + GVPY  V+ T++ G LAFL  +  +  AFNWL+NI+ +AG  AW  IS +HIRFMQ +
Sbjct: 408 KQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCL 467

Query: 462 RKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFL 521
           + RGISRD LP+KA++MP+ AYYA+FF+ LIV IQGFTAFAP F   +F  AYIS+ L +
Sbjct: 468 KLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLV 527

Query: 522 AIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
            +++  Q++++CR L K+            + ++W + E K  W++ W  L+
Sbjct: 528 VLFILCQLYYRCRFLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEKFWVALA 579

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/535 (55%), Positives = 387/535 (72%), Gaps = 4/535 (0%)

Query: 41  AITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAG 100
           AI  E    + +  E+      + +VKR+LK RH                    P+ +AG
Sbjct: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAG 83

Query: 101 PVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 160
           PVG+L++Y+F+ T+ Y VTQSLGEM TFIPVTSSF+VFA RF+SPALGA NGY+YWLSWC
Sbjct: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143

Query: 161 FTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIAL 220
            TFALE+SV+G++I YW++AVP+ AW+ IFW LLT++N+ PVK+YGEFEF IAS+KVIA+
Sbjct: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203

Query: 221 LGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY 280
           L F+ +   VVCG G   G IGFRYW++PG WG GI+S + +  +FLGWVSSLI AAFT+
Sbjct: 204 LCFLFYGLVVVCG-GSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262

Query: 281 QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDG--I 338
           QGTELVG+TAGE  NPR+ +P+AI  V  RIL+FYI SL  IGLLV Y+DP+L  DG   
Sbjct: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322

Query: 339 FVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLS 398
             ++SPF+++I  +GTKVLPDI N V+++TI+SAGNSN+Y+GSRVLY L ++ LAP F+S
Sbjct: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382

Query: 399 NVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFM 458
             T  GVPY +VL+TS+FG L +L VS+ SG  F+WLL+IT V+GFF WLLIS SHIRFM
Sbjct: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442

Query: 459 QAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIF 518
           Q ++KRGISRDDLP+KA+ MP+ AYYA+FF+ +I+L+QGFTAF P F  +DFVA YIS F
Sbjct: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAF 501

Query: 519 LFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           +F+ IWL FQ  FK R    +            + ++W + +  T W ++W  LS
Sbjct: 502 IFVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAIIWDDDKPTTLWGKIWYHLS 556

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/522 (54%), Positives = 373/522 (71%), Gaps = 3/522 (0%)

Query: 54  KETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGT 113
             TE    +  EVKR LK RH                    PL  AGPVG+L++Y+F+GT
Sbjct: 43  DHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGT 102

Query: 114 VIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKV 173
           V+YS+TQSLGEM TFIPVTSS +VF++RFLSPA G  NGYMYW +W  TFA+ELSV+G++
Sbjct: 103 VVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQI 162

Query: 174 IQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCG 233
           IQYWT+ VP+AAWIVIFW L+T +N FPV++YGE EF IAS+KV+ ++G++I++F +VCG
Sbjct: 163 IQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCG 222

Query: 234 AGQSDGPIGFRYWRNPGAWGPGIIS-SDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292
            G   GPIG        A G    S + +    FLGWVSSLI AAFTYQGTELVGITAGE
Sbjct: 223 -GSKQGPIGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGE 281

Query: 293 AANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDG-IFVSSSPFMISIEN 351
           + NPRK +P+AI KV  RIL FYI SL F+GLLVPY+DP+L+S+    V++SPF+ISI+N
Sbjct: 282 STNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKN 341

Query: 352 SGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVL 411
           +GTK+LPDIFNAVVLIT++SA NSNVYIGSRV YSL+    AP+ L+ VT+ GVPYF VL
Sbjct: 342 AGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVL 401

Query: 412 STSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDL 471
            TS+ G ++FL ++  +  AF+WL+NI+ +AG  AWL IS +HIRFMQ ++ RGISRDDL
Sbjct: 402 ITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDL 461

Query: 472 PYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWF 531
           P+KA+ MP+ AYYA+FF+ +I+ IQG+TAF P F    F  +YIS+FL L +++  Q+++
Sbjct: 462 PFKAKFMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYY 521

Query: 532 KCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVWDVLS 573
           KCR LW +            + +VW E E K  W + W  ++
Sbjct: 522 KCRFLWAVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/540 (53%), Positives = 373/540 (69%), Gaps = 2/540 (0%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           D ++  E        +   E D +           +VKR LK RH               
Sbjct: 66  DFRHGDEEDDILAYDDDDGECDESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLF 125

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                PL+ +GPVG+LI+Y+FMG+V+Y VTQSLGEM TFIPVTSS +VF +RFLSPALG 
Sbjct: 126 VGISEPLSRSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFTKRFLSPALGV 185

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
           +NGYMYW +W  TFA ELSV G++IQYWT  VPLAAWI IFW ++  +N FPVK YGE E
Sbjct: 186 SNGYMYWFNWAITFATELSVTGQIIQYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIE 245

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F ++S+KV+A++G++I++  +VCG G   GPIGFRYWR+  A+G G IS +K+E RFLGW
Sbjct: 246 FWVSSVKVLAIVGYLIYALVIVCG-GSRQGPIGFRYWRHGYAFGDGYISKNKDEARFLGW 304

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
           VSSLINAAFTYQGTELVGI+AGEAANPRK +PRAI KV+ RI +FYILSLFFIGLLVPYN
Sbjct: 305 VSSLINAAFTYQGTELVGISAGEAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYN 364

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           D +L      ++SSPF+IS+ N+GT  LPDIFNAV+LIT+LSA NS+VYI SRVLY+L+ 
Sbjct: 365 DKRLSDGSAIIASSPFVISMLNAGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAG 424

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
              AP+  + V R GVPY  V  T + G+LAFL VS  +  AFNWL+NI+ +AG  AW  
Sbjct: 425 QGNAPKQFTYVNRYGVPYLGVFVTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFF 484

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPID 509
           I F+HIRFMQA++ +GISRDDLP+KA+ MP+ AYYA+FF+ LI+ IQG+ AF P +    
Sbjct: 485 ICFAHIRFMQALKHKGISRDDLPFKARFMPWGAYYAAFFVGLIIFIQGYDAFTP-WDTKS 543

Query: 510 FVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTRWQRVW 569
           F  +YIS+ LF  ++L   ++++ RLL K+            E  VW E   +  W++ W
Sbjct: 544 FFTSYISLILFGVLYLGCLIYYRGRLLIKIEDIDIDTDRKEVEAYVWEEDAPRNWWEKFW 603

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  343 bits (879), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 182/506 (35%), Positives = 290/506 (57%), Gaps = 8/506 (1%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
           +N T ++ +  + EDD+ K ++      R +K++LK RH                     
Sbjct: 22  KNTTSSLNSFEQ-EDDSNKISDGKEDGVR-LKKELKARHISMIAIGGSLGTGLLIGTGTA 79

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMY 155
           L   GP   LI+Y F+G +++ V   LGEM T+IP+   F+ +A R+  PALG   GY Y
Sbjct: 80  LRTGGPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCY 138

Query: 156 WLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
              +      +L+    VIQYW   E V    WI IF  ++  +N   V+Y+GEFEF ++
Sbjct: 139 LFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLS 198

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
           S K++ + G I+F F ++ G G +   +GFRYW+NPGA+ P   S   ++G+F+ +V+  
Sbjct: 199 SFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVF 258

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           + A F Y G EL GI A EA NPR+ +PRAIK  + RI++FYI+++F +G+ V YNDP+L
Sbjct: 259 VYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL 318

Query: 334 ---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKN 390
                     ++SPF+++I+NSG + LP IFN  VLI + SA NS++Y+G+R LYSL+ +
Sbjct: 319 LAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAID 378

Query: 391 SLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLI 450
             AP+  +   R GVPY ++    +F  LA++ VS+GS + FN+ +N+  + G  +W+ I
Sbjct: 379 GKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISI 438

Query: 451 SFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDF 510
             ++I F +A   + + R+   Y+A   P+ AY   FF  LI  I+ FT F   F    F
Sbjct: 439 LITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSF 498

Query: 511 VAAYISIFLFLAIWLSFQVWFKCRLL 536
           +  YI + L++  +  +++ +K +L+
Sbjct: 499 ITGYIGLPLYVIFYFGYKIIYKTKLV 524

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  342 bits (878), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 180/504 (35%), Positives = 292/504 (57%), Gaps = 10/504 (1%)

Query: 43  TTERKVEDDAAKET--ESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAG 100
           T   ++ED   ++   +    E   +++ LK RH                     L  AG
Sbjct: 61  TVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAG 120

Query: 101 PVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 160
           P+   I+Y F+G +++    +LGEM ++IP+   F+ +A R+  PALG   GY Y   + 
Sbjct: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYL 179

Query: 161 FTFALELSVLGKVIQYW--TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVI 218
                +L+    VIQYW   E V    WI IF  ++ +MN   VK++GEFEF +++ KVI
Sbjct: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239

Query: 219 ALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 278
            ++G II  F ++ G G +   +GFR++ +PGA+ P   S D ++G+F+ +V+ L+ A F
Sbjct: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALF 299

Query: 279 TYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDP---KLDS 335
            Y G EL GI A EAANPRK++P+AIK  + RI+VFY++++F +G+ V Y+DP   K  +
Sbjct: 300 AYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKT 359

Query: 336 DGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPR 395
            G   ++SP++++I NSG K LP IFNA VL+ + SA NS++Y+ SR LY L+ ++ AP+
Sbjct: 360 SGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419

Query: 396 FLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 455
             +   R GVPY+S+L +S F  LA++ VS+GS K FN+ +N+  + G  +W+ I  +++
Sbjct: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479

Query: 456 RFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAY 514
            F +A++ + + R    Y+A   P+ +Y+   F  LI  I+ FT F    F   +F+  Y
Sbjct: 480 CFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGY 539

Query: 515 ISIFLFLAIWLSFQVWFKCRLLWK 538
           I I +F+  +  ++   K + +WK
Sbjct: 540 IGIPVFVISYFGYKFVKKTK-IWK 562

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/521 (35%), Positives = 299/521 (57%), Gaps = 21/521 (4%)

Query: 28  FVDEQYSGE---NVTKAITTERKVED-DAAKETESSPQERR----------EVKRKLKQR 73
           F+ + Y  +    V+ + TT + VE+ D + + + S QE             +K++L+ R
Sbjct: 3   FIQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEAR 62

Query: 74  HXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTS 133
           H                     L+ AGPV  LI+Y F+G ++Y V   LGEM T+IP+  
Sbjct: 63  HVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-D 121

Query: 134 SFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIFW 191
            F+ +A R+  PALG   GY Y   +      +L+    V+QYW   E V    WI IF 
Sbjct: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181

Query: 192 CLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGA 251
            ++ ++N+  VK++GEFEF ++S KV+ +L  I+  F ++ G G S   +GFR++++PGA
Sbjct: 182 VIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241

Query: 252 WGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRI 311
           + P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ +PRAIK  + RI
Sbjct: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301

Query: 312 LVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLIT 368
           +VFY++++F +G+ V YNDP L          ++SPF+++I+N+G  VLP IFNA VL+ 
Sbjct: 302 VVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMF 361

Query: 369 ILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGS 428
           + SA NS++Y+ SR LY L+ ++ AP+  +   + GVPY S++   +F  LA++ VS+GS
Sbjct: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421

Query: 429 GKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFF 488
            + FN+ +N+  + G  +W+ I  ++I F +A+R +G+ +  L Y A +    AY+A FF
Sbjct: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481

Query: 489 IALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQ 528
             LI LI+ FT F    F   +F+  YI I +F+  +  ++
Sbjct: 482 CCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK 522

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/490 (35%), Positives = 283/490 (57%), Gaps = 4/490 (0%)

Query: 49  EDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISY 108
            D  A E      E   +K++LK RH                     L  AGPV  LI+Y
Sbjct: 48  SDVLASEIGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAY 107

Query: 109 LFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELS 168
            F+G +++     LGEM TFIP+   F+ +A R+  PALG   GY Y + +      +L+
Sbjct: 108 TFVGIMVFFTMACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLT 166

Query: 169 VLGKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIF 226
               V+QYW   + V    W+ + + ++T +N+F V+++GEFEF ++S+KV+ ++G II 
Sbjct: 167 AAAMVMQYWVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIIL 226

Query: 227 SFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELV 286
            F ++ G   S   +GFRYW++PGA+         + G+F+ +V+ L+   F Y G EL 
Sbjct: 227 LFVIMLGGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELT 286

Query: 287 GITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPF 345
           GI A EA+NPR+++P+AIK    RILVFY++S+F +G+ VPYND KL  ++   +++SPF
Sbjct: 287 GIVAAEASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPF 346

Query: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGV 405
            I+I N+G  VLPDIFN  +LI + SA NS++Y+ SR LYSL+ ++ AP+  ++  R G+
Sbjct: 347 SIAILNAGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGI 406

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           PY S+  + +F  LA++ VS+ S + F + +N+  +AG   W+ I  ++I F +A+R + 
Sbjct: 407 PYNSLFVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQH 466

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWL 525
           + +    Y A   P+ AY + FF  LI +I+ FT F   F    F+  YI + +F+  + 
Sbjct: 467 VDKSTFAYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYF 526

Query: 526 SFQVWFKCRL 535
            +++  K  +
Sbjct: 527 GYKITCKSEI 536

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  327 bits (837), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 172/483 (35%), Positives = 282/483 (58%), Gaps = 7/483 (1%)

Query: 60  PQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVT 119
           P+    +K+ L+ RH                     L+ AGP    I+Y F+G +++   
Sbjct: 93  PKHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTM 152

Query: 120 QSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTE 179
            ++GEM ++IP+   F+ +A R++ PALG   GY Y   +      +L+    VIQYW +
Sbjct: 153 AAIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211

Query: 180 --AVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQS 237
              V    WI IF  ++  +N+  VK++GEFEF ++S KV+ +LG I+  F ++ G G  
Sbjct: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPD 271

Query: 238 DGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297
              +GFRYW++PGA+ P   + D + G+F+ +VS  + A F Y G EL GI A EA NPR
Sbjct: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331

Query: 298 KALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGT 354
           K++PRA+K  V RI++FY++++F +G+ V YNDP+L      G   ++SPF+++I+NSG 
Sbjct: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGI 391

Query: 355 KVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTS 414
           +VLP IFNA VLI + SA NS++Y+GSR LYSL+ +  AP      T  G+P++S+    
Sbjct: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451

Query: 415 VFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYK 474
           +F  LA++ VS+GS + FN+ +N+  + G  +W+ I  ++I FM+A++ +G+ R    Y 
Sbjct: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511

Query: 475 AQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKC 533
           A   P+  Y++  +   I  I+ FT F   +F   +F+  YI + +F+  +  ++   K 
Sbjct: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571

Query: 534 RLL 536
           +++
Sbjct: 572 KIV 574

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/486 (35%), Positives = 278/486 (57%), Gaps = 10/486 (2%)

Query: 58  SSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYS 117
               +   +K+ LK RH                     L  AGP   LI+Y F+GT+++ 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 118 VTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW 177
              +LGEM  +IP+   F+ +A R+  PALG   GY Y   +      +L+    VIQYW
Sbjct: 134 TMAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYW 192

Query: 178 TE--AVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAG 235
            +   V    WI IF  ++ ++N   VKY+GEFEF ++S K++ ++G +IF F ++ G G
Sbjct: 193 VDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGG 252

Query: 236 QSDGPIGFRYWRNPGAWGP---GIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292
            +   +GFRYW+ PGA+ P    +++ + + G+F+ +V+  + A F Y G EL GI A E
Sbjct: 253 PNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAE 312

Query: 293 AANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISI 349
           A NPR+ +PRAIK  V RIL FY+ ++F +G+ V Y+DP L    +     ++SPF+++I
Sbjct: 313 AENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAI 372

Query: 350 ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFS 409
           +NSG  VLP IFN  VL+ + SA NS++Y+G+R LYSL+ +  AP+  +   R GVPY +
Sbjct: 373 QNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNA 432

Query: 410 VLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRD 469
           +    +F  LA++ VS+GS + FN+ +N+  + G  +W  I  + I F +A+R +GI R 
Sbjct: 433 MGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRS 492

Query: 470 DLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQ 528
              Y A   P+ +Y+A FF  L+ LI+ F+ F    F    F+  YI + ++   ++ ++
Sbjct: 493 TFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYK 552

Query: 529 VWFKCR 534
           +++K +
Sbjct: 553 LYYKTK 558

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/511 (36%), Positives = 294/511 (57%), Gaps = 8/511 (1%)

Query: 33  YSGENVTKAITT-ERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXX 91
           YS E + + I T E + +  +  E      E   +K++L+ RH                 
Sbjct: 16  YSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIG 75

Query: 92  XXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATN 151
               LA AGPV  LISY F+G ++Y+V   LGEM  FIP+   F+ +A R++ PA+G   
Sbjct: 76  TGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAV 134

Query: 152 GYMYWLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
           GY Y   +      +L+    V+Q+W   + V    WI IF  L+  +N   V+++GEFE
Sbjct: 135 GYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFE 194

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F ++S+KV+ +LG I+  F ++ G G +    GFR+WR+PGA+ P   +   ++G+F+ +
Sbjct: 195 FWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSF 254

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
            S    A F Y GTEL GI A EA NPR+++PRAIK  + RI+VFY++++  +G+ V YN
Sbjct: 255 ASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYN 314

Query: 330 DPKLDSDGIFVSS---SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYS 386
           DP+L       +S   SPF+++IEN+   VLP IFN  VL+ + SA NS++Y+ SR LY 
Sbjct: 315 DPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYG 374

Query: 387 LSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFA 446
           L+ +  APR  +   + GVPY+S+  + +F  LA++ VS+GS + FN+ +N+  + G  +
Sbjct: 375 LAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLS 434

Query: 447 WLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTF 505
           W+ I  ++IRF +AIR +   +  L Y A   P+  Y A FF  LI LI+ +T F    F
Sbjct: 435 WITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKF 494

Query: 506 QPIDFVAAYISIFLFLAIWLSFQVWFKCRLL 536
               F++ YI I ++L  ++ ++V ++ +L+
Sbjct: 495 DYKTFISGYIGIPVYLICYVGYKVVYRTKLI 525

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/507 (35%), Positives = 289/507 (57%), Gaps = 7/507 (1%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
           +++   I+     ED           E   +K+ L+ R                      
Sbjct: 41  DDLENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNS 100

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMY 155
           LA AGPV  LI+Y F+G +++    SLGEM ++IP+   F+ +A R+  PALG   GY Y
Sbjct: 101 LATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCY 159

Query: 156 WLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
              +      +L+    VIQYW   E V    WI IF  ++ ++N   V+++GEFEF ++
Sbjct: 160 LFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLS 219

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
           S KV+ +   II  F ++ G G +   +GFR+W++PGA+     +   + G+F+ +VS  
Sbjct: 220 SFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVF 279

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           + A F Y GTELVGI  GEA NPRK++P+AIK  + RI++FY++S+  +G+ V Y+DP L
Sbjct: 280 VYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLL 339

Query: 334 ---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKN 390
               +     ++SPF+++I NSG KVLP IFNA VL+ + SA NS++Y+ SR LYSL+ +
Sbjct: 340 LEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAID 399

Query: 391 SLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLI 450
           + AP+  +   R G+PY+S+  + +F  LA++ VS+GS K FN+ +N+  + G  +W+ I
Sbjct: 400 NKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICI 459

Query: 451 SFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPID 509
             +++ F +A+R +GI +    Y A    + AY+A FF +LI LI+ FT F    F    
Sbjct: 460 LVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKT 519

Query: 510 FVAAYISIFLFLAIWLSFQVWFKCRLL 536
           F+  YI I +F   +  +++ +K +++
Sbjct: 520 FITGYIGIPVFFISYFGYKLIYKTKII 546

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  324 bits (831), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/499 (35%), Positives = 282/499 (56%), Gaps = 17/499 (3%)

Query: 45  ERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGA 104
           +R + DD          E   +K+ LK RH                     LA AGP   
Sbjct: 50  DRDIFDDG-------KTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSL 102

Query: 105 LISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFA 164
            I+Y F+G +++     LGEM  FIP+   F+ +A R++ PALG   GY Y   +    A
Sbjct: 103 FITYSFVGVLVFFTMSCLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPA 161

Query: 165 LELSVLGKVIQYWTEAVPL--AAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLG 222
            +L+    V+QYW +   L    +I IF  L+ ++N+F VK +GEFEF ++S KV+ +LG
Sbjct: 162 NQLTAGAMVVQYWVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLG 221

Query: 223 FIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGP---GIISSDKNEGRFLGWVSSLINAAFT 279
            I+  F ++ G G +   +GFRYWR+PG++ P    IIS   + G+F+ + S  + A F 
Sbjct: 222 LILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFC 281

Query: 280 YQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDP---KLDSD 336
           Y G EL GI A EA NPRK +P+AIK  + RI++FY++++  + + V YNDP   K    
Sbjct: 282 YLGIELTGIVAAEAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQ 341

Query: 337 GIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRF 396
               ++SPF+++IENSG  +LP IFN  VL  +LSA NS++Y+ SR LYSL+ ++ AP+F
Sbjct: 342 STSAAASPFVVAIENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKF 401

Query: 397 LSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIR 456
                + G+PY+S+  ++ F  LA++ VS+ +   FN+ +N   + G  +W+ I  ++I 
Sbjct: 402 FGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIH 461

Query: 457 FMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYI 515
           F +A + +G+ + +  Y A   P+ AY+A FF  ++ L++ FT F    F   +F+  YI
Sbjct: 462 FDKACKAQGMDKSNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYI 521

Query: 516 SIFLFLAIWLSFQVWFKCR 534
            I +F   ++ +++ +K +
Sbjct: 522 GIPVFFICFVGYKIVYKTK 540

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/515 (35%), Positives = 292/515 (56%), Gaps = 12/515 (2%)

Query: 33  YSGENVTK--AITTER--KVEDDAAKETE-SSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           Y G++ +K   IT+     V++     +E     +   +K+ L+ RH             
Sbjct: 41  YDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGTG 100

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPAL 147
                   LA AGP   LI+Y F+G +++ V   LGEM  +IP+   F+ ++ R+  PAL
Sbjct: 101 LLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPAL 159

Query: 148 GATNGYMYWLSWCFTFALELSVLGKVIQYWTE--AVPLAAWIVIFWCLLTSMNMFPVKYY 205
           G   GY Y   +      +L+    VIQYW +   V    WI I    + ++N   V+++
Sbjct: 160 GFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFF 219

Query: 206 GEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGR 265
           GE E+ I+++K+  +LG II    + CG G +   +GF+YW+NPGA+     +    +GR
Sbjct: 220 GEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGR 279

Query: 266 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLL 325
           F+ + S  + A F Y GTEL GI   E  NPRKA+P+AIK  + RI+VFY++S+F +G+ 
Sbjct: 280 FVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMC 339

Query: 326 VPYNDPKL---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSR 382
           VP+NDP L    S     S+SPF+++I N+G  VLP I NA +LI + SA NS++Y+ SR
Sbjct: 340 VPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASR 399

Query: 383 VLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVA 442
            LY L+ ++ APR  +   + GVPY+S+L   +F  LA++ VS+GS + F + +N   + 
Sbjct: 400 SLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIF 459

Query: 443 GFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF- 501
           G  +W+ I  ++IRF +A R +GI +  L Y++ + P+ A+++ FF  LI LI+ F AF 
Sbjct: 460 GLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL 519

Query: 502 APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLL 536
             TF    F+  YI I  ++  ++ +++W+K +++
Sbjct: 520 GDTFDYKSFITGYIGIPTYIISYIGYKLWYKTKII 554

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/507 (35%), Positives = 283/507 (55%), Gaps = 17/507 (3%)

Query: 45  ERKVEDDAAKETESSPQERRE---VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGP 101
           E   E  +A  T  S  ++RE   +K+ L+ RH                     L+  GP
Sbjct: 25  ELDTESLSALNTGGSESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGP 84

Query: 102 VGALISYLFMGTVIYSVTQSLGEMVTFIPVTS-----SFSVFAQRFLSPALGATNGYMYW 156
            G L SY+ +  VIY V  +LGEMV ++P +      S S    R+  P+LG   G+ Y+
Sbjct: 85  AGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYY 144

Query: 157 LSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIK 216
             +    A E +    V+ YWT  VP AAWI IF  ++T +N  PVK+YGE EF  A +K
Sbjct: 145 YCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILK 204

Query: 217 VIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINA 276
           ++ ++G +  SF +  G G S   +GFRYW+ PGA+   I +   N GRFL   + +I  
Sbjct: 205 ILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHITTG--NTGRFLDVWTGVIKG 262

Query: 277 AFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDP---- 331
            F +  G ELV +T+ EA + R+ + +A ++   R++ FY+ S   IG++V  NDP    
Sbjct: 263 GFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRD 322

Query: 332 KLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNS 391
            L S     +SSPF+I+I+N+  K+LP I NA +L +  S+GNS ++  SR L S++++ 
Sbjct: 323 ALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDG 382

Query: 392 LAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLIS 451
           +AP+    + R GVPY +V  ++ F  LA+L VS+GS KAF W  NI+ ++GF  W+ I 
Sbjct: 383 VAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIG 442

Query: 452 FSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTF-QPIDF 510
            +++RF +AI  RG+  D +P+K+   P+  Y+    +++I L  G+  F P F +  DF
Sbjct: 443 VAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADF 501

Query: 511 VAAYISIFLFLAIWLSFQVWFKCRLLW 537
           VAAYI++ +F+ +W+  +++ +    W
Sbjct: 502 VAAYITLPVFVVLWVGHKIYTRTLSTW 528

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/492 (35%), Positives = 286/492 (58%), Gaps = 7/492 (1%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D +        E   +++ LK RH                     L   GPV  LI+Y F
Sbjct: 65  DDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGF 124

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
           +G +++     LGEM ++IP+   F+ +A R++ PALG   GY Y   +      +L+  
Sbjct: 125 VGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAA 183

Query: 171 GKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
             VIQYW   + V    WI IF  ++ ++N+  V+++GEFEF ++S KV+ +LG I+  F
Sbjct: 184 ALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLF 243

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            ++ G G     +GFRYWR+PGA+     +   ++G+F+ + S  + + F+Y G EL GI
Sbjct: 244 IIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGI 303

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS---DGIFVSSSPF 345
              EA NPRK++P+AIK  V RI+VFY+ ++F +G+ V YNDP+L S     +  ++SPF
Sbjct: 304 VCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPF 363

Query: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGV 405
           +++I+NSG KVLP IFN  VL+ + SA NS++Y+ SR LY+L+ +  AP+  +  ++ GV
Sbjct: 364 VVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGV 423

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           PY++++ + +F  LA++ VSAGS K FN+ +N+  + G  +W+ I   +I F +A R +G
Sbjct: 424 PYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQG 483

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIW 524
           + +    Y A    + AY+A FF  LI LI+ FT F   TF    F+  YI + +++  W
Sbjct: 484 VDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSW 543

Query: 525 LSFQVWFKCRLL 536
           + +++ +K +++
Sbjct: 544 VGYKLIYKTKVV 555

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/513 (34%), Positives = 296/513 (57%), Gaps = 8/513 (1%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           +E+   +++ + I++    +++ +   +   +  R +K+ LK RH               
Sbjct: 33  EEELINDDLERNISSASSQDENDSYNIDGKTEGTR-LKKALKARHVSMIAIGGSLGTGLL 91

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 LA AGPV  LI+Y F+G +++     LGEM T+IP+   F+ +A R+  PALG 
Sbjct: 92  IGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGF 150

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGE 207
             GY Y   +      +L+    VIQYW   E V    W+ IF  ++ S+N+F V+++GE
Sbjct: 151 AVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGE 210

Query: 208 FEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFL 267
           FEF ++S KV+ +LG ++  F ++ G G     +GFRYWR+PG++     +   + GRF+
Sbjct: 211 FEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFV 270

Query: 268 GWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVP 327
            +VS  + A + Y G EL GI A EA NPRK++P+AIK  + RI++FY++S+F +G+ V 
Sbjct: 271 AFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVA 330

Query: 328 YNDP---KLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVL 384
           Y+DP   K  +     ++SPF+++I NSG   LP I NA VL+ + SA NS++Y+ SR L
Sbjct: 331 YDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSL 390

Query: 385 YSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGF 444
           YSL+ ++ AP+  +   R G+PY+++  + +F  LA++ VS+ S K FN+ +N+  + G 
Sbjct: 391 YSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGI 450

Query: 445 FAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-AP 503
            +W+ I  ++I F +A+R +G+ +    Y A   P+ A+++ FF  LI LI+ FT F   
Sbjct: 451 LSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNH 510

Query: 504 TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLL 536
            F   +F+  YI + +F   +  ++  +K +++
Sbjct: 511 QFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVI 543

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  315 bits (808), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/492 (35%), Positives = 285/492 (57%), Gaps = 7/492 (1%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D +        E   +++ LK RH                     L   GPV  LI+Y F
Sbjct: 67  DDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAF 126

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
           +G +++     LGEM ++IP+   F+ +A R++ PALG   GY Y   +      +L+  
Sbjct: 127 VGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAA 185

Query: 171 GKVIQYW--TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
             VIQYW   + V    WI IF  ++ ++N+  VK++GEFEF ++S KV+ +LG I+  F
Sbjct: 186 ALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLF 245

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            ++ G G +   +GFRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI
Sbjct: 246 IIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGI 305

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS---DGIFVSSSPF 345
              EA NPRK++P+AIK  V RI+VFY+ ++F +G+ V YNDP+L S     +  ++SPF
Sbjct: 306 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPF 365

Query: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGV 405
           +++I+NSG +VLP IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+  +  +R GV
Sbjct: 366 VVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGV 425

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           PY +++ + +F  LA++ VS+GS K FN+ +N+  + G  +W+ I   +I F +A R +G
Sbjct: 426 PYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 485

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIW 524
           I +    Y A    + AY+A FF  LI LI+ FT F    F    F+  YI + +++  W
Sbjct: 486 IDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISW 545

Query: 525 LSFQVWFKCRLL 536
             +++ +K +++
Sbjct: 546 AGYKLIYKTKVI 557

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  313 bits (803), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 176/492 (35%), Positives = 283/492 (57%), Gaps = 7/492 (1%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D +        E   +K++LK RH                     L   GPV  LI+Y F
Sbjct: 65  DDSFAIADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAF 124

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
           +G +++     LGEM ++IP+   F+ +A R++ PALG   GY Y   +      +L+  
Sbjct: 125 VGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAA 183

Query: 171 GKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
             VIQYW   + V    WI IF  ++ ++N+  VK++GEFEF ++S KV+ +LG I+  F
Sbjct: 184 ALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLF 243

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            ++ G G     +GFRYWR+PGA+     +   + G+F  +V+  + + F+Y G EL GI
Sbjct: 244 IIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGI 303

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS---DGIFVSSSPF 345
              EA NPRK++P+AIK  V RI+VFY+ ++F +G+ V YNDP+L S     +  ++SPF
Sbjct: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPF 363

Query: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGV 405
           +++I+NSG KVLP IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+  +  ++ GV
Sbjct: 364 VVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGV 423

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           PY +++ + +F  LA++ VS+GS K FN+ +N+  + G  +W+ I   +I F +A R +G
Sbjct: 424 PYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 483

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIW 524
           I +    Y A    + AY+A  F  LI LI+ FT F    F    F+  YI + +++  W
Sbjct: 484 IDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSW 543

Query: 525 LSFQVWFKCRLL 536
             +++ +K +++
Sbjct: 544 AGYKLIYKTKVI 555

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  312 bits (800), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 286/499 (57%), Gaps = 8/499 (1%)

Query: 44  TERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVG 103
           T     DD+    +   +  R +++ LK RH                     L   GPV 
Sbjct: 60  TSPSARDDSFAVPDGKDETTR-LRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVA 118

Query: 104 ALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTF 163
            LI+Y F+G +++     LGEM ++IP+   F+ +A R++ PALG   GY Y   +    
Sbjct: 119 MLIAYAFVGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILP 177

Query: 164 ALELSVLGKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221
             +L+    VIQYW   + V    WI IF  ++ ++N+  VK++GEFEF ++S KV+ +L
Sbjct: 178 PNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVML 237

Query: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281
           G I+  F ++ G G     +GFRYWR+PGA+     +    +G+F+ +++  + + F+Y 
Sbjct: 238 GLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYT 297

Query: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS---DGI 338
           G EL GI   EA NPRK++P+AIK  V RI+VFY+ ++F +G+ V YNDP+L S     +
Sbjct: 298 GIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKAL 357

Query: 339 FVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLS 398
             ++SPF+++I+NSG KVLP IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+  S
Sbjct: 358 SAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFS 417

Query: 399 NVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFM 458
              + GVPY +++ + +F  LA++ VSAGS K FN+ +N+  + G  +W+ I   +I F 
Sbjct: 418 KTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFD 477

Query: 459 QAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISI 517
           +A R +GI +    Y A    + AY+A  F   I LI+ FT F    F    F+  YI +
Sbjct: 478 KACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGL 537

Query: 518 FLFLAIWLSFQVWFKCRLL 536
            +++  W+ +++ +K +++
Sbjct: 538 PVYVFSWVGYKLIYKTKVI 556

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  311 bits (797), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 188/564 (33%), Positives = 296/564 (52%), Gaps = 27/564 (4%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSP-QERREVKRKLKQRHXXXXXXXXXXXX 86
           FVD + S ++ + A  +E+  + D     ++ P      +++ LK RH            
Sbjct: 43  FVDVE-SQQSTSSATISEKLGDGDG----DADPFANEGSLQQGLKSRHIQMIALGGAIGT 97

Query: 87  XXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-----VTSSFSVFAQR 141
                    LA  GP G  ISY+ + +V+Y +    GEMV ++P      + S +    R
Sbjct: 98  GLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVAR 157

Query: 142 FLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP 201
           ++  +LG    + Y+  +    A E +    V++YWT AVP   WI+IF  ++  +N  P
Sbjct: 158 YVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVILNFGP 217

Query: 202 VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDK 261
           VKYYGE EF  ASIK++ ++G II SF +  G G +   +GFRYW+ PGA+   I+    
Sbjct: 218 VKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHIMKG-- 275

Query: 262 NEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLF 320
             GRFL   S +I   F +  G ELV +T+ E  + R+ + +A ++ + R++ FY+L   
Sbjct: 276 GFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTL 335

Query: 321 FIGLLVPYNDPKL----DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSN 376
            I ++V YNDP L     S      SSPF+I I+N+G +VLP I NA +L +  SAGN+ 
Sbjct: 336 AISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAF 395

Query: 377 VYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLL 436
           ++  +R L ++++N  APR    + R GVPY ++  +     LAFL VS+ +   FNW  
Sbjct: 396 MFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFS 455

Query: 437 NITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQ 496
           NI+ ++GF  W+    ++IRF +AI   G+  D LP+K    P+  YY+ F I+LI L  
Sbjct: 456 NISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTN 514

Query: 497 GFTAFAP-TFQPIDFVAAYISIFLFLAIWLSFQVW---FKCRLLWKLXXXXXXXXXXXXE 552
           G+  F P  ++  DFVAAYI++ +F+ +W+  ++W   F  R   ++            E
Sbjct: 515 GYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQIDVTTGLVDIE 574

Query: 553 ELVWIEPECK----TRWQRVWDVL 572
           E   I  E +    TRWQ+  D +
Sbjct: 575 ERTKILDETRVEPSTRWQKFMDAV 598

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  311 bits (798), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 169/486 (34%), Positives = 278/486 (57%), Gaps = 11/486 (2%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D    +++  +   ++K+ +K RH                     L + GP G +I Y  
Sbjct: 81  DKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAI 140

Query: 111 MGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
           MG+ +Y + Q+ GE+ V +  ++  F+ +    + PALG +  ++Y L W     LEL  
Sbjct: 141 MGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVT 200

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
               I+YWT +V    ++ IF+ ++ ++N+F  + Y E EF   + KV+ + GF+I    
Sbjct: 201 ASITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGII 260

Query: 230 VVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289
           V CG   +DG IG +YW +PG++     S DK    F G VS+L+ AAF +  TE + +T
Sbjct: 261 VNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALT 315

Query: 290 AGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMIS 348
           A E ANPRK++P A KK++ RILV Y+ S+  IG LVP+N  +L  S G    +SP++I+
Sbjct: 316 AAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIA 375

Query: 349 IENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYF 408
           I + G KV+P + NAV+L++++S GNS  Y  SR+L +L++   AP FL  V R G P  
Sbjct: 376 IASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTL 435

Query: 409 SVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISR 468
           +++ +SVFG ++F+  S      F WLL I+G++  F W  I  SHIRF +A++ +G S 
Sbjct: 436 AMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSL 495

Query: 469 DDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQ-PID---FVAAYISIFLFLAIW 524
            +L +K+Q+  + +YYA+  + LI++ Q +TA AP  +  +D   F   Y+++ + +A++
Sbjct: 496 GELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALY 555

Query: 525 LSFQVW 530
             ++VW
Sbjct: 556 FGYKVW 561

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  308 bits (788), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 185/499 (37%), Positives = 284/499 (56%), Gaps = 8/499 (1%)

Query: 43  TTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPV 102
           +TE    DD  ++ +    ++R +K+ LK RH                     LA AGPV
Sbjct: 40  STESVALDDTNEQFDGKCSDQR-LKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPV 98

Query: 103 GALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFT 162
             LISY F+G +++ V   +GEM  +IP+   F+ +A R+  PALG   GY Y + +   
Sbjct: 99  SMLISYSFVGVLVFFVMSCIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFIL 157

Query: 163 FALELSVLGKVIQYWT--EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIAL 220
              +L+    VIQYW   E V    WI I   ++  +N F VK++GEFEF ++S KVI +
Sbjct: 158 PPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVM 217

Query: 221 LGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY 280
           LG II  F ++ G   +   +GFRYW++PGA+     S   + GRF+ +VS  +   F Y
Sbjct: 218 LGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCY 277

Query: 281 QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDG 337
            G EL GI A EA NPRK +P+AIK  + RI++FYI+++F +G+ V  NDP L    +  
Sbjct: 278 LGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKS 337

Query: 338 IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL 397
              ++SPF+++I NSG + LP IFNA VL+ + SA NS++Y+ SR LYSL+ ++ AP+  
Sbjct: 338 TSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIF 397

Query: 398 SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457
           +   R G+PY S+    +F  LA++ VS+GS K FN+ +N+  + G   W+ I  ++I F
Sbjct: 398 AKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICF 457

Query: 458 MQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYIS 516
            +A+R +GI +    Y A + P+ AY++ FF  L+ LI+ FT F    F   +F+  YI 
Sbjct: 458 DRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIG 517

Query: 517 IFLFLAIWLSFQVWFKCRL 535
           + LF   +  ++   K ++
Sbjct: 518 LPLFFICYFGYKFVKKTKI 536

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  309 bits (791), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 174/484 (35%), Positives = 274/484 (56%), Gaps = 14/484 (2%)

Query: 66  VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM 125
           +K+ L+ RH                     L+  GP G L SY+ +  VIY V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 126 VTFIPVTS-----SFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA 180
           V F+P ++     S S    R+  P+LG   G+ Y+  +    A E +    V+ YWT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 181 VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP 240
           VP  AWI IF  ++T +N  PVK YGE EF  A +K++ ++G +  SF +  G G +   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 241 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKA 299
           +GFRYW++PGA+   I +   N GRFL   + +I   F +  G ELV IT+ EA + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTG--NTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 300 LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS----DGIFVSSSPFMISIENSGTK 355
           + +A ++   R++ FY+ S   IG++V   DP L +          SSPF+I+I+N+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSV 415
           VLP I NA +L +  S+GNS ++  SR L S++++  APR L  + R GVPY++V  ++ 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 416 FGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKA 475
           F  LAFL VS+GS KAF W  NI+ ++GF  W+ I  ++++F +A+  RG+  + +P+K+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 476 QMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRL 535
            + P+  Y+    ++LI L  G+ +F   +   DFVAAYI++ +F+ +W+  +++ +   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 536 LWKL 539
            W L
Sbjct: 581 TWLL 584

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/524 (34%), Positives = 288/524 (54%), Gaps = 19/524 (3%)

Query: 28  FVDEQYSGENV-TKAITTERKVEDDAAKET-ESSPQERREVKRKLKQRHXXXXXXXXXXX 85
           + ++ YS + + T + T    ++D+A KE  +       E+K+ LK RH           
Sbjct: 56  YNEKSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIG 115

Query: 86  XXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSV-----FAQ 140
                     LA+ GP G  ISYL + T +Y +  +LGEMV F+P   S S         
Sbjct: 116 TSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVH 175

Query: 141 RFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIFWCLLTSMN 198
           +++ P+LG    + Y+  +    A E+S    VI+YW   E VP  AWI IF  L+  +N
Sbjct: 176 KYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILN 235

Query: 199 MFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAG-QSDGPIGFRYWRNPGAWGPGII 257
             PV  YGE EF  ASIK++ + G II SF +  G G +SDG +GFRYW+NPG++   I 
Sbjct: 236 FLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHI- 294

Query: 258 SSDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYI 316
            +    G FL   + +I   F+   G ELV +T+ E A+ R+ + +A K+ V R++ FYI
Sbjct: 295 -TGGGGGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYI 353

Query: 317 LSLFFIGLLVPYNDPKLDS----DGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSA 372
           L    IG++V YNDP L +          SSPF+I I+N+G + +P I N  +L +  SA
Sbjct: 354 LGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSA 413

Query: 373 GNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAF 432
           GN+ ++  SR L ++++N  AP+    + + GVPY +V ++ +   LA+L VS+ +   F
Sbjct: 414 GNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVF 473

Query: 433 NWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALI 492
           NW  NI+ ++GF  W+    ++IRF +AI    ++   +P++A+   +  +Y+ F+++LI
Sbjct: 474 NWFSNISTISGFIGWICACVAYIRFRKAITYNKLTH-RIPFRAKGQQYTIWYSLFWVSLI 532

Query: 493 VLIQGFTAFAP-TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRL 535
            L  G+  F P  +   DF+AAYI++ +F+ +W+  +V+ +  L
Sbjct: 533 TLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRTLL 576

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  307 bits (786), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 177/506 (34%), Positives = 279/506 (55%), Gaps = 16/506 (3%)

Query: 40  KAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           +++T E+    D++ E E+  +   ++K+ L  RH                     L   
Sbjct: 34  ESLTREKITRSDSSSEVEA--EGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTV 91

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEMVTFIP-----VTSSFSVFAQRFLSPALGATNGYM 154
           GP G +ISY+ + TVIY +  +LGEMV ++P        S +    R++  +L    G+ 
Sbjct: 92  GPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWN 151

Query: 155 YWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIAS 214
           Y+  +    A E +    V+ YWT +VP A WI IF  ++T +N   VKY+GE EF  AS
Sbjct: 152 YYYCFVILVAAECTAASGVVTYWTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFAS 211

Query: 215 IKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 274
           IK++ +LG I+ SF +  G G S   +GF YW++PG +   I  +  + G FL   + +I
Sbjct: 212 IKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGTFAHHI--TGGSWGSFLDIYTGII 269

Query: 275 NAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDP-- 331
             AF +  G ELV +T+ E  + R+ + +A K+ + R++ FYIL    I ++V YNDP  
Sbjct: 270 KGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVL 329

Query: 332 --KLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
              L+      +SSPF+I I+N+G KVLP I NA +L +  SAGNS ++  SR L +++ 
Sbjct: 330 LNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAH 389

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
           N  AP+    V R GVPY+SV  +++   LAFL VS+ + + F+W  NI+ ++GF  W+ 
Sbjct: 390 NGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWIC 449

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTF-QPI 508
              +++RF +AI    +  D LP+K    P+L +Y+   I++I L  G+  F P F    
Sbjct: 450 AIIAYLRFRKAIFYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGS 508

Query: 509 DFVAAYISIFLFLAIWLSFQVWFKCR 534
           DFVAAYI++ LFL +W+  + W + +
Sbjct: 509 DFVAAYITLPLFLILWVGHKFWARYK 534

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  306 bits (785), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 174/482 (36%), Positives = 277/482 (57%), Gaps = 7/482 (1%)

Query: 61  QERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQ 120
            E   +K+ L+ RH                     LA AGP   LISY F+G ++Y+V  
Sbjct: 46  HEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMA 105

Query: 121 SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT-- 178
            LGEM  FIP+   F+ +A R++ PALG   GY Y   +      +L+    V+QYW   
Sbjct: 106 CLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164

Query: 179 EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD 238
           E V    WI IF  L+  +N   V+++GEFEF ++S+KV+ +LG I+  F ++ G G + 
Sbjct: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNH 224

Query: 239 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 298
              GFRYWR+PGA+ P   +   ++G+F+ + S    A F Y GTEL GI A EA NPR+
Sbjct: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRR 284

Query: 299 ALPRAIKKVVVRILVFYILSLFFIGLLVPYNDP---KLDSDGIFVSSSPFMISIENSGTK 355
           ++PRAIK  + RI++FY++S+  +G+ V YNDP   K        ++SPF+++I+N+G  
Sbjct: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIP 344

Query: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSV 415
           VLP IFNA VL+ + SA NS++Y+ SR LY L+ +  AP+  +     GVPY+S+  + +
Sbjct: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404

Query: 416 FGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKA 475
           F  LA++ VS+GS + FN+ +N+  + G  +W+ I  +++RF +A+  +   +    Y A
Sbjct: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464

Query: 476 QMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCR 534
              P+  + + FF  LI LI+ +T F   TF    F++ YI I ++   ++ +++  + +
Sbjct: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524

Query: 535 LL 536
           L+
Sbjct: 525 LI 526

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  307 bits (786), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 170/478 (35%), Positives = 269/478 (56%), Gaps = 14/478 (2%)

Query: 64  REVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLG 123
            E+K+ LK RH                     L   GP G  ISY  + +VIY + Q +G
Sbjct: 73  HELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIG 132

Query: 124 EMVTFIPVTSS----FSVF-AQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT 178
           EMV ++P + S    F+ +   +++  +LG  + + Y+  +    A E +    V++YWT
Sbjct: 133 EMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWT 192

Query: 179 EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD 238
            +VP AAWI IF   +  +N   VK+YGE EF  ASIK++ ++G II SF +  G G + 
Sbjct: 193 TSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNH 252

Query: 239 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPR 297
             +GFRYW+NPG +   I     + G FL   + +I   F +  G E++ +T+ E  + R
Sbjct: 253 DRLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQR 310

Query: 298 KALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS----DGIFVSSSPFMISIENSG 353
           + + +A ++ V R++ FYIL    I ++V YNDP L++    +     SSPF+I I+N+G
Sbjct: 311 RNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAG 370

Query: 354 TKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLST 413
            KVLP I NA +L +  SAGN+ ++  SR L ++++N  APR  + V R GVPY++V  +
Sbjct: 371 IKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLS 430

Query: 414 SVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPY 473
           S    LA+L  S+ +   FNW  NI+ ++GF  W+ +  ++IRF +AI   G+ +  LPY
Sbjct: 431 SAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPY 489

Query: 474 KAQMMPFLAYYASFFIALIVLIQGFTAFAPTF-QPIDFVAAYISIFLFLAIWLSFQVW 530
            A+ MP+L Y+    I++I L  G+  F P F    +FVAAYI++ +F  +W+  +V+
Sbjct: 490 TARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVY 547

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  307 bits (786), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 167/515 (32%), Positives = 291/515 (56%), Gaps = 21/515 (4%)

Query: 29  VDEQYSGEN--VTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXX 86
           +D++++ ++  + K +T       ++ +E  ++      +K+ LK RH            
Sbjct: 41  LDDRFNKKDSGLNKVLTVSSDTSTNSLEEDYTN-----TLKQGLKSRHVQLIALGGCIGT 95

Query: 87  XXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-----VTSSFSVFAQR 141
                    L   GP G  I+Y  + +VIY +  ++GEMV ++P        S +   +R
Sbjct: 96  GLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKR 155

Query: 142 FLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP 201
           ++  +L    G+ Y+  +    A E +    V++YWT AVP AAWI IF  ++  +NM  
Sbjct: 156 YVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSS 215

Query: 202 VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDK 261
           VKY+GE EF  ASIK++ ++G II SF +  G G S   +GFRYW+NPGA+   +  +D 
Sbjct: 216 VKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHV--TDG 273

Query: 262 NEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLF 320
           + G FL   S +I  AF +  G ELV +T+ E ++ R+ + +A K+ + R++ FYIL   
Sbjct: 274 SLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTL 333

Query: 321 FIGLLVPYNDP----KLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSN 376
            IG++V +NDP     L ++     SSPF+I I+N+G +VLP I NA +L +  S+GN+ 
Sbjct: 334 AIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAF 393

Query: 377 VYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLL 436
           ++  SR L+++++N  AP+    + + GVPY +V+ +++   LA+L  S+ + + F WL 
Sbjct: 394 MFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLS 453

Query: 437 NITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQ 496
           NI+ ++GF  W+    +++RF +AI    +  D +P+K    P+L  ++   +++I +  
Sbjct: 454 NISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIITITN 512

Query: 497 GFTAFAPTFQPI-DFVAAYISIFLFLAIWLSFQVW 530
           G+  F P F  + DF+AAYI++ +FLA+++  +V+
Sbjct: 513 GYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVY 547

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  306 bits (783), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 175/479 (36%), Positives = 268/479 (55%), Gaps = 13/479 (2%)

Query: 66  VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM 125
           +K  LK RH                     L  AGP   +I +   G++IYS+  ++ EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 126 VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLA 184
               P++  F+ +A RF+  + G  N + Y L W     LE+      + YW T      
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244
            ++ +FW ++  +N+F VK YGE EF  ++IKVI ++GFII    +VCG G + G +G +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304
           YW +PGA+      +     +F G+ S  + AAF++ G+EL+GI   EA NPRKA+P A 
Sbjct: 269 YWHDPGAFVGATAGA-----QFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNA 363
           K+V  RIL+FYILSL FIGLLVP ND +L  S  +  ++SPF+I+I   G + LP + N 
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINV 383

Query: 364 VVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLE 423
           V+LI +LS GNS +Y  SR L +L++    P+ +S + R G P   +  +S FG +AF+ 
Sbjct: 384 VILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVA 443

Query: 424 VSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAY 483
            S   G  FNWLL I+G++ FF W  I   HIRF  A++ +  S D+LP+ + +  F +Y
Sbjct: 444 QSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSY 503

Query: 484 YASFFIALIVLIQGFTAFAP---TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
           +  F I L++  Q + A  P   T    +F +AY+S+ + L ++++ ++W K    WK+
Sbjct: 504 WGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKN---WKI 559

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  305 bits (780), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 173/492 (35%), Positives = 265/492 (53%), Gaps = 18/492 (3%)

Query: 53  AKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMG 112
           A +T  SP     +K  LK RH                     L  AGP G LI +   G
Sbjct: 71  AIKTAQSP-----LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTG 125

Query: 113 TVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGK 172
           T+IYS+  ++GE+    PV   F+ +A RF+  + G    ++Y L W     LE+     
Sbjct: 126 TMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASI 185

Query: 173 VIQYW-TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVV 231
            + YW T+      ++ +F+ ++  +NMF VK YGE EF  + IKVI ++GFII +  ++
Sbjct: 186 TVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLI 245

Query: 232 CGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 291
           CG G+    IG +YW NPGA+       D    +F G+ +  + AAF++ G+ELVG+   
Sbjct: 246 CGGGKDHKYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGS 300

Query: 292 EAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIE 350
           EA  PRK++P A K+V  RI +FYIL L  IG+LVP + P+L  +  +  ++SPF+I+I 
Sbjct: 301 EAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIV 360

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
           N G K LP + N V+LI +LS GNS +Y  SR L +L+     P     + RGG P   +
Sbjct: 361 NHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGI 420

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
             ++ FG +AF+  S   G  FNWL+ ++G++  F W  I   HIR+  A+  +G S D+
Sbjct: 421 AISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDE 480

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTA-FAPTFQP--IDFVAAYISIFLFLAIWLSF 527
           LP++A    + +Y+  F   L+ + Q +   F P  +P   DF  AY+S  +F+A++   
Sbjct: 481 LPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFH 540

Query: 528 QVWFKCRLLWKL 539
           ++W   +  WKL
Sbjct: 541 KIW---KRNWKL 549

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  303 bits (775), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 271/478 (56%), Gaps = 9/478 (1%)

Query: 65  EVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124
            +K+ L+ RH                     L+ AGP+  LI+Y  MG V+++V   LGE
Sbjct: 57  RLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGE 116

Query: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTE--AVP 182
           M  +IP+   F+ +A R+  PALG   GY Y   +      +L+    V+QYW     V 
Sbjct: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175

Query: 183 LAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIG 242
              WI +F  ++ ++N+  VK++GEFEF ++S KV+ +L  +     +V G G S   +G
Sbjct: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNRLG 235

Query: 243 FRYWRNPGAWGP--GIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL 300
           FRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  NPR+ +
Sbjct: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295

Query: 301 PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGTKVL 357
           PRAIK  + RI+VFY+ ++F +GL V YNDP L          ++SP++++I+N+G  VL
Sbjct: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIPVL 355

Query: 358 PDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFG 417
           P IFNA VL  + SA NS++Y+GSR LY L+ +  AP+  +     GVPY S+   ++F 
Sbjct: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415

Query: 418 FLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQM 477
            LA++ VS+ +   F++ +N+T + G  +W+ I  ++I F +A R +GI ++ L Y+A  
Sbjct: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475

Query: 478 MPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCR 534
            P  A+ A  F  ++ L++ FT F   TF    F+  YI I +++  ++ +++  K +
Sbjct: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  302 bits (774), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 174/522 (33%), Positives = 276/522 (52%), Gaps = 15/522 (2%)

Query: 29  VDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXX 88
           V ++ +G+     I +  ++       +++ PQ    +K+ LK RH              
Sbjct: 15  VTDKQTGQVYEIDIESYSQISGPKVSSSDA-PQGDHTLKKGLKSRHIQLIALGGCIGTGL 73

Query: 89  XXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSV-----FAQRFL 143
                  L   GP G   SY  +  +IY V  +LGEMV ++P   S S         R++
Sbjct: 74  FVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSSSGGSISKLVTRYV 133

Query: 144 SPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVK 203
            P+LG   G+ Y+  +    A E +    V+QYWT AVP  AWI IF  ++  +N   VK
Sbjct: 134 DPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVPKGAWITIFLGVVVLLNFCAVK 193

Query: 204 YYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNE 263
           +YGE EF  AS+K++ +LG +  SF +  G G     +GFRYW+ PGA+   I S   N 
Sbjct: 194 FYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGAFAYHITSG--NT 251

Query: 264 GRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFI 322
           GRFL   + +I   F +  G ELV +T+ EA + R+ + +A ++ V R++ FY+ S   I
Sbjct: 252 GRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRFVYRLIFFYVSSSLAI 311

Query: 323 GLLVPYNDPKL----DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVY 378
           G +V YND  L    D       SSPF+I I+N+G KVLP I N  +L +  S+GNS ++
Sbjct: 312 GCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMF 371

Query: 379 IGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNI 438
             SR L S+S+   AP+ L  V R GVPY +V  TS+   +A+L VS+ +   F W  NI
Sbjct: 372 AASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSSTADVFTWFSNI 431

Query: 439 TGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGF 498
           + ++GF  W+ I  +++RF +AI  + +  + +P+K    P+  ++    +++I L  G+
Sbjct: 432 STISGFIGWICIGIAYLRFRKAIFFQNL-YERVPFKTPFQPYGTWFFIIAVSVICLTNGY 490

Query: 499 TAFAP-TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
             F P  +   DF+AAY+++ +FL +W+  ++W +    W +
Sbjct: 491 AIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAI 532

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  303 bits (777), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 172/512 (33%), Positives = 278/512 (54%), Gaps = 16/512 (3%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQERRE-VKRKLKQRHXXXXXXXXXXXXXXXXXXXP 94
           E     I + + V DDA  E      E  E +K+ ++ RH                    
Sbjct: 68  ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGT 127

Query: 95  PLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGY 153
            LAHAGP G +I Y  M + IY + Q++GEM V ++ +   F+ +    + PAL  +  +
Sbjct: 128 TLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAW 187

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP-VKYYGEFEFCI 212
           +Y + W     LEL      IQYWT  V    +++IF+ L+ ++N+F   + Y E EF  
Sbjct: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFIC 247

Query: 213 ASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSS 272
            S K++ ++GF I    ++CG   +DG IG +YWR+PGA+            RF G VS+
Sbjct: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVST 302

Query: 273 LINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPK 332
           L+ AAF++  TE + ITA E +NPRKA+P A KKV+ R L+ Y+ S+  +GLLVPY+  +
Sbjct: 303 LVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSE 362

Query: 333 L-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNS 391
           L  S      +SP+++++   G +V+P   NAV+LI++ S  +S  Y  SR+L +L++  
Sbjct: 363 LLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQG 422

Query: 392 LAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLIS 451
            AP+  + V R G P    L  +V   +AF   S+   + FNWLL I+G++  F W LI 
Sbjct: 423 YAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALIC 482

Query: 452 FSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFV 511
            SHIRF +A++ +G S D++ YK+Q+  + + YA   + LI++ Q +    P  +    V
Sbjct: 483 LSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADV 542

Query: 512 AA----YISIFLFLAIWLSFQVWFKCRLLWKL 539
            A    Y+++ +F+ ++L +++W   +  W+L
Sbjct: 543 QAFFQDYLAMPVFIVLYLGYKIW---KRDWRL 571

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  302 bits (774), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 178/489 (36%), Positives = 273/489 (55%), Gaps = 18/489 (3%)

Query: 56  TESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVI 115
           T  SP     ++RKLK RH                     L  AGP G LI +  M T+I
Sbjct: 79  TSQSP-----LQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMI 133

Query: 116 YSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQ 175
             +  SLGEM    PV+  ++ +A RF+  + G  N   Y +       LE+      + 
Sbjct: 134 LCMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVD 193

Query: 176 YW-TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGA 234
           YW  ++   AA++ +FW  + S+NMF VK YGE EF  + IKV+ ++GFII    +VCG 
Sbjct: 194 YWGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGG 253

Query: 235 GQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 294
           G +   IG ++W NPGA+       D    +F G  S  + AAF++  TELVG+ A E  
Sbjct: 254 GPTHEYIGSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETE 308

Query: 295 NPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIF-VSSSPFMISIENSG 353
           +PRK++P+A K+V  RI +FYILSL  +GLLVPY DP+L    I   ++SPF+++++N G
Sbjct: 309 DPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHG 368

Query: 354 TKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLST 413
            K LP + N V+L  +LS GNS+V+  SR L +LS+    P     + R G P  S++ +
Sbjct: 369 IKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFS 428

Query: 414 SVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPY 473
           S FG L FL VS    + F+W+L+++G++  F WL IS  HIRF +A+  +  S D+L +
Sbjct: 429 SAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAF 488

Query: 474 KAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP---IDFVAAYISIFLFLAIWLSFQVW 530
            + +  + +YY+ F I +++++Q + A  P  Q     +F  AY+S+ + +A++L  +++
Sbjct: 489 ASPIGIWGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIY 548

Query: 531 FKCRLLWKL 539
            K    WKL
Sbjct: 549 TKN---WKL 554

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  302 bits (774), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 171/482 (35%), Positives = 264/482 (54%), Gaps = 13/482 (2%)

Query: 63  RREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSL 122
           R  ++ +LK RH                     L  AGP G LI ++  G++IY +  S+
Sbjct: 81  RSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSV 140

Query: 123 GEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAV 181
            E+    PV   F+ +A RF+  + G  N + Y L W  T  LE+      + YW T+  
Sbjct: 141 AELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKK 200

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
               ++ +FW ++  +NMF V+ YGE EF  +  K++ ++GFII +  ++CG G   G I
Sbjct: 201 YRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYI 260

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           G RYW +PGA+     + D +  +F G+ S  + AAF++ G+ELVG+ A EA+NPRK +P
Sbjct: 261 GARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVP 315

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDI 360
            A K+V  RI +FY+L L  IG+LVPY DP+L     +  ++SPF+I+I+N G   LP +
Sbjct: 316 GAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTL 375

Query: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA 420
            N V+LI +LS GNS VY  SR L +L+     P+  S + R G P   +  TS FG +A
Sbjct: 376 VNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIA 435

Query: 421 FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF 480
           F+  S   G+ F+WL+ ++G++  F W  I   HIRF +A+  +G S ++L + +    +
Sbjct: 436 FVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVW 495

Query: 481 LAYYASFFIALIVLIQGFTAFAPTFQP---IDFVAAYISIFLFLAIWLSFQVWFKCRLLW 537
            A +  F   +++  Q + A  P   P    DF   Y+S+ + LA+WL  ++W K    W
Sbjct: 496 GAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKN---W 552

Query: 538 KL 539
           KL
Sbjct: 553 KL 554

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  300 bits (769), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 172/530 (32%), Positives = 278/530 (52%), Gaps = 30/530 (5%)

Query: 28  FVD-----EQYSGENVTKAITTERKVE--DDAAKE------------TESSPQERREVKR 68
           FVD     EQ +   +T A + +   E  D   KE            TE S Q+ +E+K+
Sbjct: 49  FVDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQ 108

Query: 69  KLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VT 127
            +K RH                     L +AGP G LI Y  MGT +Y + Q+ GE+ V+
Sbjct: 109 TIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVS 168

Query: 128 FIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWI 187
           +  ++  F+V+    + PA G +  ++Y + W     LEL      I+YWT  V    ++
Sbjct: 169 YSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFV 228

Query: 188 VIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWR 247
            IF+ L+  +N F  + Y E EF     K++ ++GF I    +  G   +DG IG RYW 
Sbjct: 229 GIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWH 288

Query: 248 NPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKV 307
            PGA+     + D+    F G +++++ AAF +  TE + +TA E +NPRKA+P A KKV
Sbjct: 289 TPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKV 343

Query: 308 VVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVL 366
           + RIL  ++ S+  +G LVPY+ D  + S G    +SP+++++   G KV+P   NAV+L
Sbjct: 344 LYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFINAVIL 403

Query: 367 ITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSA 426
           +++LS GNS  Y  SR+LYSL++   AP+F   V R G P+ +++   VF  ++F   S 
Sbjct: 404 LSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASP 463

Query: 427 GSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYAS 486
              + F WLL I+G++  F W  I  SHIRF +A+  +  S  ++ +KAQ   + +YY  
Sbjct: 464 KEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVC 523

Query: 487 FFIALIVLIQGFTAFAP----TFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
           F + +I++ Q + A AP          F   Y+++ + +  ++ +++W K
Sbjct: 524 FMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKK 573

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  297 bits (760), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 154/496 (31%), Positives = 261/496 (52%), Gaps = 4/496 (0%)

Query: 42  ITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGP 101
           +  ER    +   E+E   ++   + R+LK R                      LA  GP
Sbjct: 8   VVLERPASGEDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGP 67

Query: 102 VGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161
           +   I+YLF G+++  V  SL EM +F P+   FS +  R++ PA G   G+ Y+L +  
Sbjct: 68  ISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAI 127

Query: 162 TFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221
             +  L+  G VI YW   V +  W+ + +  +  +N   VKY+GE E  +   K++ L+
Sbjct: 128 VLSANLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLV 187

Query: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281
              I    + CG   +    GFRYWR  GA  P ++      G+FLGW + ++ + F + 
Sbjct: 188 IVYITCLIITCGGAPNHTTTGFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFM 244

Query: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV-PYNDPKLDSDGIFV 340
           G+E++GI  GE ANP+K +P++   V  RI   Y+  +F +GL + P N   + +     
Sbjct: 245 GSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDA 304

Query: 341 SSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNV 400
           ++SPF+I+I +SG KVLP+  NA +L+ I+S+ N+++YI SR LY L+K+  AP+    V
Sbjct: 305 NASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLV 364

Query: 401 TRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQA 460
            R  VP    ++ S+ GFLA++     +   F+++ +   V G   W  I  ++I + +A
Sbjct: 365 NRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRA 424

Query: 461 IRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLF 520
           I+ +GIS DD+P++    P+ AY   FF+ +I    G+ AF   F    F+ +YI +F  
Sbjct: 425 IKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFAN 484

Query: 521 LAIWLSFQVWFKCRLL 536
           + + + ++++FK + +
Sbjct: 485 ILMVIGYKLYFKTKFV 500

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  298 bits (762), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 183/526 (34%), Positives = 278/526 (52%), Gaps = 28/526 (5%)

Query: 30  DEQYSGENVTKAITTERKVE-----------DDAAKETESSPQERREVKRKLKQRHXXXX 78
           +E   G+  T+ + + R+ E           D  A  T +SP     ++  LK RH    
Sbjct: 39  EEHKKGKVWTRFVDSFRERERLEVDPNMSELDQIAFRTANSP-----LQHHLKNRHLQMI 93

Query: 79  XXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVF 138
                            L  AGP G LI +   GT+IYS+  +LGE+    PV+  F+ +
Sbjct: 94  AIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGELAVLFPVSGGFTTY 153

Query: 139 AQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLAAWIVIFWCLLTSM 197
           A RF+  + G  N   Y L W     LE+      + YW T       ++ +FW  +  +
Sbjct: 154 ATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRDGFVALFWLAIFII 213

Query: 198 NMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGII 257
           N+F VK YGE EF  + IKVI ++GFII    + CG G   G IG RYW +P     G  
Sbjct: 214 NLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGGRYWHHP----YGAF 269

Query: 258 SSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYIL 317
             D    RF G  S  + AAF++ G+ELVG+ + E ANPRK++P+A K+V  RI +FY+L
Sbjct: 270 VGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPKAAKQVFWRITLFYLL 329

Query: 318 SLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSN 376
           +L  +GLLVPY + +L  +  +  ++SPF+I+I   G + LP + N V+LI +LS GNS 
Sbjct: 330 ALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGIRGLPSVVNVVILIAVLSVGNSA 389

Query: 377 VYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLL 436
           +Y  SR L +L++ +  P+F   + R G P +S+L TS FG +AF+  S   G+ FNWLL
Sbjct: 390 IYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLL 449

Query: 437 NITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQ 496
            ++G++  F W  I   HIRF +A+  +G   D+L + +    + +Y+  F I L+ + Q
Sbjct: 450 ALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQ 509

Query: 497 GFTA-FAPTFQP--IDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
            + A F P  +P    F  AY+S  + +A +L  +++ K    WK+
Sbjct: 510 FYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKN---WKI 552

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  297 bits (761), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 174/479 (36%), Positives = 264/479 (55%), Gaps = 13/479 (2%)

Query: 66  VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM 125
           ++R LK RH                     L   GP G LI +  +G +IY V  S+GE+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 126 VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLA 184
               PV+  F+ +A RF+  + G    Y Y L W     LE+      + +W T      
Sbjct: 137 AVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244
            ++ +F+ ++  +N F V+ YGE EF  + IKVI ++GFII    +VCG G   G IG +
Sbjct: 197 GFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGK 256

Query: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304
           YW NPGA+     S D    RF G  S  + AAF++ GTELVG+ + E ANPRKALPRA 
Sbjct: 257 YWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAA 311

Query: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNA 363
           K+V  RIL+FYI+SL  IGLLVP+   +L  +  +  ++SPF+++I+  G K LP + N 
Sbjct: 312 KQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVINV 371

Query: 364 VVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLE 423
           V+LI++LS GNS VY  SR + +L++    P   + + R G P  ++++T VFG L+F+ 
Sbjct: 372 VILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIA 431

Query: 424 VSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAY 483
            S   G  FNWLL ++G++  F+W  I   HIRF +A+  +G S D+L + +      +Y
Sbjct: 432 QSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSY 491

Query: 484 YASFFIALIVLIQGFTAFAP---TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
           +    + L+++ Q + A  P   +    DF +AY+S  + LA ++  ++W +    WKL
Sbjct: 492 FGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRN---WKL 547

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 165/502 (32%), Positives = 268/502 (53%), Gaps = 13/502 (2%)

Query: 37  NVTKAITTERKVEDDAAKETES-SPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
           N    I +   V D A  E  +   Q   ++K+ ++ RH                     
Sbjct: 69  NEMNPILSHESVFDTAVVEISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTT 128

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYM 154
           L+HAGP G +I Y  M T IY V Q++GEM V ++ +   FS +    + P L     ++
Sbjct: 129 LSHAGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWI 188

Query: 155 YWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP-VKYYGEFEFCIA 213
           Y + W     LEL      IQYWT  V    +++IF+ L+  +N+F   + Y E EF   
Sbjct: 189 YCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCN 248

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
             K++ + GF I    ++CG   + G IG RYW +PGA+       D    RF G VS+L
Sbjct: 249 VCKILMMTGFFILGIILICGGAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTL 303

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           + AAF + GTE + ITA E ANPRKA+P A KKV+ R L+ Y+ S+  +G LVPYN  +L
Sbjct: 304 VTAAFAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSEL 363

Query: 334 -DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392
             S G    +SP++I++ + G +V+P   NAV+LI++ S  +S  Y  SR+L +L++   
Sbjct: 364 LGSSGPATKASPYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGF 423

Query: 393 APRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISF 452
           AP+  + V + G P    +  ++   ++F   S+     FNWLL+I+G++  F W +IS 
Sbjct: 424 APKIFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISL 483

Query: 453 SHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPI 508
           SHIRF +A++ +G S D++ +K+Q   + + YA   + L+++ Q +    P    +   +
Sbjct: 484 SHIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAV 543

Query: 509 DFVAAYISIFLFLAIWLSFQVW 530
            F  AY+++ +F+ ++  +++W
Sbjct: 544 SFFQAYLAMPVFIVLYFGYKIW 565

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  296 bits (758), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/501 (33%), Positives = 268/501 (53%), Gaps = 20/501 (3%)

Query: 43  TTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPV 102
           +T R +  +   + E   Q+       L  RH                     L   GP 
Sbjct: 39  STNRGINGNKDAKLEGKLQQ------GLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPA 92

Query: 103 GALISYLFMGTVIYSVTQSLGEMVTFIP-----VTSSFSVFAQRFLSPALGATNGYMYWL 157
           G  ISY+ + TV+Y +  + GEMV ++P        S S    R++ P+L    G+ Y+ 
Sbjct: 93  GLFISYVIISTVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFY 152

Query: 158 SWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKV 217
            +    A E +    V++YWT+AVP AAWI IF  ++  +N+  VKYYGE EF  ASIKV
Sbjct: 153 CYVILVAAECTAASGVVKYWTDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKV 212

Query: 218 IALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAA 277
           + ++G II SF +  G G +   +GFRYW+NPG +   I  +  N G FL   S +I  A
Sbjct: 213 LCIVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHI--TGGNLGNFLDVYSGIIKGA 270

Query: 278 FTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLD-- 334
           F +  G EL+ + + E  + R+ + +A K+ V R++ FYIL    I ++V  NDP L   
Sbjct: 271 FAFILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSA 330

Query: 335 --SDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392
             S      SSPF+I I+N+G K+LP I NA +L +  SAGN+ ++  SR L +++ N  
Sbjct: 331 LASGKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQ 390

Query: 393 APRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISF 452
           AP+    + R GVP+ +V  +++   LA+L VS+ +   F W  NI+ ++GF  W     
Sbjct: 391 APKIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLV 450

Query: 453 SHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPI-DFV 511
           +++RF +AI+  G+  + LPY  +   ++ +++   + L++   G+  F P F  + DF+
Sbjct: 451 AYLRFRKAIKYNGL-ENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFI 509

Query: 512 AAYISIFLFLAIWLSFQVWFK 532
           AAYI++ LF+ +W+  +++ +
Sbjct: 510 AAYITLPLFVVLWIGHKIYTR 530

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 169/486 (34%), Positives = 275/486 (56%), Gaps = 11/486 (2%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D    +++  +   ++K+ +K RH                     L + GP G +I Y  
Sbjct: 81  DKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAI 140

Query: 111 MGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
           MG+ +Y + Q+ GE+ V +  ++  F+ +    + PALG +  ++Y L W     LEL  
Sbjct: 141 MGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVT 200

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
               I+YWT +V    ++ IF+ L  ++N+F  + Y E EF   + KV+ + GF I    
Sbjct: 201 ASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGII 260

Query: 230 VVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289
           V CG   +DG IG +YW +PG++     S DK    F G VS+L+ AAF +  TE + +T
Sbjct: 261 VNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALT 315

Query: 290 AGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMIS 348
           A E ANPRK++P A KKV+ RI+V ++ S+  +G LVP+N  +L  S G    +SP++I+
Sbjct: 316 AAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIA 375

Query: 349 IENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYF 408
           I + G KV+P   NAV+L+++LS GNS  Y  SR+L SL++   AP FL  V R G P  
Sbjct: 376 IASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTL 435

Query: 409 SVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISR 468
           +++ ++VFG ++F+  S      F WLL I+G++  F W  I  SHIRF +A++ +G S 
Sbjct: 436 AMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSL 495

Query: 469 DDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQ-PID---FVAAYISIFLFLAIW 524
            +L +K+Q+  + +YYA+  + LI++ Q +TA AP  +  +D   F   Y+++ + +A++
Sbjct: 496 GELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALY 555

Query: 525 LSFQVW 530
             ++VW
Sbjct: 556 FGYKVW 561

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  297 bits (760), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 185/548 (33%), Positives = 287/548 (52%), Gaps = 28/548 (5%)

Query: 42  ITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGP 101
           +  +  +E     E E    + RE+K+ +K RH                     LA++GP
Sbjct: 86  LAGDSDIEGKPRTEPEKD-DDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGP 144

Query: 102 VGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 160
            G +I Y  MG+ IY + Q+ GE+ V +  +T  F+ +    + PA G    ++Y + W 
Sbjct: 145 AGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWL 204

Query: 161 FTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP-VKYYGEFEFCIASIKVIA 219
               LEL      I+YWT  V    ++VIF+CL+  +N+      Y E EF   S K++ 
Sbjct: 205 CVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILM 264

Query: 220 LLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFT 279
           L GF I    V+CG   +DG IG R W NPG++       DK   RF G VS+L+NAAF 
Sbjct: 265 LTGFFILGIVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFA 319

Query: 280 YQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGI 338
           +  +E +G+TA E +NPRKA+P A KK++ RI+  Y+ S+  +G LVPY+ D  L S G 
Sbjct: 320 FGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGA 379

Query: 339 FVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLS 398
              +SP++++I   G +V+P   NAV+L+++LS GNS  Y  SR L SLS+   AP FL+
Sbjct: 380 ATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLN 439

Query: 399 NVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFM 458
            V R G P  +   +++ G +AF   S    + F WLL I+G++  F W  I  SH+RF 
Sbjct: 440 YVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFR 499

Query: 459 QAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA----Y 514
           +A+R +G S  ++ +K+Q+  + + Y+   + LI++ Q +TA  P  +    V A    Y
Sbjct: 500 RAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENY 559

Query: 515 ISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXX-----EELVWIEPECKTR----- 564
           +++ +F+ ++  F++W K    W+L                 EEL+  E E   R     
Sbjct: 560 LAMPIFIVLYFGFKIWKK---DWRLFIRAEDIDLVSHREIFDEELLKQEDEEYRRKLRDG 616

Query: 565 --WQRVWD 570
             W+RV+D
Sbjct: 617 PMWRRVYD 624

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  296 bits (759), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 168/517 (32%), Positives = 276/517 (53%), Gaps = 17/517 (3%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           S   + + +  +  +E   + + +S P +   +K+ L+ RH                   
Sbjct: 77  SNGTIREDLIMDVDLEKSPSVDGDSEPHK---LKQGLQSRHVQLIALGGAIGTGLLVGTS 133

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSV-----FAQRFLSPALG 148
             L   GP G  ISY+ +  VIY +  +LGEMV F+P   S S         R++ P+LG
Sbjct: 134 STLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLG 193

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
              G+ Y+  +    A E +    V++YWT AVP   WI IF C++  +N   VK YGE 
Sbjct: 194 FATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGES 253

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF  ASIK++ ++G II SF +  G G +   +GFRYW++PGA+   +  +  + G F  
Sbjct: 254 EFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHL--TGGSLGNFTD 311

Query: 269 WVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVP 327
             + +I  AF +  G ELV +T+ E A+ R+ + +A ++ V R++ FY+L    I ++VP
Sbjct: 312 IYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVP 371

Query: 328 YNDPK----LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRV 383
           YNDP     L        SSPF+I I+N+G KVLP I N  +L +  SA N+ ++  +R 
Sbjct: 372 YNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRS 431

Query: 384 LYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAG 443
           L ++++   AP+ L  + + GVPY +V  + +   LA+L VS+ +   FNW  NI+ ++G
Sbjct: 432 LLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISG 491

Query: 444 FFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
           F  W+    +++RF +AI   G+  D LP+K    P+  +++   I +I +  G+  F P
Sbjct: 492 FLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIP 550

Query: 504 TFQPI-DFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
            +  + DF+AAYI++ +FL +W   +++ +    W L
Sbjct: 551 KYWRVADFIAAYITLPIFLVLWFGHKLYTRTWRQWWL 587

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  294 bits (752), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 162/490 (33%), Positives = 265/490 (54%), Gaps = 17/490 (3%)

Query: 55  ETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTV 114
           ET+S+  E   + + L+ RH                     L + G    L+S++ + T+
Sbjct: 35  ETQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTI 94

Query: 115 IYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVI 174
           +Y +  SL EM+ ++P   S      R++ P+LG   G+ Y  ++    A ELS    V+
Sbjct: 95  VYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVV 154

Query: 175 QYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGA 234
            YW   VP+AAWI IF  ++  +N   VKYYGE EF  ASIK+I +LG ++ S  +  G 
Sbjct: 155 SYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGG 214

Query: 235 GQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEA 293
             +    GFRYW+NPG +   +  +  + GRFL    ++I +AF +    EL+GI   EA
Sbjct: 215 APNHDRTGFRYWKNPGPFAMSL--APGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEA 272

Query: 294 ANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPK----LDSDGIFVSSSPFMISI 349
            + R+   +A ++ + RI+ FY+     IG+++   DPK    L++     +SSPF+  I
Sbjct: 273 QDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGI 332

Query: 350 ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFS 409
            N+G  VL  + N  +L +  SAGNS +Y  +R++ +L++   AP+FL+ + R GVPY +
Sbjct: 333 ANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNA 392

Query: 410 VLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRD 469
           V+  ++   LA+L V   S   F WL NI  ++GF  W  +  + IRF     +RGI  +
Sbjct: 393 VIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRF-----RRGIVFN 447

Query: 470 DL----PYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-TFQPIDFVAAYISIFLFLAIW 524
           +L    PY+  + P++AYY +F   ++ L  GF  F    +  +DFVAAY+++ ++L ++
Sbjct: 448 NLQSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLY 507

Query: 525 LSFQVWFKCR 534
           L  ++WF+ R
Sbjct: 508 LGHKLWFRTR 517

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/481 (35%), Positives = 257/481 (53%), Gaps = 34/481 (7%)

Query: 44  TERKVEDDAAKETESSPQERREV---------------------KRKLKQRHXXXXXXXX 82
           T++  +DD   E  SS Q  R +                     KR LK RH        
Sbjct: 42  TKQSKDDDDIAEGHSSYQPPRNIFQRCIDSFKPPLDGSFHTHNLKRTLKARHLIMIAIGG 101

Query: 83  XXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRF 142
                        LA  GP+  +I +   GT I      LGE+    PV  +F+ ++ RF
Sbjct: 102 SIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTRF 161

Query: 143 LSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPV 202
           L P++      +Y + W F   LE+      IQYW +++    W+ IF+C++ S+N+F  
Sbjct: 162 LDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGA 221

Query: 203 KYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKN 262
           + +GE EF  +SIKVI ++GFII    ++CG G     +G RYW +PG    G       
Sbjct: 222 RGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGARYWHDPGCLSHG------- 274

Query: 263 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFI 322
              F G +S L+ A+++  GTE+V + +GE  NPR+ LP AIK+   RIL F+++SL  I
Sbjct: 275 ---FPGVLSVLVVASYSLGGTEMVCLASGE-TNPRE-LPSAIKQTFWRILFFFLISLTLI 329

Query: 323 GLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSR 382
           G LVPY +P L   G  V++SPF+I+I+    K LP I NAV+LI+I+S GNS ++  SR
Sbjct: 330 GFLVPYTNPNL-LGGSSVNNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSR 388

Query: 383 VLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVA 442
            L S++   L P+F   + R G P   +L+ S+FG LAFL  S+  G+ F+WL+ I G+A
Sbjct: 389 TLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLA 448

Query: 443 GFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFA 502
               WL I+ SHIRF  A++ +G S D+L + + +  + + Y++   +LI++ Q + A  
Sbjct: 449 TCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALW 508

Query: 503 P 503
           P
Sbjct: 509 P 509

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  296 bits (757), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/517 (32%), Positives = 275/517 (53%), Gaps = 17/517 (3%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           S   + + +  +  VE   + E ++ P +   +K+ L+ RH                   
Sbjct: 81  SNGTIREDLIMDVDVEKSPSVEGDNEPHK---LKQGLQSRHVQLIALGGAIGTGLLVGTS 137

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSV-----FAQRFLSPALG 148
             L   GP G  ISY+ +  VIY +  +LGEMV F+P   S S         R++  +LG
Sbjct: 138 STLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLG 197

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
              G+ Y+  +    A E +    V++YWT AVP   WI IF C++  +N+  VK YGE 
Sbjct: 198 FATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGES 257

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF  ASIK++ ++G II SF +  G G +   +GFRYW++PGA+   +  +  + G F  
Sbjct: 258 EFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHL--TGGSLGNFTD 315

Query: 269 WVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVP 327
             + +I  AF +  G ELV +T+ E A+ R+ + +A ++ V R++ FY+L    I ++VP
Sbjct: 316 IYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVP 375

Query: 328 YNDPK----LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRV 383
           YNDP     L        SSPF+I I+N+G KVLP I N  +L +  SA N+ ++  +R 
Sbjct: 376 YNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRS 435

Query: 384 LYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAG 443
           L ++++   AP+ L  + R GVPY +V  + +   LA+L VS+ +   FNW  NI+ ++G
Sbjct: 436 LLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISG 495

Query: 444 FFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
           F  W+    +++RF +AI   G+  D LP+K    P+  + +   + +I L  G+  F P
Sbjct: 496 FLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIP 554

Query: 504 TFQPI-DFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
            +  I DF+AAYI++ +FL +W   +++ +    W L
Sbjct: 555 KYWKIADFIAAYITLPIFLVLWFGHKLYTRTWSQWWL 591

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  294 bits (752), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/509 (33%), Positives = 267/509 (52%), Gaps = 14/509 (2%)

Query: 37  NVTKAITTERKVEDDAAKETESSPQE-----RREVKRKLKQRHXXXXXXXXXXXXXXXXX 91
           N  K + +  +    +    ES   +        +K+ L  RH                 
Sbjct: 17  NGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIALGGCIGTGLFVG 76

Query: 92  XXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATN 151
               L   GP    +S++ + T++Y +  +L EMV ++P   S      R++ P+LG   
Sbjct: 77  TSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFAA 136

Query: 152 GYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFC 211
           G+ Y  S+    A EL+    +++YWT+ VP   WI IF  ++  +N   V++YGE EF 
Sbjct: 137 GWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFW 196

Query: 212 IASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVS 271
            AS+K+I +L  ++ S  +  G   +   +GFRYWRNPGA+G  I  +  N GRFL   +
Sbjct: 197 FASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHI--TGGNLGRFLDLWT 254

Query: 272 SLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYND 330
           ++I +AF +    ELVG+   EA + R+ + +A ++ + RI+ FY+ S   IG++V  ND
Sbjct: 255 AIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKND 314

Query: 331 PK----LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYS 386
                 L+ +    +SSPF+  I NSG  VL  + N  +L +  SAGNS  Y  SR + +
Sbjct: 315 HNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILA 374

Query: 387 LSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFA 446
           LSK   AP+  S + R GVPY +V   S+   LA+L VS+ S K F WL NI  ++GF  
Sbjct: 375 LSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIG 434

Query: 447 WLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-TF 505
           W LI  ++IRF +AI    +  D +PY++ + PF AY+ +  +A+I L  G+  F    +
Sbjct: 435 WFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRW 493

Query: 506 QPIDFVAAYISIFLFLAIWLSFQVWFKCR 534
              DF+ +YIS+ +FLA +L  +  +K R
Sbjct: 494 DYKDFLTSYISLPIFLAFYLGHKTIYKTR 522

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  295 bits (754), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/475 (35%), Positives = 255/475 (53%), Gaps = 10/475 (2%)

Query: 63  RREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSL 122
           R  ++R LK RH                     L   GP   LI +  +G +IYSV  ++
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAM 136

Query: 123 GEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAV 181
           GE+    PV   F+ +  RF+  + G    Y+Y L W     LE+      + YW T A 
Sbjct: 137 GELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAK 196

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
               ++ +F+ ++  +NMF VK YGE EF  + IKV  ++GFII    ++CG G   G +
Sbjct: 197 YRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYV 256

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           G +YW NPGA+     + D    RF    S  + AAF++ GTELVG+ A E  NPRKALP
Sbjct: 257 GGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDI 360
           RA K+V  RI +FYI+SL  IGLLVPY    L  S  +  ++SPF+++I+  G   LP +
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSV 371

Query: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA 420
            N V+LI++LS GNS+VY  SR L +L+     P+  S + R G P   +L+T  FG L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 421 FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF 480
           F+  S   G  FNWL+ ++G++  F W  I   H+RF +A+  +G S D+L + + +  +
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 481 LAYYASFFIALIVLIQGFTAFAP---TFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
            +Y+    I L+ + Q + A  P   T    DF  AY+S+ + L  +L+ +++ +
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTR 546

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  291 bits (746), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 167/513 (32%), Positives = 272/513 (53%), Gaps = 16/513 (3%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           F D +  GE  +  +       +    + E +  +   +++ L  RH             
Sbjct: 15  FYDVKSQGETYSGTL-------NQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCIGTG 67

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPAL 147
                   L + GP+   +S++ +  ++Y V  +L EM+ ++P   +      R++ P+L
Sbjct: 68  LFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSL 127

Query: 148 GATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGE 207
           G   G+ Y  S+    A ELS    V+QYWT+ V +A WI IF  ++  +N  PVK+YGE
Sbjct: 128 GFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGE 187

Query: 208 FEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFL 267
            EF  AS+K+I +LG +I S  +  G   S   +GFRYW NPG +   I  +  N GRFL
Sbjct: 188 SEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHI--TGGNTGRFL 245

Query: 268 GWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV 326
              +++I + F +    EL+G+   EA + R+ + +A ++ + RI+ FYI S   IG ++
Sbjct: 246 DIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFIL 305

Query: 327 PYNDPK----LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSR 382
             +DPK    L SD    +SSPF+  I N+G  VL  I NAV+L +  S+ NS +Y  SR
Sbjct: 306 SRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSR 365

Query: 383 VLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVA 442
            + +L+K   AP+  + + R GVPY +V  ++    L +L  S+ S + F WL NI  ++
Sbjct: 366 SILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTIS 425

Query: 443 GFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFA 502
           GF  W LI  +++RF +AI    +  + +P+K+ + P+  Y+   F+ L+ L  G+  F 
Sbjct: 426 GFIGWALIGITYLRFRKAIFYNNL-YERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFI 484

Query: 503 PTF-QPIDFVAAYISIFLFLAIWLSFQVWFKCR 534
           P +    DFVAAYI++ +F  ++L  ++WFK R
Sbjct: 485 PKYWNASDFVAAYITLPIFFLLYLGHKIWFKTR 517

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  290 bits (741), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 151/491 (30%), Positives = 255/491 (51%), Gaps = 4/491 (0%)

Query: 45  ERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGA 104
           E  + D A+   E        + R+L                         LA  GP+  
Sbjct: 12  EPTLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISI 71

Query: 105 LISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFA 164
            ++YLF G+++  V  SL EM  F P+   FS +  +++ PA G   G+ Y+L +    +
Sbjct: 72  FLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLS 131

Query: 165 LELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFI 224
             L+  G VI YW   + +A W+ + +     +N   V+Y+G+ E  +   K+  LL   
Sbjct: 132 ANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIF 191

Query: 225 IFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTE 284
           I    + CG G     IGFRYWR  G + P ++    N G+FLGW + +I + F + G+E
Sbjct: 192 IVCLVITCGGGPDHTTIGFRYWRESG-FLPYLVKG--NTGKFLGWWACVIQSIFGFMGSE 248

Query: 285 LVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV-PYNDPKLDSDGIFVSSS 343
           ++GI  GE ANPRK +P+A + V++RI VFYI  +F +GL V P+N   + +     ++S
Sbjct: 249 MIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANAS 308

Query: 344 PFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRG 403
           PF+I+I  SG KVLP   NA +L+ I S+  +++YI SR LY L+K+  AP+    + + 
Sbjct: 309 PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKH 368

Query: 404 GVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRK 463
            +P    +  S+ GFLA++     +   F ++ +   V G   W  I  ++I + + ++ 
Sbjct: 369 KIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKS 428

Query: 464 RGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAI 523
            G+  D++P++    P+ AY A FF+++I    G++AF   F    F+ +YI IF  + +
Sbjct: 429 HGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLL 488

Query: 524 WLSFQVWFKCR 534
            L +++++K +
Sbjct: 489 VLGYKLYYKTK 499

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  293 bits (749), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 177/529 (33%), Positives = 281/529 (53%), Gaps = 26/529 (4%)

Query: 29  VDEQYSGENVTKAITTERKVEDD--AAKETESSPQ-----------ERREVKRKLKQRHX 75
           +D   +  + +K+++   +++D    A++ E  P             +  +K  LK RH 
Sbjct: 45  IDSNDATIDHSKSVSRWTRIKDSFKRAEKEEVDPNLTEAERIAINTAKAPLKHTLKGRHM 104

Query: 76  XXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSF 135
                               L  AGP G +I +    T+IY +  +LGE+    PV+  F
Sbjct: 105 QMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFPVSGGF 164

Query: 136 SVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLAAWIVIFWCLL 194
           + +A RF+  + G  + + Y L W  T  LE+      + YW T       ++ +FW ++
Sbjct: 165 TTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDGFVALFWLVI 224

Query: 195 TSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGP 254
             +N+F V+ +GE EF  ++IKV+ ++GFII    +V G G   G +G RYW NPGA+  
Sbjct: 225 VIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAF-- 282

Query: 255 GIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVF 314
                D    +F G  S  + AAF++ G+ELVGITA EAANPRK++PRA K+VV RI++F
Sbjct: 283 ---VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLF 339

Query: 315 YILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAG 373
           Y+ SL  IGLLVPY DP+L  +  +  S+SPF+I+I   G + LP + N V+LI +LS G
Sbjct: 340 YMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVILIAVLSVG 399

Query: 374 NSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFN 433
           NS ++ GSR + +LS+    P     + R G P   ++  S FG +AF+  S   G+ F 
Sbjct: 400 NSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFA 459

Query: 434 WLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIV 493
           WL+ ++G++  F W  I   HIRF  A++ +G S ++LP+ +      + +  F + L+ 
Sbjct: 460 WLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMF 519

Query: 494 LIQGFTA-FAPTFQPID--FVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
           + Q + A F P  +P    F  +Y+S  + LA +   +++ K    WKL
Sbjct: 520 IAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKN---WKL 565

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  291 bits (745), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 171/493 (34%), Positives = 268/493 (54%), Gaps = 16/493 (3%)

Query: 55  ETESSPQERREVKRK--LKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMG 112
           + E  P   RE K K  +  RH                     L + GP G  I Y  MG
Sbjct: 66  DAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMG 125

Query: 113 TVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLG 171
           + IY + Q+ GEM V++  ++ +F+ +    + PALG +  ++Y L W     LEL    
Sbjct: 126 SCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTAT 185

Query: 172 KVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVV 231
             I+YWT AV    ++VIF+ L   +N+F  + Y E EF   + KV+ + GF I    V 
Sbjct: 186 ITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVN 245

Query: 232 CGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 291
           CG   +DG +G +YW +PGA     +   K    F G +++++ AAF +  TE + +TA 
Sbjct: 246 CGGAGNDGYLGGKYWHDPGA-----LYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAA 300

Query: 292 EAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIE 350
           E ANPR+A+P A KK+V R+L+ ++  +  +G LVPYN D  + S G    +SP++I+I 
Sbjct: 301 EQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIA 360

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
           + G KV+P   NAV+L+++LS GNS  Y  SR+L SLS+   AP +L+ + R G P  ++
Sbjct: 361 SHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAM 420

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
           L + +FG +AF+  S      F WLL I+G++  F W+ I  SHIRF +A+  +G S  +
Sbjct: 421 LVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGE 480

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFVAAYISIFLFLAIWLS 526
           L YK+Q     +YYA+  +A ++  Q + A AP         +F   Y+++ + +A++  
Sbjct: 481 LGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFG 540

Query: 527 FQVWFKCRLLWKL 539
           ++VW   +  WKL
Sbjct: 541 YRVW---KRDWKL 550

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  291 bits (745), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 177/514 (34%), Positives = 277/514 (53%), Gaps = 23/514 (4%)

Query: 36  ENVTKAITTERKVEDDAAKETES-------SPQERREVKRKLKQRHXXXXXXXXXXXXXX 88
             +T+ +T ++  E     ET S        P+E  ++K+ LK RH              
Sbjct: 33  NTITEQLTKDKHKETIDYSETSSLDEEKQQQPEENGKLKQGLKSRHVQLIALGGTIGTGL 92

Query: 89  XXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSV-----FAQRFL 143
                  LA  GP G   SYL + T IY +  + GEMV ++P   S S        ++++
Sbjct: 93  LVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYV 152

Query: 144 SPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA--VPLAAWIVIFWCLLTSMNMFP 201
             +LG  + + Y+  +    A E +    V++YW  A  VP  AWI IF   + ++NM P
Sbjct: 153 DRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLP 212

Query: 202 VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDK 261
           V +YGE EF  ASIK++ +LG II SF +  G G S   +GFRYW+ PGA+   I  +D 
Sbjct: 213 VNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHI--TDG 270

Query: 262 NEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLF 320
             G FL   + +I   F +  G ELV +T+ E  + R+ + +A ++ V R+++FY+L   
Sbjct: 271 TGGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSL 330

Query: 321 FIGLLVPYNDPKLDS----DGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSN 376
            I ++V YNDP L +          SSPF+I I+N+G KVLP I N  ++ +  SAGN+ 
Sbjct: 331 SISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAY 390

Query: 377 VYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLL 436
           ++  SR L +++ +  AP+F S + R GVPY +V  + +F  LA+L VS+ +   FNW  
Sbjct: 391 MFASSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFS 450

Query: 437 NITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQ 496
           NI+ ++GF  W+    ++IRF +AI    +  D LPYK     +L +Y+ F ++LI L  
Sbjct: 451 NISTISGFIGWICACVAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTN 509

Query: 497 GFTAFAPTFQPI-DFVAAYISIFLFLAIWLSFQV 529
           G+  F P F    DF+AAYI++ +F+ +W+  ++
Sbjct: 510 GYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKL 543

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  291 bits (746), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 166/507 (32%), Positives = 271/507 (53%), Gaps = 23/507 (4%)

Query: 35  GENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXP 94
           G N  + I +E  + +D  K          ++K+ L  RH                    
Sbjct: 80  GYNGNETIISEELINEDGRK---------NKLKQGLNARHIQLIALGGCIGTGLFVGAGI 130

Query: 95  PLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSV-----FAQRFLSPALGA 149
            L   GP G + SYL + T++Y +   LGEMV ++P   S S        +R+L  +L  
Sbjct: 131 TLNKCGPAGLVASYLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSF 190

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
             G+ Y+  +    A E +    V++YWT+ VP  AWIV+F  ++  +NM PV+ YGE E
Sbjct: 191 AAGWNYYYCFVMLVAAECTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESE 250

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F  A  K++ ++G II SF +  G G +   +GFRYW  PG++   I  ++ + G FL  
Sbjct: 251 FWFAISKILCIVGLIILSFILFWGGGPNHDRLGFRYWITPGSFANTI--TNGSFGNFLDV 308

Query: 270 VSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY 328
              +I  AF++  G ELV + + E ++PR+ + +A K+ + R++ FYIL    I ++V Y
Sbjct: 309 YKGIILGAFSFILGPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSY 368

Query: 329 NDPKLDS----DGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVL 384
           NDP L +    D     SSPF+I I+N+G  VLP I N  +LI+  S+GN+ ++  SR L
Sbjct: 369 NDPILSTALIQDKPGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSL 428

Query: 385 YSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGF 444
            +++ NS AP+ L  + R GVPY +V+ + +   +A+L  S  +   F W  N++ ++GF
Sbjct: 429 QTMAINSQAPKCLGKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGF 488

Query: 445 FAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP- 503
             W+++S +++RF +AI   G+ +D LPY     P+L  Y+     +I +  GF    P 
Sbjct: 489 LGWIIVSVTYLRFRKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPR 547

Query: 504 TFQPIDFVAAYISIFLFLAIWLSFQVW 530
            +   DF+AAY+++ +FL IW+  + +
Sbjct: 548 NWNVSDFIAAYLTLPIFLMIWIGHKFY 574

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  290 bits (743), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 181/502 (36%), Positives = 274/502 (54%), Gaps = 19/502 (3%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
           E V   +T   K+    A +T  SP     ++ KLK RH                     
Sbjct: 67  EEVDPNLTDLEKI----AIKTARSP-----LQHKLKSRHLQMIAIGGAIGTGLFVGSGRA 117

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMY 155
           L  AGP G LI +   GT+I+++  +LGE+    PV+  F+ +A RF+  + G    + Y
Sbjct: 118 LRTAGPAGILIGWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFNY 177

Query: 156 WLSWCFTFALELSVLGKVIQYWTEAVPLA-AWIVIFWCLLTSMNMFPVKYYGEFEFCIAS 214
            L W     LE+      + YW   V     ++ +FW ++  +NMF V+ YGE EF  + 
Sbjct: 178 MLQWLVVLPLEIVAASITVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSI 237

Query: 215 IKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 274
           IKV A++GFII    +VCG G   G +G RYW NPGA+    + S   + +F G+ S  +
Sbjct: 238 IKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGAF----VGSTSGQ-KFHGFCSVFV 292

Query: 275 NAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL- 333
            AAF++ G+EL+G+   EA NPRKA+P A K+V  RIL+FYI+ L  IG LVPYNDP+L 
Sbjct: 293 TAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLI 352

Query: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393
            S  +  S+SPF+I+I   G   LP + N V+LI++LS GNS +Y  SR L +LS+    
Sbjct: 353 SSSSVDASASPFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFL 412

Query: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453
           P+ +S + R G P   +  +S FG +AF+  S    + FNWLL I+G++ FF W  I   
Sbjct: 413 PKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICIC 472

Query: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP---TFQPIDF 510
           HIRF  A++ +G   D+LP+ +      +Y+  F   L+++ Q + A  P   +    +F
Sbjct: 473 HIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEF 532

Query: 511 VAAYISIFLFLAIWLSFQVWFK 532
            +AY++  + LA +++ ++W K
Sbjct: 533 FSAYLAAPVILAFYIAHKLWKK 554

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  291 bits (746), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 266/488 (54%), Gaps = 12/488 (2%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           D   +  +   Q++  +K+ +K RH                     L +AGP G +I Y 
Sbjct: 129 DGIKQAPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYA 188

Query: 110 FMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELS 168
            MG+ +Y + Q+ GE+ V +  +   F+ +    + PALG +  +++ L W     LEL 
Sbjct: 189 IMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELV 248

Query: 169 VLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
                I+YWT  V    ++VIF+ L+  +N+F  K Y E +F     K++ ++GF I + 
Sbjct: 249 TASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAI 308

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            + CG   +DG IG +YWR+PGA+       D    RF G V++ + AAF +  +E + +
Sbjct: 309 IIDCGGAGTDGYIGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAM 363

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY-NDPKLDSDGIFVSSSPFMI 347
           TA E +NPRKA+P A KK++ RIL  ++ SL  +G LVPY +D  L + G    +SP++I
Sbjct: 364 TASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVI 423

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           ++ + G +V+P   NAV+L+++LS  NS  Y  SR+L SL+K   AP+    + R G P 
Sbjct: 424 AVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPA 483

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
            ++L +++FG +AF   S      F WLL I+G++  F W+ I  SHIRF +A++ +G S
Sbjct: 484 VAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRS 543

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVAAYISIFLFLA 522
             ++ YK+Q+  + + YA   + L ++ Q + A AP           F   Y+++ + +A
Sbjct: 544 LGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIA 603

Query: 523 IWLSFQVW 530
           +++ F+VW
Sbjct: 604 LYIFFKVW 611

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  291 bits (745), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 161/492 (32%), Positives = 265/492 (53%), Gaps = 12/492 (2%)

Query: 48  VEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALIS 107
            E    + ++   Q +  +K+ +K RH                     L +AGP G +I 
Sbjct: 125 TESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIG 184

Query: 108 YLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALE 166
           Y  MG+ IY + Q+ GE+ V +  +   F+ +    + PALG +  ++Y L W     LE
Sbjct: 185 YAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLE 244

Query: 167 LSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIF 226
           L      I+YWT  V    ++VIF+ L+  +N+F  K Y E +F     K++ ++GF I 
Sbjct: 245 LVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFIL 304

Query: 227 SFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELV 286
           +  + CG   +DG IG RYW NPGA+       +    RF G V++ + AAF +  +E +
Sbjct: 305 AIIIDCGGAGTDGYIGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTAAFAFGMSEQL 359

Query: 287 GITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY-NDPKLDSDGIFVSSSPF 345
            +TA E +NPRKA+P A KK++ RIL  ++ SL  +G LVPY +D  L + G    +SP+
Sbjct: 360 AMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPY 419

Query: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGV 405
           +I++ + G +V+P   NAV+L+++LS  N   Y  SR+L SL+K   AP+    + R G 
Sbjct: 420 VIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGR 479

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           P  ++L +S+FG +AF   S      F WLL I+G++  F W+ I  SHIRF +A++ +G
Sbjct: 480 PAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQG 539

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVAAYISIFLF 520
            S  ++ YK+Q+  + + YA   + L ++ Q + A +P           F   Y+++ + 
Sbjct: 540 RSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPIL 599

Query: 521 LAIWLSFQVWFK 532
           +A+++ ++VW K
Sbjct: 600 IALYVFYKVWKK 611

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  291 bits (746), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 167/518 (32%), Positives = 275/518 (53%), Gaps = 19/518 (3%)

Query: 31  EQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXX 90
            Q +  N T  +  E  +E   + + ++ P     +K+ L+ RH                
Sbjct: 132 NQSASSNGT--VREELDLEKSPSADGDAGPHR---LKQGLQSRHVQLIALGGAIGTGLLV 186

Query: 91  XXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSV-----FAQRFLSP 145
                L   GP G  ISY+ +  VIY +  +LGEMV F+P   S S         R++  
Sbjct: 187 GTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDA 246

Query: 146 ALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYY 205
           +LG   G+ Y+  +    A E +    V++YWT AVP   WI IF C++  +N   VK Y
Sbjct: 247 SLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNFSAVKVY 306

Query: 206 GEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGR 265
           GE EF  ASIK++ ++G II SF +  G G     +GFRYW++PG++   +  +  + G 
Sbjct: 307 GESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFAHHL--AGGSLGN 364

Query: 266 FLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGL 324
           F    + +I  AF +  G ELV +T+ E A+ R+ + +A ++ V R++ FY+L    I +
Sbjct: 365 FTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAITV 424

Query: 325 LVPYNDPK----LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIG 380
           +VPYNDP     L        SSP++I I+N+G KVLP I N  +L +  SA N+ ++  
Sbjct: 425 IVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFAS 484

Query: 381 SRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITG 440
           +R L ++++   AP+ L  + R GVPY +V  + +   LA+L VS+ +   FNW  NI+ 
Sbjct: 485 TRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNIST 544

Query: 441 VAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTA 500
           ++GF  W+    +++RF +AI   G+  D LP+K    P+  +++   +++I +  G+  
Sbjct: 545 ISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAI 603

Query: 501 FAPTFQPI-DFVAAYISIFLFLAIWLSFQVWFKCRLLW 537
           F P +  + DF+AAYI++ +FL +WL  +++ +    W
Sbjct: 604 FIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWNHW 641

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  290 bits (741), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 169/502 (33%), Positives = 274/502 (54%), Gaps = 20/502 (3%)

Query: 50  DDAAK----ETESSPQERR--EVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVG 103
           DDA      ET    Q  +  ++K+ +K RH                   P L+ AGP  
Sbjct: 98  DDAISSSISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAA 157

Query: 104 ALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFT 162
            +I Y  MGT +Y + Q+ GE+ V +  +   F+ +    + PALG +  ++Y L W   
Sbjct: 158 LVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCV 217

Query: 163 FALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLG 222
             LEL      I+YWT  V    ++VIF+ L+ ++N F  + Y E EF     KV+ + G
Sbjct: 218 CPLELVTASMTIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTG 277

Query: 223 FIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQG 282
           F I    +  G   +DG +G +YW +PGA+     + DK+  RF G + + + AAF +  
Sbjct: 278 FFILGIIITAGGAGNDGYLGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGA 332

Query: 283 TELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVS 341
           TE + +TA E +NPRKA+P A KKV+ RI+  ++ S+  IG LVPYN D  L S G  + 
Sbjct: 333 TEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIK 392

Query: 342 SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT 401
           +SP++I++ + G +V+P   NAV+L+++LS GNS  Y  SR+L SL++   AP++   V 
Sbjct: 393 ASPYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVD 452

Query: 402 RGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAI 461
           R G P+ ++L +++FG +AF   S    + F+WLL I+G++  F W+ I  SHIRF +A+
Sbjct: 453 REGRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAM 512

Query: 462 RKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISI 517
           + +G S  ++ Y +Q   + + YA+  + L ++ Q + A AP         +F   Y+++
Sbjct: 513 QVQGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAM 572

Query: 518 FLFLAIWLSFQVWFKCRLLWKL 539
            + +A +  ++VW   +  WKL
Sbjct: 573 PILIAFYFGYRVW---KRDWKL 591

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  290 bits (743), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 159/490 (32%), Positives = 268/490 (54%), Gaps = 12/490 (2%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           D   +  +   Q++  +K+ +K RH                     L +AGP G +I Y 
Sbjct: 129 DGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYA 188

Query: 110 FMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELS 168
            MG+ +Y + Q+ GE+ V +  +   F+ +    + PALG +  +++ L W     LEL 
Sbjct: 189 IMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELV 248

Query: 169 VLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
                I+YWT +V    ++VIF+ L+  +N+F  K Y E +F     K++ ++GF I + 
Sbjct: 249 TASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAI 308

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            + CG   +DG IG +YWR+PGA+       D    RF G V++ + AAF +  +E + +
Sbjct: 309 IIDCGGAGTDGYIGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAM 363

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY-NDPKLDSDGIFVSSSPFMI 347
           TA E +NPRKA+P A KK++ RIL  ++ SL  +G LVPY +D  L + G    +SP++I
Sbjct: 364 TASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVI 423

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           ++ + G +V+P   NAV+L+++LS  N   Y  SR+L SL+K   AP+    + R G P 
Sbjct: 424 AVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPA 483

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
            ++L +++FG +AF   S      F WLL I+G++  F W+ I  SHIRF +A++ +G S
Sbjct: 484 AAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRS 543

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVAAYISIFLFLA 522
             ++ YK+Q+  + + YA   + L ++ Q + A AP           F   Y+++ +++A
Sbjct: 544 LGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIA 603

Query: 523 IWLSFQVWFK 532
           +++ ++VW K
Sbjct: 604 LYIFYKVWKK 613

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  287 bits (734), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 169/458 (36%), Positives = 249/458 (54%), Gaps = 16/458 (3%)

Query: 66  VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM 125
           +KR LK RH                     L   GP   +I+++  G+++YSV Q+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 126 VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLA- 184
              +PV+ S+  +  RF+ P+ G    Y Y +    T  LEL      + YW      A 
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD-GPIGF 243
           A++ +F+ ++  +N+F VK YGE EF  + IKV A++GFII    +VCG G SD G IG 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 244 RYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRA 303
           RYW NPG +  G          F G+ +  + +AF++ G+E+  + A E  NPRK LPRA
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 304 IKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFN 362
            K+V  RI +FY++SL  IG LVPY D  L  +  +  S+SPF+I+I  +G K LP + N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 363 AVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFL 422
            V+LI +LS GN  VY  SR + SL+     PR    V R G P   +L  ++FG L+FL
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 423 EVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLA 482
             S+  G+ F+W+L I+G+  FF W  I   H+RF +A+  +G S D+L YKAQ   + +
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 483 YYASFFIALIVLIQGFTAFAP---TFQPIDFVAAYISI 517
            Y    I +++  Q + A  P   +     F +AY+S+
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSL 536

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  288 bits (736), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 165/517 (31%), Positives = 277/517 (53%), Gaps = 17/517 (3%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           S   + + +  +  +E   + + ++ P   R++K+ L+ RH                   
Sbjct: 76  SNGTIHEELVMDVDLEKSPSADGDNEP---RKLKQGLQSRHVQLIALGGAIGTGLLVGTS 132

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSV-----FAQRFLSPALG 148
             L   GP G  ISY+ +  VIY +  +LGEMV F+P   S S         R++  +LG
Sbjct: 133 STLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLG 192

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
              G+ Y+  +    A E +    V++YWT AVP   WI +F  ++  +N   VK YGE 
Sbjct: 193 FATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGES 252

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF  ASIK++ ++G II SF +  G G     +GFRYW++PGA+   +  +  + G F  
Sbjct: 253 EFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHHL--TGGSLGNFTD 310

Query: 269 WVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVP 327
             + +I  AF +  G ELV +T+ E A+ R+ + +A ++ V R++ FY+L    I ++VP
Sbjct: 311 IYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVP 370

Query: 328 YNDP----KLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRV 383
           YNDP     L        SSPF+I I+N+G KVLP I N  +L +  SA N+ ++  +R 
Sbjct: 371 YNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRS 430

Query: 384 LYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAG 443
           L ++++   AP+ L  + R GVPY +V ++ +   LA+L VS+ +   FNW  NI+ ++G
Sbjct: 431 LLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISG 490

Query: 444 FFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
           F  W+    +++RF +AI   G+  D LP+K    P+  +++   +++I +  G+  F P
Sbjct: 491 FLGWICGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIP 549

Query: 504 TFQPI-DFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
            +  + DF+AAY+++ +FL +WL  +++ +    W L
Sbjct: 550 KYWKVADFIAAYVTLPIFLVLWLGHKLYTRTWHQWWL 586

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  287 bits (734), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 185/564 (32%), Positives = 285/564 (50%), Gaps = 31/564 (5%)

Query: 30  DEQYSGENVTKAITTERKVE----DDAAKETESSP--QERREVKRKLKQRHXXXXXXXXX 83
           DE  SG        + R+VE    D    E E       +  +K  LK RH         
Sbjct: 44  DEAGSGSKWQDFKDSFRRVEPVEVDPNLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGA 103

Query: 84  XXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFL 143
                       L   GP   LI +   GT+IYS+  +LGE+    P++  F+ +A RF+
Sbjct: 104 IGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGELAVIFPISGGFTTYATRFI 163

Query: 144 SPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLAAWIVIFWCLLTSMNMFPV 202
             + G  N + Y L W     LE+      + +W T+      ++ +FW ++  +NMF V
Sbjct: 164 DESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLVIVIINMFGV 223

Query: 203 KYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKN 262
           K YGE EF  + IKVI ++GFII    + CG G   G IG +YW +PGA+     + D  
Sbjct: 224 KGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTP 278

Query: 263 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFI 322
             +F G  S  + +AF++ G+ELVG+ A E+ +PRK++P+A K+V  RI +FYILSL  +
Sbjct: 279 GAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMV 338

Query: 323 GLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGS 381
           GLLVPYNDP L  +  +  ++SPF+I+I+  G K LP + N V+LI +LS GNS +Y  S
Sbjct: 339 GLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACS 398

Query: 382 RVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGV 441
           R + +L++    P+  + V R G P   +  TS FG +AF+  S   G  FNWLL ++G+
Sbjct: 399 RTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGL 458

Query: 442 AGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF 501
           +  F W  I   HIRF +A+  +G   D+L +K+    + +Y+  F + ++ + Q + A 
Sbjct: 459 SSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVAL 518

Query: 502 AP---TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIE 558
            P   +     F  AY+S  L +A++L  +++   +  WKL               V +E
Sbjct: 519 FPVGASPSAEGFFEAYLSFPLVVAMYLGHKIY---KRNWKLFIPAEDMDIDTGRREVDLE 575

Query: 559 ------------PECKTRWQRVWD 570
                          K +W R+W+
Sbjct: 576 LLKQEIAEEKAIMATKPKWYRIWN 599

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  287 bits (735), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 161/497 (32%), Positives = 269/497 (54%), Gaps = 14/497 (2%)

Query: 49  EDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISY 108
            D   K    +  +   +K+ ++ RH                     L HAGP G LI Y
Sbjct: 99  NDSTDKINPPAGNKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGY 158

Query: 109 LFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 167
             MG+++Y + Q+ GE+ + +  +T  ++ +    +    G    ++Y L W     LEL
Sbjct: 159 AIMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLEL 218

Query: 168 SVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFS 227
                 I+YWT +V    +++IF+ L+ ++N+F  + Y E EF     K++ + GF I S
Sbjct: 219 VTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILS 278

Query: 228 FCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 287
             +  G   +DG IG +YW +PGA+  G  S D    RF G V++L+ AAF + G+E + 
Sbjct: 279 IIIDVGGAGNDGFIGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIA 333

Query: 288 ITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFM 346
           IT  E +NPRKA+P A K+++ RIL  ++ ++  +G LVPYN D  L S G    +SP++
Sbjct: 334 ITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYV 393

Query: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVP 406
           I+I + G +V+P   NAV+L+++LS  NS+ Y  +R+  +LS+   AP+F S + R G P
Sbjct: 394 IAIASHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRP 453

Query: 407 YFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGI 466
             ++  +++F  +AF   S    + F WLL I+G++  F W  I FSHIRF +A++ +G 
Sbjct: 454 LIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGR 513

Query: 467 SRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISIFLFLA 522
           S  +L +K+Q   + + YA   + LI++ Q + A AP          F   Y+++ + +A
Sbjct: 514 SLGELGFKSQTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIA 573

Query: 523 IWLSFQVWFKCRLLWKL 539
           +++ +++W K    WKL
Sbjct: 574 LYVGYKIWTKD---WKL 587

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  287 bits (735), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 158/484 (32%), Positives = 261/484 (53%), Gaps = 11/484 (2%)

Query: 55  ETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTV 114
            T +   + + +K+ ++ RH                     L +AGP G +I Y  MG++
Sbjct: 119 RTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSI 178

Query: 115 IYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKV 173
           IY + Q+ GEM + +  +   ++V+    +    G    ++Y + W     LEL      
Sbjct: 179 IYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLT 238

Query: 174 IQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCG 233
           I+YWT +V    ++ IF+ L+  +N+F  K Y E EF     KV+ ++GF I S  +  G
Sbjct: 239 IKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAG 298

Query: 234 AGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 293
              +DG +G  YW  PGA+       D +   F G   +L+ AAF Y GTE + +TA E 
Sbjct: 299 GAGNDGYLGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQ 353

Query: 294 ANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENS 352
           +NPR A+P A KKV+ RI+  Y++S+  IG LVP++  +L  SDG   S+SP++++    
Sbjct: 354 SNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLH 413

Query: 353 GTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLS 412
           G +V+P   NAV+LI++LS GNS  Y  SR+L SL++   AP++   + R G P  ++L 
Sbjct: 414 GVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLM 473

Query: 413 TSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLP 472
           +++FG +AF   S    + F WLL I+G++  F W  I  SHIRF  A++ +G S  ++ 
Sbjct: 474 SALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVG 533

Query: 473 YKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISIFLFLAIWLSFQ 528
           Y AQ   + ++YA F + LI + Q + A AP         +F   Y+++ + + ++L ++
Sbjct: 534 YLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYK 593

Query: 529 VWFK 532
           +++K
Sbjct: 594 IYYK 597

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  285 bits (729), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 168/501 (33%), Positives = 269/501 (53%), Gaps = 18/501 (3%)

Query: 49  EDDAAKETESSPQERREVKRKLKQ----RHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGA 104
           +  +  + E   +  R+ + KLKQ    RH                     L + GP G 
Sbjct: 69  DGASGNDVEFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGL 128

Query: 105 LISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTF 163
           +I Y  MG+ +Y + Q+ GE+ V++  ++ +F+ +    +  A G +  ++Y L W    
Sbjct: 129 VIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVL 188

Query: 164 ALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGF 223
            LEL      I+YWT +V    ++ IF+ L+  +NMF  + Y E EF     KV+ ++GF
Sbjct: 189 PLELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGF 248

Query: 224 IIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGT 283
            I    V CG   +DG IG RYW NPGA+        K    F G +S+++ AAF +  T
Sbjct: 249 FILGIIVNCGGAGNDGYIGGRYWNNPGAF-----YGTKPIHHFKGIISTMVTAAFAFGAT 303

Query: 284 ELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVS-S 342
           E + +TA E ANPR+A+P A KKVV RIL+ ++  +  IG LVP+N P+L   G   + +
Sbjct: 304 EFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHA 363

Query: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402
           SP++I++ + G +V+P   NAV+L+++LS GNS  Y  SR+L +L+    AP +L  + R
Sbjct: 364 SPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDR 423

Query: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462
            G P  ++L + VFG ++F+  S      F WLL I+G++  F W+ I  SHIRF +A+ 
Sbjct: 424 SGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALI 483

Query: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISIF 518
            +G    +L YK+Q     +YYA+F +  I++ Q + A AP          F   Y+++ 
Sbjct: 484 VQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALP 543

Query: 519 LFLAIWLSFQVWFKCRLLWKL 539
           LF+ ++  F++W   +  W+L
Sbjct: 544 LFVVLYFGFKIW---KRDWRL 561

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  286 bits (733), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 157/488 (32%), Positives = 267/488 (54%), Gaps = 13/488 (2%)

Query: 51  DAAKETESSPQERRE-VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           D  K++    + ++E +K+ +K RH                     L +AGP G +I Y 
Sbjct: 129 DGIKQSSQEQEPKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYA 188

Query: 110 FMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELS 168
            MG+ +Y + Q+ GE+ V +  +   F+ +    + PA+G +  +++ L W     LEL 
Sbjct: 189 IMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELV 248

Query: 169 VLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
                I+YWT  V    +++IF+ L+  +N+F  K Y E +F     K++ + GF I + 
Sbjct: 249 TASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAI 308

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            + CG   +DG IG RYWR+PGA+       D +  RF G V++ + AAF +  +E + +
Sbjct: 309 IIDCGGAGTDGYIGSRYWRDPGAF-----RGDTSIQRFKGVVATFVTAAFAFGMSEQLAM 363

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY-NDPKLDSDGIFVSSSPFMI 347
           TA E +NPRKA+P A KK++ RIL  ++ SL  +G LVPY +D  L + G    +SP++I
Sbjct: 364 TASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVI 423

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           ++ + G +V+P   NAV+L+++LS  NS  Y  SR+L SL+K   AP+    + R G P 
Sbjct: 424 AVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPA 483

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
            +++ ++VFG +AF   S      F WLL I+G++  F W+ I  SHIRF + ++ +G S
Sbjct: 484 VAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRS 543

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVAAYISIFLFLA 522
             ++ YK+Q+  + + YA   + L ++ Q + A +P           F   Y+++ + +A
Sbjct: 544 LGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIA 603

Query: 523 IWLSFQVW 530
           +++ ++VW
Sbjct: 604 LYIFYKVW 611

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  283 bits (723), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 163/477 (34%), Positives = 262/477 (54%), Gaps = 4/477 (0%)

Query: 57  ESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIY 116
           E+  +  + ++R  KQRH                     L   GP   LI+++F G+++ 
Sbjct: 37  EAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLI 96

Query: 117 SVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQY 176
            V  SL EM +F P+  SFS +A R++ PALG   G+ Y+L +    A ELS +G ++QY
Sbjct: 97  GVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQY 156

Query: 177 WTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQ 236
           W E + +A +IV+F  +L S+N   +K+YGE EF  A +K + L+   +    + CG G 
Sbjct: 157 WREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGP 216

Query: 237 SDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 296
           S   IGFRYWR   A+ P ++      GRFLGW + +I + + Y G+E +G+  GEA NP
Sbjct: 217 SKETIGFRYWREY-AFVPYLVKG--TTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNP 273

Query: 297 RKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTK 355
           +K +P A + V+ RI  FYI+ +  +GL++  +D  L ++     S SPF+I+  N+G K
Sbjct: 274 KKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGIK 333

Query: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSV 415
            LP   NA++++ I SA N+ +Y+ SR  Y L+K+ +AP+      R GVP+   L   +
Sbjct: 334 GLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGL 393

Query: 416 FGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKA 475
              L+F+ +S  S   F +L +   V G   WL +  S+I + +A     + RD +P++ 
Sbjct: 394 ISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRM 453

Query: 476 QMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
              P+ AY   FF++LI+   G++AF   F+   F+ +YI I +F+   L ++ W K
Sbjct: 454 WFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFWKFWKK 510

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  284 bits (726), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 163/497 (32%), Positives = 262/497 (52%), Gaps = 25/497 (5%)

Query: 46  RKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGAL 105
           +K +DD     +       ++K+ +K RH                     LA AGP G +
Sbjct: 44  KKKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLI 103

Query: 106 ISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFA 164
           I Y     ++Y + Q+ GE+ + +  +T +++ ++   + PALG +  ++Y + W   F 
Sbjct: 104 IGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFP 163

Query: 165 LELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFI 224
           L+L      I+YWT+  P   ++ I + L+  +N+F  K Y E EF   + KV+ ++GF+
Sbjct: 164 LQLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFV 222

Query: 225 IFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTE 284
           I    + CG   +DG IG RYW  PGA+  G          F G       AAF Y G E
Sbjct: 223 ILGIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIE 272

Query: 285 LVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSP 344
           ++ +TA E  NPRK++P A KKV+ RIL+ Y+L+   +  LVPY+ P+L S G    +SP
Sbjct: 273 VMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASP 332

Query: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGG 404
           F+I+I + G  V+P I NAV+L+ ++S GNS++Y   R+L SLS+   AP+  + V R G
Sbjct: 333 FVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQG 392

Query: 405 VPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKR 464
            P    L     G LAF+  S      F+WLL I+G++  F W+ I  SH+RF  A++ +
Sbjct: 393 RPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQ 452

Query: 465 GISRDDLPYKAQMMPFLAYYASFF---IALIVLIQGF-TAFAP-----TFQPIDFVAAYI 515
           G S  ++ YK+Q      Y+ S+F   ++L VL+  F  A AP          DF  +Y+
Sbjct: 453 GRSLGEVGYKSQT----GYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYL 508

Query: 516 SIFLFLAIWLSFQVWFK 532
           +  + + I+  +++++K
Sbjct: 509 AAPVLIFIYFGYKIYYK 525

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  284 bits (727), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 161/488 (32%), Positives = 259/488 (53%), Gaps = 11/488 (2%)

Query: 49  EDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISY 108
           +D   +E   +     ++K+ +K RH                     L  AGP   +I+Y
Sbjct: 58  QDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAY 117

Query: 109 LFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 167
             +  V Y + Q+ GEM    P +  +F+ +   F+S   G    +++++ W     LEL
Sbjct: 118 GMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLEL 177

Query: 168 SVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFS 227
                 +QYW +++    ++VIF+  L  ++ F VK YGE EF     K++ + GFIIFS
Sbjct: 178 ITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFS 237

Query: 228 FCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 287
             V  G   + G IG +YW +PGA+     +SD N GRF G    L+ A F+Y G EL  
Sbjct: 238 IVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGMELFA 292

Query: 288 ITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFM 346
           ++  E  NPR++ P A K+ + RI+V Y+L++  +G  VP N  +L  S G    +SP++
Sbjct: 293 LSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYV 352

Query: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVP 406
           ++    G KV+P I NAV+LI+++S GNS +Y   R++ +L++   AP+F+  V R G P
Sbjct: 353 LAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRP 412

Query: 407 YFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGI 466
            F+++  SVFG + F+  S+   + FNWL  I G+A  F W  I  SHIRF QA++ +  
Sbjct: 413 LFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNK 472

Query: 467 SRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP---TFQPID-FVAAYISIFLFLA 522
           S D++ YK+    + +Y+  FF  L+ + Q + A AP   T    D F  +Y++  +F A
Sbjct: 473 SLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAFPIFFA 532

Query: 523 IWLSFQVW 530
            +  + +W
Sbjct: 533 FYFGYMIW 540

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 177/501 (35%), Positives = 270/501 (53%), Gaps = 14/501 (2%)

Query: 45  ERKVEDDAAK-ETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVG 103
           E  V DD +  E  +       +K  LK RH                     L  AGP G
Sbjct: 59  EAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAG 118

Query: 104 ALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTF 163
            LI +   GT+IY +  ++GE+    P++  F+ +A RF+  + G  N + Y L W    
Sbjct: 119 ILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVL 178

Query: 164 ALELSVLGKVIQYW-TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLG 222
            LE+      + YW T+      ++ +FW ++  +N+F VK YGE EF  + IKV+ ++G
Sbjct: 179 PLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIG 238

Query: 223 FIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQG 282
           FII    + CG G   G IG +Y+ +PGA+       D    RF G  S  + AAF++ G
Sbjct: 239 FIIMGIVLNCGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAG 293

Query: 283 TELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVS 341
           +EL+GI A E+A PRK++P+A K+V  RI +FY+LSL  +GLLVPY D +L  +  +  +
Sbjct: 294 SELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAA 353

Query: 342 SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT 401
           +SPF+I+I + G + LP + N V+LI +LS GNS VY  SR L +L++ +  P+    + 
Sbjct: 354 ASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYID 413

Query: 402 RGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAI 461
           R G P F +  TS FG +AF+  S   G+ F WLL ++G++  F W  I F HIRF  A+
Sbjct: 414 RSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAAL 473

Query: 462 RKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTA-FAPTFQPID--FVAAYISIF 518
             +G S D+LP+KA    + + +  F I L+ + Q + A F P  +P    F  +Y+S  
Sbjct: 474 TAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFP 533

Query: 519 LFLAIWLSFQVWFKCRLLWKL 539
           + LA +   +++ +    WKL
Sbjct: 534 VVLAFYFGHKLYARN---WKL 551

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  283 bits (724), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 159/496 (32%), Positives = 262/496 (52%), Gaps = 14/496 (2%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           ++    + +S  E     + L  RH                     L   GP   +I ++
Sbjct: 54  ENVESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWV 113

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
            + T ++++  +LGE+ +  PV   F+V+  RF+ P+ G      Y   W     LEL  
Sbjct: 114 IISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVA 173

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
               I+YW   +   AW+ IF+ ++   N+  VK +GE EF ++ +K++A++GF I    
Sbjct: 174 ASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIV 233

Query: 230 VVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289
           + CG G   G IG +YW NPGA+       + +  RF G  S  + AAF+Y GTEL+ ++
Sbjct: 234 LTCGGGPEGGYIGGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVS 288

Query: 290 AGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSSSPFMI 347
           A E+ NPR  LP+A K+    I V YI+ L  +G LVP +DP+L   S  + V++SP +I
Sbjct: 289 AAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVI 348

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           +IEN G K LP + NA++LI +LS  NS VY  SR + S+++    P+  S V R G P 
Sbjct: 349 AIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPL 408

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
           +++L+T +FG L+F+  S      F WL  ++G++  F W  I+ SHIRF   +++RG S
Sbjct: 409 YAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRS 468

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPI----DFVAAYISIFLFLAI 523
            D+LP+ +    + +YY    I +++++  +TA  P+ + +     F   Y+S  + L  
Sbjct: 469 LDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVC 528

Query: 524 WLSFQVWFKCRLLWKL 539
           ++  +++ K    W+L
Sbjct: 529 YIGHKLYTKS---WRL 541

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  284 bits (726), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 161/516 (31%), Positives = 278/516 (53%), Gaps = 20/516 (3%)

Query: 36  ENVTKAITTERKVEDDAAKETES------SPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
            ++  AI+   +   +  K   S      +  +   +K+ ++ RH               
Sbjct: 80  NDLASAISPSSRQRQELEKNESSDNIGARTGNKSDSLKKTIQPRHVLMIALGTGIGTGLL 139

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALG 148
                 L HAGP G LI Y  MG+++Y + Q+ GEM + +  +T  ++ +    +    G
Sbjct: 140 VGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFG 199

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
               ++Y L W     LEL      I+YWT +V    +++IF+ L+ ++N+F  + Y E 
Sbjct: 200 FAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEA 259

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF     K++ + GF I    +  G   +DG IG +YW +PGA+  G  S D    RF G
Sbjct: 260 EFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFN-GKHSID----RFKG 314

Query: 269 WVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY 328
            V++L+ AAF + G+E + IT  E ANPRKA+P A K+++ RIL  ++ ++  +G LVPY
Sbjct: 315 VVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPY 374

Query: 329 NDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           N  +L  S G    +SP++I++ + G +V+P   NAV+L+++LS  NS+ Y  +R+L +L
Sbjct: 375 NSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTL 434

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           S+   APR  + + + G P  ++  +++FG +AF   S    + F WLL I+G++  F W
Sbjct: 435 SEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTW 494

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQ- 506
             I  SHIRF +A++ +G S  +L +++Q   + + YA   + LI++ Q + A AP  + 
Sbjct: 495 TAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILILIGQFWVAIAPIGEG 554

Query: 507 PID---FVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
            +D   F   Y+++ + +A+++ +++W K    WKL
Sbjct: 555 KLDAQAFFENYLAMPILIALYVGYKIWKKD---WKL 587

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  283 bits (724), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 173/505 (34%), Positives = 275/505 (54%), Gaps = 13/505 (2%)

Query: 40  KAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           K I  E    +    E  +    R  +K  LK RH                     L  A
Sbjct: 61  KRIELEELDPNLTDAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTA 120

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSW 159
           GP G LI +   GT+IYS+  ++GE+    PV+  F+ +A RF+  + G    + Y L W
Sbjct: 121 GPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQW 180

Query: 160 CFTFALELSVLGKVIQYW-TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVI 218
             T  LE+      + YW  +A     ++ +FW     +N+F VK YGE EF  A IKV+
Sbjct: 181 LITLPLEIVSASITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVV 240

Query: 219 ALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 278
            ++GFII +  ++CG G   G IG +YW +PGA+       D    +F G+ +  I A+F
Sbjct: 241 TIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASF 295

Query: 279 TYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDG 337
           ++ G+E+VG+   E+ NPRK++P A K+V  RI +FY+L L  IG+LVPYND +L  +  
Sbjct: 296 SFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASS 355

Query: 338 IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL 397
           +  ++SPF+I++ N G + LP + N V+LI++LS GNS++Y+ SR L +L++    P+ +
Sbjct: 356 VDAAASPFVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIV 415

Query: 398 SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457
           + + R G P  ++   S FG +AF+  S+  G+ FNWLL ++G++  F+W  I   HIRF
Sbjct: 416 AYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRF 475

Query: 458 MQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP---TFQPIDFVAAY 514
            +A+  +G S D+LP+ + +    +Y+  F   L+++ Q +    P   +    DF  AY
Sbjct: 476 RRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAY 535

Query: 515 ISIFLFLAIWLSFQVWFKCRLLWKL 539
           +S  + LA ++  ++W K    WKL
Sbjct: 536 LSFPIVLAFYIFHKIWKKN---WKL 557

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  283 bits (723), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 158/481 (32%), Positives = 253/481 (52%), Gaps = 17/481 (3%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           DD  K   ++ +    + R L  RH                     L   GP   +I++ 
Sbjct: 55  DDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWT 114

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
            + T ++++  +LGE+    PV   F+V+  R + P+LG      Y   W     LEL  
Sbjct: 115 IISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVA 174

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
               I+YW  +V   AW+ +F+  +   ++  VK +GE EF ++ +K++A+ GF I    
Sbjct: 175 ASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIV 234

Query: 230 VVCGAGQSDGPIGFRYWRNPGAW---GPGIISSDKNEGRFLGWVSSLINAAFTYQGTELV 286
           ++CG G  +G IG +YW +PG++    PG         +F G  S  + AAF+Y GTELV
Sbjct: 235 LICGGGPKNGYIGAKYWNDPGSFVGASPG--------SQFKGLCSVFVTAAFSYSGTELV 286

Query: 287 GITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSSSP 344
           G++A E+ANPR  LP+A K+    I + Y+L L  IG LV ++DPKL   S  + V++SP
Sbjct: 287 GVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASP 346

Query: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGG 404
            +I+IEN G + LP + NA++LI I+S  NS+VY  SR + S+++    PR  + +   G
Sbjct: 347 LVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRG 406

Query: 405 VPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKR 464
            P  +++ T VFG L+F+  S    + F WL  ++G++  F WL I+ SHIRF +A+  +
Sbjct: 407 RPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQ 466

Query: 465 GISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP----IDFVAAYISIFLF 520
           G S D+LPY +      ++Y    I L+++   +T+  P          F   Y+S+ +F
Sbjct: 467 GYSLDELPYLSMTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIF 526

Query: 521 L 521
           L
Sbjct: 527 L 527

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  285 bits (728), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 164/518 (31%), Positives = 266/518 (51%), Gaps = 17/518 (3%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           ++D+  + + V    TT   ++D+     +       E+++ +K RH             
Sbjct: 124 YIDDLENKQQVELIGTT---IQDEELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTG 180

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPA 146
                  PLA AGP   +I Y  MGT IY + Q+ GEM V +  +T SF+ F    + P 
Sbjct: 181 LLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPG 240

Query: 147 LGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYG 206
                 ++Y + W     LEL      IQYWT  V    ++VIF+ L+  +N F  K Y 
Sbjct: 241 FNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYA 300

Query: 207 EFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRF 266
           E EF   + KV+ + GF I + C+  GA  +DG IG +YW +PGA+            RF
Sbjct: 301 EAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERF 355

Query: 267 LGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV 326
            G + + + AAF +  TE + +TA E +NPRKA+P A KK++ R+LV ++ ++  IG LV
Sbjct: 356 KGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLV 415

Query: 327 PYN-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLY 385
           PY+ D  L S G    +SP++++I   G +V     NAV+LI+++S GNS  Y  SR+L 
Sbjct: 416 PYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLM 475

Query: 386 SLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFF 445
           SL++   AP+    V R G P  ++  ++V   +AF   S    + F WL+ I G++  F
Sbjct: 476 SLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLF 535

Query: 446 AWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-- 503
            W  I  SH+RF +A++ +G S  ++ Y +Q     + YA+  + L ++ Q + A  P  
Sbjct: 536 TWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMG 595

Query: 504 TFQPI--DFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
           T  P    F + Y+++ + +  +  +++W   +  W+L
Sbjct: 596 THTPDANSFFSNYLAMPILIVFYFGYKIW---KRDWRL 630

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  282 bits (721), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 166/510 (32%), Positives = 263/510 (51%), Gaps = 13/510 (2%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           FVD     E  T       +   D   +  S   + + +K+ +K RH             
Sbjct: 54  FVDSFKRAEGSTTHTKQINENTSDLEGDVNSFTSDSK-LKKSMKSRHVVMMTLGTGIGTG 112

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPA 146
                   L + GP   +I Y  +  V Y + Q+ GEM VT+  + ++F+ ++  F+S  
Sbjct: 113 LLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKP 172

Query: 147 LGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYG 206
            G    ++Y   W     LEL      I++W + +    +I+IF+  L  ++ F VK YG
Sbjct: 173 FGFATVWVYCFQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYG 232

Query: 207 EFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRF 266
           E EF     K++ + GFII S  + CG   +DG IG +YWRNPGA+     + D + GRF
Sbjct: 233 ETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRF 287

Query: 267 LGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV 326
                 L+ A F++ G EL  ++  E ANPRK  P A K+ + RILV Y+L++  IG  V
Sbjct: 288 KNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNV 347

Query: 327 PYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLY 385
           PYND +L  + G    +SP++++    G KV+P I NAV+LI+++S  NS++Y G R++ 
Sbjct: 348 PYNDDQLMGAGGSATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMC 407

Query: 386 SLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFF 445
           SL++    P+FL  V R G P  +++  SVFG + F+  S+     F WL  I G++  F
Sbjct: 408 SLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELF 467

Query: 446 AWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-- 503
            W  I  SH+RF QA++ +G S D+L YKA    + + Y  FF  L+ + Q + A AP  
Sbjct: 468 TWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLN 527

Query: 504 ---TFQPIDFVAAYISIFLFLAIWLSFQVW 530
                    F  +Y++  +++A +L + ++
Sbjct: 528 NGGKCSAESFFQSYLAFPIWIAFYLGYMIY 557

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  283 bits (723), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 160/516 (31%), Positives = 274/516 (53%), Gaps = 20/516 (3%)

Query: 36  ENVTKAIT-TERKVEDDAAKETES-----SPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
            ++T AI+ + R+  +    ET       +  +   +K+ ++ RH               
Sbjct: 80  NDLTSAISPSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLL 139

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALG 148
                 L HAGP G LI Y  MG+++Y + Q+ GEM + +  +T  ++ +    +    G
Sbjct: 140 VGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFG 199

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
               ++Y L W     LEL      I+YWT +V    +++IF+ L+ ++N+F  + Y E 
Sbjct: 200 FAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEA 259

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF     K++ + GF I    +  G   +DG IG +YW  PGA+  G+ + D    RF G
Sbjct: 260 EFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFN-GVHAID----RFKG 314

Query: 269 WVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY 328
            V++L+ AAF + G+E + IT  E +NPRKA+P A K+++ RIL  ++ ++  +G LVPY
Sbjct: 315 VVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPY 374

Query: 329 N-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           N D  L S G    +SP++I+I + G +V P   NAV+L+++LS  NS+ Y  +R+  +L
Sbjct: 375 NSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTL 434

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           S+   AP+  S + R G P  ++  +++F  +AF   S    + F WLL I+G++  F W
Sbjct: 435 SEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTW 494

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP---- 503
             I  SHIRF +A++ +G S  +L +K+Q   + + Y+   + LI++ Q + A AP    
Sbjct: 495 TAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEG 554

Query: 504 TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
                 F   Y+++ + + +++ +++W K    WKL
Sbjct: 555 KLDAQAFFENYLAMPILIVLYVGYKMWNKD---WKL 587

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  281 bits (719), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 163/517 (31%), Positives = 271/517 (52%), Gaps = 12/517 (2%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           +E +S E   K +  E+   D    E      +  ++ + L  RH               
Sbjct: 28  EETWSVEKQLKPLAEEKDYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLF 87

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 L+  GP   +I++  + T ++++  SLGE+    PV   F+V+  RF+ P+ G 
Sbjct: 88  VNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGF 147

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
              + Y   W     LEL      I+YW +++   AW+ IF+  +   NM  VK +GE E
Sbjct: 148 AVNFNYLAQWAILLPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETE 207

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F ++ +K++A++GF I    ++CG G S G IG +YW +PGA+       D    RF G 
Sbjct: 208 FVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAF-----VGDTPAQRFKGL 262

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
            +  I AAF+Y G ELVG++A E+ NPR  LP+A K+    I + Y++ L  IG LVP N
Sbjct: 263 SAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSN 322

Query: 330 DPKL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           DP L   +  +  ++SP +I+I+N G K LP + NA++LI +LS  NS VY  SR + S+
Sbjct: 323 DPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISM 382

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           ++    PR L++V + G P +++  T + G L+F+  S    + F WL  ++G++  F W
Sbjct: 383 AEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCW 442

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT--- 504
             I+ +H+RF  A++ +  S ++LPY +    + ++Y    I L+++   +T+  P    
Sbjct: 443 FAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGN 502

Query: 505 -FQPIDFVAAYISIFLFLAIWLSFQVWFK-CRLLWKL 539
                 F  +Y+S+ +F+A +L  ++W +  RL  KL
Sbjct: 503 GADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKL 539

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  281 bits (720), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 158/505 (31%), Positives = 259/505 (51%), Gaps = 16/505 (3%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           S EN+   +      E++       S     ++ + L  RH                   
Sbjct: 61  SKENIKSDVPHVSDFENNVYDTANDS-----KLNKDLSVRHLLTLAVGGAIGTGLFVNSG 115

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
             L   GP   +++++ + T ++++  +LGE+    PV   F+V+  RF+ P+ G     
Sbjct: 116 ASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNI 175

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
            Y   W     LEL      I+YW   +   AW+ IF+  +   NM  VK +GE EF ++
Sbjct: 176 NYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLS 235

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
            IK++A++GF I    + CG G S   IG RYW +PGA+       D    RF G  +  
Sbjct: 236 MIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF-----VGDTPGRRFKGVCAVF 290

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           + AAF+Y GTELV ++A E+ NPR  LP+A K+    I + YI  L  IG LVPYND +L
Sbjct: 291 VTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERL 350

Query: 334 --DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNS 391
              +  +  ++SP +I+IEN G K LP + NA++LI ILS  NS VY  SR + ++++  
Sbjct: 351 LNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIG 410

Query: 392 LAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLIS 451
             P+ L+ + + G P +++ +T +FG L+F+  S    + F WL  ++G++  F W  I+
Sbjct: 411 NLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSIN 470

Query: 452 FSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----FQP 507
            SHIRF QA++ +  S ++LP+ +    + ++Y    I L+++   +T+  P        
Sbjct: 471 LSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADA 530

Query: 508 IDFVAAYISIFLFLAIWLSFQVWFK 532
             F   Y+S+ +F+  +L  +V+ K
Sbjct: 531 ESFFEGYLSLPIFIVCYLGHKVYKK 555

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 159/516 (30%), Positives = 273/516 (52%), Gaps = 20/516 (3%)

Query: 36  ENVTKAITTERKVEDDAAKETES------SPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
            ++T AI+   +   +  K   S      +  +   +K+ ++ RH               
Sbjct: 80  NDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLL 139

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALG 148
                 L HAGP G LI Y  MG+++Y + Q+ GEM + +  +T  ++ +    +    G
Sbjct: 140 VGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFG 199

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
               ++Y L W     LEL      I+YWT +V    +++IF+ L+ ++N+F  + Y E 
Sbjct: 200 FAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEA 259

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF     K++ + GF I    +  G   +DG IG +YW +PGA+  G  + D    RF G
Sbjct: 260 EFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFN-GKHAID----RFKG 314

Query: 269 WVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY 328
             ++L+ AAF + G+E + IT  E +NPRKA+P A K+++ RIL  ++ ++  +G LVPY
Sbjct: 315 VAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPY 374

Query: 329 N-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           N D  L S G    +SP++I++ + G +V+P   NAV+L+++LS  NS+ Y  +R+  +L
Sbjct: 375 NSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTL 434

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           S+   AP+  S + R G P  ++  +++F  +AF   S    + F WLL I+G++  F W
Sbjct: 435 SEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTW 494

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP---- 503
             I  SH+RF +A++ +G S  +L +K+Q   + + YA   + LI++ Q + A AP    
Sbjct: 495 TAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIGEG 554

Query: 504 TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
                 F   Y+++ + +A+++ ++VW K    WKL
Sbjct: 555 KLDAQAFFENYLAMPILIALYVGYKVWHKD---WKL 587

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  282 bits (722), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 167/502 (33%), Positives = 272/502 (54%), Gaps = 12/502 (2%)

Query: 38  VTKAITTERKVEDDAAKETESSPQERRE-VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPL 96
           V+ A  ++ K   D+    E   + + E +K+ +K RH                     L
Sbjct: 96  VSPATLSDYKKSGDSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKAL 155

Query: 97  AHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMY 155
             AGP G  I Y  MG+ IY + Q+ GEM VT+  +   F+ +    +SP LG    ++Y
Sbjct: 156 NDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVY 215

Query: 156 WLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASI 215
           WL W     LEL      I+YWT  V    ++VIF+ L+  +N+F  + Y E EF     
Sbjct: 216 WLQWACVCPLELVTASMTIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCC 275

Query: 216 KVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLIN 275
           KV+ + GF I    + CG   +DG IG +YW +PGA+       DK   RF G  ++L+ 
Sbjct: 276 KVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVT 330

Query: 276 AAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLD 334
           AAF + G+E + +TA E +NPRKA+P A KK++ RI++ ++ S+  +G LVP+N D  + 
Sbjct: 331 AAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMG 390

Query: 335 SDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAP 394
           SD     +SP++I+I + G +V+P   NAV+L+++LS GNS  Y  SR+L SLS+   AP
Sbjct: 391 SDSSKTKASPYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAP 450

Query: 395 RFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSH 454
           +F + + R G P  +++  ++F  +AF   S+     F WLL I+G++  F W  I  SH
Sbjct: 451 KFFNYIDREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSH 510

Query: 455 IRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDF 510
           IRF +A+  +G S  ++ +K+++  + +YYA+  + L+++ Q +   AP          F
Sbjct: 511 IRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSF 570

Query: 511 VAAYISIFLFLAIWLSFQVWFK 532
             +Y+++ + +A ++ +  W K
Sbjct: 571 FESYLAMLMLIAFYVGYMFWKK 592

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  281 bits (719), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/489 (32%), Positives = 262/489 (53%), Gaps = 20/489 (4%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D+ K       +   +KR LK RH                     +A  GP+  +I +  
Sbjct: 70  DSFKPPLDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAI 129

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
            G+ I      LGE+    PV  +F+ ++ RFL P+L      +Y + W F   LE+   
Sbjct: 130 AGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISS 189

Query: 171 GKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCV 230
              +QYW +++    W+ IF+C + S+N+F  + +GE EF  +S+KV+ + GFII    +
Sbjct: 190 AMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVL 249

Query: 231 VCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITA 290
           +CG G     +G +YW +PG    G          F G +S L+ A+++  GTE+V + +
Sbjct: 250 ICGGGPDHDFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLAS 299

Query: 291 GEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIE 350
           GE  +P K LP AIK+   RIL F+++SL  IG LVPY +  L   G  V++SPF+I+I+
Sbjct: 300 GET-DP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENL-LGGSSVNNSPFVIAIK 356

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
               KVLP I NAV+LI+ILS GNS ++  SR L S++   L PRF   + R G P   +
Sbjct: 357 LHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGI 416

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
           ++ S+FG LAFL  S+   + F+WL+ I G+A    WL I+ SHIRF  A++ +G S D+
Sbjct: 417 ITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDE 476

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-------TFQPIDFVAAYISIFLFLAI 523
           L + + +  + + Y++   +LI++ Q + A  P       + +   F  +Y+   + + +
Sbjct: 477 LEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVL 536

Query: 524 WLSFQVWFK 532
           ++  +++++
Sbjct: 537 FVGHKIFYR 545

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  281 bits (719), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 165/512 (32%), Positives = 268/512 (52%), Gaps = 14/512 (2%)

Query: 30  DEQYSGENVTKAITTERKVEDD-AAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXX 88
           D Q    ++   I + ++ +D     + E +    +E K+ +K RH              
Sbjct: 56  DVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGL 115

Query: 89  XXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPAL 147
                  L+ AGP   +I+Y  +  V Y + Q+ GEM VT+  +  SF+ +   F+S   
Sbjct: 116 LVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPF 175

Query: 148 GATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGE 207
           G    +++ + W     LEL      I+YW  ++    +++IF+  L  ++ F V+ YGE
Sbjct: 176 GFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGE 235

Query: 208 FEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFL 267
            EF   + K++ + GFIIF+  V CG    DG IG +YW +PGA+     +S     RF 
Sbjct: 236 TEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFK 290

Query: 268 GWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVP 327
           G   +L+NA F+Y G EL  ++  +  NPRK+ P A K  V RI+V Y+L++  IG +VP
Sbjct: 291 GICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVP 350

Query: 328 YNDPKL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLY 385
           +N  +L   S G  + +SP++++    G KV+P I NAV+LI ++S  NS++Y G R+L 
Sbjct: 351 HNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLS 410

Query: 386 SLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFF 445
           SL++   APRFLS V R G P  ++L +++ G + F   S    + F WL  I+G++  F
Sbjct: 411 SLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELF 470

Query: 446 AWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-- 503
            W  I FSHIRF +A++ +  S D L YKA    + +Y+   F  L+   Q + A +P  
Sbjct: 471 TWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN 530

Query: 504 ---TFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
                    F A+Y+++ ++L  +  +  W+K
Sbjct: 531 SGGKCDANSFFASYLAMPIWLVFYFGYMCWYK 562

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  281 bits (719), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 157/516 (30%), Positives = 269/516 (52%), Gaps = 20/516 (3%)

Query: 32  QYSGENVTKAITTERKVEDDAAKETESSPQER---------REVKRKLKQRHXXXXXXXX 82
           + S +N+T  +T  +  E  + K  E++P E+           + + L  RH        
Sbjct: 49  EKSSDNMTTYVTDSKTKEGGSEKNIETTPSEQFSIAKEDINENLNKDLSIRHLITLAVGG 108

Query: 83  XXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRF 142
                        LA  GP   +I ++ + T +++V  +LGE+    PV   F+V+  RF
Sbjct: 109 SIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRF 168

Query: 143 LSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPV 202
           + P++       Y   W     LEL      I+YW + +   AW+ IF+ ++   NM  V
Sbjct: 169 VDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDV 228

Query: 203 KYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKN 262
           K +GE EF ++ +K++A++GF I    + CG G   G +G  YW +PG++       DK 
Sbjct: 229 KSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSF-----VGDKP 283

Query: 263 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFI 322
             +F G  S  + AAF+Y G EL  ++A E+ +PRK +P+A K+    +   Y+  L  I
Sbjct: 284 GTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTII 343

Query: 323 GLLVPYNDPKL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIG 380
           G LVP++DP+L   S  +  ++SP +ISI+N+G K L  + NA++LI+I+S  NS VY  
Sbjct: 344 GCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYAC 403

Query: 381 SRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITG 440
           SR + S++     P+ LS V + G P  ++LST  FG L+F+  S    + F WL  ++G
Sbjct: 404 SRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSG 463

Query: 441 VAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTA 500
           ++  F W+ I++SHIRF  A++ +  + D+LPY +Q     ++Y    + L+++   +T+
Sbjct: 464 LSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTS 523

Query: 501 FAP----TFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
             P    T     F   Y+S+ + +A ++  +++ +
Sbjct: 524 LFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVR 559

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  281 bits (719), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 166/503 (33%), Positives = 260/503 (51%), Gaps = 9/503 (1%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           F D     E  T       +   D     ES   + + +K+ +K RH             
Sbjct: 54  FADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSK-LKKSMKSRHVVMMSLGTGIGTG 112

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPA 146
                   L + GP   +I Y+ +  V Y + Q+ GEM VT+  + ++F+ ++  F+S +
Sbjct: 113 LLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKS 172

Query: 147 LGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYG 206
            G    ++Y   W     LEL      IQ+W + +    +I+IF+  L  ++ F VK YG
Sbjct: 173 FGFATVWLYCFQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYG 232

Query: 207 EFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRF 266
           E EF     K++ + GFII S  + CG   +DG IG  YW NPGA+     + D + GRF
Sbjct: 233 ETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRF 287

Query: 267 LGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV 326
                 L+ A F++ G EL  ++  E +NPRK+ P A K+ + RI+V Y+L++  IG  V
Sbjct: 288 KNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNV 347

Query: 327 PYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLY 385
           PYND +L  + G    +SP++++    G K++P I NAV+LI+++S  NS++Y G R++ 
Sbjct: 348 PYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLIC 407

Query: 386 SLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFF 445
           SL++   AP+FL  V R G P  +++   VFG +AF+  S+     F WL  I G++  F
Sbjct: 408 SLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELF 467

Query: 446 AWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTF 505
            W  I  SH+RF QA++ +G S D+L YKA    + + Y  FF  L+ + Q + A AP  
Sbjct: 468 TWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLG 527

Query: 506 QPIDFVA-AYISIFLFLAIWLSF 527
                 A ++   +L   IWL+F
Sbjct: 528 NGGKCDAESFFQNYLAFPIWLAF 550

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  282 bits (721), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 164/504 (32%), Positives = 269/504 (53%), Gaps = 13/504 (2%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
            ++TK      +  +D  +  E + +   E+K  +K RH                     
Sbjct: 94  HDLTKTFEGTLEPSEDGTQPAEVAGKSE-ELKHSIKPRHVIMISLGTGIGTGMLVGNGTS 152

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYM 154
           LA++GP G +I Y  MG+ IY + Q+ GEM V +  +   F+ +    + PALG +  ++
Sbjct: 153 LANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWV 212

Query: 155 YWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP-VKYYGEFEFCIA 213
           Y + W     LEL      I+YWT  V    ++VIF+ L+  +N+      Y E EF   
Sbjct: 213 YCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFN 272

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
           S K++ LLGF I    ++CG    DG IG RYW +PGA+       +    RF G VS+L
Sbjct: 273 SCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAF-----RGEHAIDRFKGVVSTL 327

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPK 332
           +NAAF +  +E++G+TA E +NPRKA+P A KK++ RI+  Y+ S+  +G LVP+N D  
Sbjct: 328 VNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQL 387

Query: 333 LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392
           L S G  V +SP+++++   G +V+P   NAV+L+++LS  NS  Y  SR+L  L++   
Sbjct: 388 LGSSGGGVKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGY 447

Query: 393 APRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISF 452
           AP+    V R G P   +   ++   ++F   S    + F WLL I+G++  F W  I  
Sbjct: 448 APKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICL 507

Query: 453 SHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP-ID-- 509
           SHIRF +A+  +G S  ++ +K+Q   + ++YA   + LI++ Q + A AP  +  +D  
Sbjct: 508 SHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQ 567

Query: 510 -FVAAYISIFLFLAIWLSFQVWFK 532
            F   Y++  + +A++  ++++ K
Sbjct: 568 AFFENYLAAPILIALYFGYKIYTK 591

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  281 bits (719), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 159/514 (30%), Positives = 274/514 (53%), Gaps = 26/514 (5%)

Query: 44  TERKVEDD---------AAKETESSP---QERREVKRKLKQRHXXXXXXXXXXXXXXXXX 91
           T R +E++         A K+ + +P   ++   +++ +K RH                 
Sbjct: 97  TNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVG 156

Query: 92  XXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGAT 150
               L  AGP G +I Y  MG+ +Y + Q+ GEM V +  +  +F+ +    +  A G +
Sbjct: 157 NGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFS 216

Query: 151 NGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEF 210
             ++Y L W     LEL      IQYWT  V    ++VIF+ L+  +N+F  K Y E EF
Sbjct: 217 VAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEF 276

Query: 211 CIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWV 270
              S KV+ + GF I +  +  G   +DG IG +YW NPGA+       DK+  RF   +
Sbjct: 277 FFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVM 331

Query: 271 SSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYND 330
           S+   AAF +  +E + I A E +NPR+A+P A K ++ RIL  ++ S+  +G LVPYN 
Sbjct: 332 STFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNS 391

Query: 331 PKLDSDGIFVS-SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
            +L   G   + +SP++I++ + G +V+P   NAV+L+++LS  NS  Y   R+LYSLS+
Sbjct: 392 TELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQ 451

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
              AP + + + R G P  +++ +++F  +AF   S+     F WLL I+G++  F W+ 
Sbjct: 452 QGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIA 511

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TF 505
           I  SHIRF +A++ +G S D++ +K+Q+  + + YA+  + L ++ + + + AP      
Sbjct: 512 ICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHL 571

Query: 506 QPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
              +F   Y+++ + + ++  +++   C+  WKL
Sbjct: 572 DAQNFFENYLAMPILIVLYFGYKI---CKRDWKL 602

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  281 bits (718), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/523 (31%), Positives = 270/523 (51%), Gaps = 25/523 (4%)

Query: 30  DEQYSG---------ENVTKAITTERKVEDDAAKETESS----PQERREVKRKLKQRHXX 76
           DE+Y+          ++  +A      +  +A  E   S    P++   +KR +K RH  
Sbjct: 53  DEEYAAKSSVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLPEKGASLKRDIKPRHVV 112

Query: 77  XXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-VTSSF 135
                              LA  GP G  I Y  MG+ +YS+ Q+ GE+    P +T +F
Sbjct: 113 MMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNF 172

Query: 136 SVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLT 195
           + +    + PA+      +Y + W   F LE+      I+YW  ++    W VIF+ ++ 
Sbjct: 173 NNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVMII 232

Query: 196 SMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPG 255
            +NM     Y E +F   + K++   GF I    + CG       IG +YW +PGA+   
Sbjct: 233 GINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAF--- 289

Query: 256 IISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFY 315
             + D    RF   VS+L+ AAF +  +E V +TA E ANPRKA+P A K+V+ RI+  Y
Sbjct: 290 --NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIY 347

Query: 316 ILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGN 374
           + S+  +G LVPYN P+L  S    V SSP++I++ + G KV+P   NAV+LI++LS GN
Sbjct: 348 LASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVGN 407

Query: 375 SNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNW 434
            + Y  SR+L  LS+   AP+F   V R G P ++++  ++ G + F+  S+     F W
Sbjct: 408 FSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTW 467

Query: 435 LLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVL 494
           L+ ++G++  F W  I  SH+RF +A++ +  S  +L +++Q+  + +YY  F + L+ +
Sbjct: 468 LMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFI 527

Query: 495 IQGFTAFAPT-----FQPIDFVAAYISIFLFLAIWLSFQVWFK 532
            Q + A  P          +F A Y+++ +FLA++  F++W K
Sbjct: 528 GQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKK 570

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  279 bits (713), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 159/532 (29%), Positives = 274/532 (51%), Gaps = 27/532 (5%)

Query: 29  VDEQYSGENVTKAITTERKV-EDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           V ++    N+   ++ E+ +   +   E+ +     R +K  L+ RH             
Sbjct: 18  VYDKNDKNNIKDGVSFEKPIIYSEVDIESGAKESSSRNLKHGLQSRHIQLIALGGTIGTG 77

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSS-------FSVFAQ 140
                   LA+ GP   +ISY+ + T++Y +    GEMV ++P            +    
Sbjct: 78  LFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESVGYCAYLVS 137

Query: 141 RFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMF 200
           +++  +LG    + Y+  +    A E +    +++YWT  +P A  I +F  ++  +N  
Sbjct: 138 KYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAVLIFLFLGVIFLLNFL 197

Query: 201 PVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAG---QSDGPIGFRYWRNPGAWGPGII 257
           PVK+YGE EF  A IK+  + G II +F + CG     + +  +GF YW+NP ++   + 
Sbjct: 198 PVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYV- 256

Query: 258 SSDKNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYI 316
            ++ + G FL   ++LI  AF +  G ELV +T+ E  + R+ + +A ++ V R++ FYI
Sbjct: 257 -TNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYI 315

Query: 317 LSLFFIGLLVPYNDPKL------DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITIL 370
                I ++VPYNDP L      +  G    SSPF+I I+N+G  +LP I N  +L + +
Sbjct: 316 FGALSISVIVPYNDPTLLNALALNKPG--AGSSPFVIGIQNAGITILPHIINFCILTSAM 373

Query: 371 SAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGK 430
           SAGN+ ++  +R L ++ KN  APR  S + R GVPY ++  + +   LAFL  SA S K
Sbjct: 374 SAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNCSASSAK 433

Query: 431 AFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIA 490
            F W  NI+ ++GF  W     +++RF + I   G+  D LP+K +   +L +Y+  F+ 
Sbjct: 434 VFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVG 492

Query: 491 LIVLIQGFTAFAPTF-QPIDFVAAYISIFLFLAIWLSFQVW---FKCRLLWK 538
           +++L  G+    P F    DF+AAYI++ +FL ++    ++   ++ R  WK
Sbjct: 493 ILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIYSGRWRQRKWWK 544

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  279 bits (714), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 180/562 (32%), Positives = 285/562 (50%), Gaps = 25/562 (4%)

Query: 29  VDEQYSG---ENVTKAITTERKVEDD---AAKETESSPQERREVKRKLKQRHXXXXXXXX 82
           +DE  SG   ++   +    + +E D   +  E  +    +  +K  LK RH        
Sbjct: 43  IDETGSGSKWQDFKDSFKRVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGG 102

Query: 83  XXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRF 142
                        L   GP   LI +   GT+IY++  +LGE+    P++  F+ +A RF
Sbjct: 103 AIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRF 162

Query: 143 LSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLAAWIVIFWCLLTSMNMFP 201
           +  + G  N + Y L W     LE+      + +W T+      ++ +FW  +  +NMF 
Sbjct: 163 IDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFG 222

Query: 202 VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDK 261
           VK YGE EF  + IKVI ++GFII    + CG G + G IG +YW +PGA+     + D 
Sbjct: 223 VKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAF-----AGDT 277

Query: 262 NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFF 321
              +F G  S  + AAF++ G+ELVG+ A E+  PRK++P+A K+V  RI +FYILSL  
Sbjct: 278 PGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLM 337

Query: 322 IGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIG 380
           IGLLVPYND  L  +  +  ++SPF+I+I+  G K LP + N V+LI +LS GNS +Y  
Sbjct: 338 IGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYAC 397

Query: 381 SRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITG 440
           SR + +L++    P   S V R G P   +  TS FG +AF+  S   G+ FNWLL ++G
Sbjct: 398 SRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSG 457

Query: 441 VAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTA 500
           ++  F W  I   HIRF +A+  +G   D+L +K+    + +Y+  F + ++ + Q + A
Sbjct: 458 LSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVA 517

Query: 501 FAPTFQPID---FVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWI 557
             P         F  AY+S  L + +++  +++ +   L+               +L  +
Sbjct: 518 VFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLL 577

Query: 558 EPE---------CKTRWQRVWD 570
           + E          K RW R+W+
Sbjct: 578 KQEIAEEKAIMATKPRWYRIWN 599

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  281 bits (719), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 169/517 (32%), Positives = 263/517 (50%), Gaps = 22/517 (4%)

Query: 31  EQYSGENVTKAITTER---KVEDD----AAKETESSPQERREVKRKLKQ----RHXXXXX 79
           E YS +     +  ++    + DD    A    +S P E+++   +LKQ    RH     
Sbjct: 104 ENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMS 163

Query: 80  XXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVF 138
                          PLA AGP   +I Y  MGT +Y + Q+ GE+ V +  V  SF+ F
Sbjct: 164 LGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTF 223

Query: 139 AQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMN 198
               + P       ++Y + W     LEL      I+YWT  V    ++VIF+ L+  +N
Sbjct: 224 PSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLIN 283

Query: 199 MFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIIS 258
            F  K Y E EF     KV+ ++GF I + C+  GA  +DG IG +YW +PGA+      
Sbjct: 284 FFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAF-----R 338

Query: 259 SDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILS 318
                 RF G + + + AAF +  TE + +TA E +NPRKA+P A KKV  RIL+ ++ S
Sbjct: 339 GQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTS 398

Query: 319 LFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNV 377
           +  IG LVPYN D  + S     S+SP++++    G  V+    NAV+L+++LS  NS  
Sbjct: 399 IILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAF 458

Query: 378 YIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLN 437
           Y  SR+L  L++   AP++   V R G P  S+L  ++   +AF   S      F WLL 
Sbjct: 459 YSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLA 518

Query: 438 ITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQG 497
           I+G++  F W  I  SHIRF + ++ +G S  +L ++AQ     +YYA+  + L ++ Q 
Sbjct: 519 ISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQF 578

Query: 498 FTAFAP----TFQPIDFVAAYISIFLFLAIWLSFQVW 530
           + A  P    T    +F   Y+++ + LA+++ F++W
Sbjct: 579 WVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLW 615

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  278 bits (712), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 160/489 (32%), Positives = 262/489 (53%), Gaps = 11/489 (2%)

Query: 48  VEDDAAKETESSPQE-RREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           VED+ +   E S +   R +K+ +K RH                     L++ GP   +I
Sbjct: 47  VEDEKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVI 106

Query: 107 SYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
            Y+ +  V Y + Q+ GEM VT+  +  SF+ +   F+S  +G    +++ + W     L
Sbjct: 107 GYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPL 166

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           EL      IQYW +++    WIVIF+  L  +++F VK YGE EF   + K++ + GFII
Sbjct: 167 ELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFII 226

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTEL 285
           FS  V  G   +DG IG +YW+NPG++     +S  + GRF      L+ A F+Y GTEL
Sbjct: 227 FSIVVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTEL 281

Query: 286 VGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY-NDPKLDSDGIFVSSSP 344
             ++  E ANPR++ P+A K+ + RIL+ Y+L++  IG  VP+ ND  + + G    +SP
Sbjct: 282 YVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASP 341

Query: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGG 404
           ++++    G KV+P I NAV+LI + S GNS++Y   R+  SL++   AP+ L+ + R G
Sbjct: 342 YVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREG 401

Query: 405 VPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKR 464
            P  ++ + +V G +AF   S+   + F WL  I  ++  F W  I  SHIRF  A++ +
Sbjct: 402 RPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQ 461

Query: 465 GISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP---TFQPIDFVAAYISIFLFL 521
           G   ++L YKA    + + +   F  L+ + Q + A +P   T     F  +Y++  L+L
Sbjct: 462 GKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWL 521

Query: 522 AIWLSFQVW 530
             + ++ +W
Sbjct: 522 FFYFAYMLW 530

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  278 bits (712), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 179/495 (36%), Positives = 270/495 (54%), Gaps = 18/495 (3%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           +  A  T +SP     +KR LK RH                     L  AGP G LI + 
Sbjct: 66  EKIAIATANSP-----LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWA 120

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
             GT+IY +  ++GE+    PV+  F+ +A RF+  + G  N + Y L W     LE+  
Sbjct: 121 LTGTMIYCMVMAMGELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVA 180

Query: 170 LGKVIQYW-TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
               + YW T+      ++ +F+ ++ S+NMF VK YGE EF  + IKVI ++GFII   
Sbjct: 181 ASITVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGI 240

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            +VCG G   G IG   W NPGA+       +    RF G  S  + AAF++ G+ELVG+
Sbjct: 241 ILVCGGGPVGGYIGGANWHNPGAF-----VGNTAGKRFKGVCSVFVTAAFSFAGSELVGL 295

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMI 347
            + E ANPRK+LPRA K+V  RI +FYI+SL  IGLLVPYND +L  +  +  ++SPF++
Sbjct: 296 ASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVL 355

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           +I+N G K LP + N V+LI +LS GNS V+  SR L +L++    P+    + R G P 
Sbjct: 356 AIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPL 415

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
             +  TS FG L+F+  S   G+ F+WLL ++G++  F W+ I   H+RF +A+  +G S
Sbjct: 416 VGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRS 475

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP---IDFVAAYISIFLFLAIW 524
            D+L + +    + + Y +  I LI+  Q + A  P   P    DF  +Y+S+ + L ++
Sbjct: 476 TDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMY 535

Query: 525 LSFQVWFKCRLLWKL 539
           +  + +   +  WKL
Sbjct: 536 IGHKCY---KRNWKL 547

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  277 bits (709), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 164/473 (34%), Positives = 257/473 (54%), Gaps = 10/473 (2%)

Query: 63  RREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSL 122
           +  +K  LK RH                     L   GP   LI +   GT+IY++  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 123 GEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAV 181
           GE+    P++  F+ +A RF+  + G  N + Y L W     LE+      + +W T+  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
               ++ +FW ++  +NMF VK YGE EF  + IKVI ++GFII    + CG G   G I
Sbjct: 203 YRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           G +YW +PGA+     + D    +F G  S  + +AF++ G+ELVG+ A E+  PRK++P
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVP 317

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDI 360
           +A K+V  RI +FYILSL  IGLLVPYND  L  +  +  ++SPF+I+I+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA 420
            N V+LI +LS GNS +Y  SR + +L++    P+  + V R G P   +  TS FG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 421 FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF 480
           F+  S   G  FNWLL ++G++  F W  I   HIRF +A+  +G   D+L +K+    +
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 481 LAYYASFFIALIVLIQGFTAFAP---TFQPIDFVAAYISIFLFLAIWLSFQVW 530
            +Y+  F + ++ + Q + A  P   +     F  AY+S  L +A+++  +++
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIY 550

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  278 bits (712), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 170/496 (34%), Positives = 259/496 (52%), Gaps = 17/496 (3%)

Query: 51  DAAKETE----SSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           DA+++ E    +S +   + K+ +K RH                     L   GP G LI
Sbjct: 63  DASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLI 122

Query: 107 SYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
            Y  +  V Y + Q+ GEM    P +  +F+V++  F+S + G    ++Y L W     L
Sbjct: 123 GYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPL 182

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           EL      I+YW  ++   A+I IF+ ++  ++ F    YGE EF  ++ KV  + GFII
Sbjct: 183 ELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFII 242

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTEL 285
            S  + CG   + G IG  YWRNPGA+  G        G F G    L+ A F+Y G EL
Sbjct: 243 LSIVINCGGAGTGGYIGGEYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYGGMEL 297

Query: 286 VGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSSS 343
             +T  E ANPRKA+P A KK + RIL+ Y+L++  IG LVPYN  +L   S      +S
Sbjct: 298 FALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHAS 357

Query: 344 PFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRG 403
           P++I++ + G KV+P I NAV+LI+++S GNS +Y   R+L SL++   AP+  S V R 
Sbjct: 358 PYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRA 417

Query: 404 GVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRK 463
           G P  +++  S+FG L+F+  S    + F WL  I G++  F W  I  SH+RF  A++ 
Sbjct: 418 GRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKY 477

Query: 464 RGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAI 523
           +G S  +L YK++   + + YA FF  ++ + Q + A AP        A       F   
Sbjct: 478 QGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAE-----AFFQS 532

Query: 524 WLSFQVWFKCRLLWKL 539
           +L+F +W  C + +K+
Sbjct: 533 YLAFPIWISCYVGYKI 548

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  278 bits (710), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 161/492 (32%), Positives = 259/492 (52%), Gaps = 10/492 (2%)

Query: 41  AITTERKVEDDAAKETE--SSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAH 98
           +IT  R++ ++ +   +   S     ++K+ +K RH                     L +
Sbjct: 64  SITKTRQINENTSDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHY 123

Query: 99  AGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWL 157
            GP   +I Y+ +  V Y + Q+ GEM VT+  + ++F+ ++  F+S   G    ++Y  
Sbjct: 124 GGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCF 183

Query: 158 SWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKV 217
            W     LEL      IQYW + +    +I+IF+  L  +++F VK YGE EF     K+
Sbjct: 184 QWLTVLPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKI 243

Query: 218 IALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAA 277
           + + GFII S  + CG    DG IG  YW NPGA+     + D +  RF      L+   
Sbjct: 244 LMIAGFIILSVVINCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGY 298

Query: 278 FTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSD 336
           F++ G EL  ++  E +NPRK+ P A K+ + RI++ Y+L++  IG  VPYND +L  + 
Sbjct: 299 FSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAG 358

Query: 337 GIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRF 396
           G    +SP++++    G K++P I NAV+LI+++S  NS++Y G R++ SLS+   AP+F
Sbjct: 359 GSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKF 418

Query: 397 LSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIR 456
           L  V R G P  +++   +FG +AF+  S+     F WL  I G++  F W  I  SH+R
Sbjct: 419 LDYVDREGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLR 478

Query: 457 FMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDF-VAAYI 515
           F QA++ +G S D+L YKA    + + Y  FF  L+ + Q + A AP        V ++ 
Sbjct: 479 FRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFF 538

Query: 516 SIFLFLAIWLSF 527
             +L   IWL+F
Sbjct: 539 ESYLAAPIWLTF 550

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  278 bits (712), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 157/505 (31%), Positives = 266/505 (52%), Gaps = 13/505 (2%)

Query: 37  NVTKAITTERKVEDDAAKETESSPQ------ERREVKRKLKQRHXXXXXXXXXXXXXXXX 90
           NVT     E    DD   +   SP+      E R  +RKL  R                 
Sbjct: 82  NVTSLEEGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFV 141

Query: 91  XXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGAT 150
                +   GP   LI++     V   +++ +  MVT++PVT SF  F +RF+  + G  
Sbjct: 142 SIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFA 201

Query: 151 NGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEF 210
            G+ Y++        E++ +  V++YWT+ +P AA I +   L  S+N++ V ++GE EF
Sbjct: 202 VGWTYFVCQAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEF 261

Query: 211 CIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWV 270
            ++  KV+  +G IIF+  V+ G       +GF+ W NPGA+   I  SD + GRF G++
Sbjct: 262 YLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYI--SDGSVGRFHGFM 319

Query: 271 SSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYND 330
           S L+ A + + G + +G  A EA NPRK +P + +KV  R+++FYI     +G+L+PYND
Sbjct: 320 SCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYND 379

Query: 331 PKL----DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYS 386
           P +        +   +SP++ +++  G +VLP I N ++L +I+SAGNS++Y  SRVL+ 
Sbjct: 380 PNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHR 439

Query: 387 LSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFA 446
           L+ ++ APR     T+ GVP +  ++  V   LA+L VS  +     W LN+   A    
Sbjct: 440 LALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIV 499

Query: 447 WLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-TF 505
           ++ I  S+++F +    + +    LPY +  +P+LA+++ F++ L++L+ G+T F   ++
Sbjct: 500 YIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSW 559

Query: 506 QPIDFVAAYISIFLFLAIWLSFQVW 530
               FV +Y  I  FL      +++
Sbjct: 560 DTQSFVFSYFMIPFFLVFLFGHKLY 584

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  277 bits (708), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 164/528 (31%), Positives = 276/528 (52%), Gaps = 32/528 (6%)

Query: 29  VDEQYSG--ENVTKAITTERKVEDDAA------------KETESSPQERREVKRKLKQRH 74
           ++E +S   EN+   + + +K++D+              K  + + +   ++++ ++ RH
Sbjct: 29  INESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRH 88

Query: 75  XXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTS 133
                                L +AGP G LI Y+ M + IY + Q+ GEM V ++ +  
Sbjct: 89  VIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIG 148

Query: 134 SFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCL 193
            F+ +    +  A      ++Y + W     LEL      I+YW E V    ++ IF+ L
Sbjct: 149 GFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLL 208

Query: 194 LTSMNMFP-VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAW 252
           + ++N+F   + Y E EF     K++ + GF I    ++CG   + G IG  YW NPGA+
Sbjct: 209 IIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAF 268

Query: 253 ---GPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVV 309
               PG         RF G VS+L+ AAF++  TE + ITA E +NPRKA+P A KKV+ 
Sbjct: 269 RGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 320

Query: 310 RILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLIT 368
           R L  Y+ S+  +G LVPYN P+L  S      +SP++I++ + G ++ P   NAV+LI+
Sbjct: 321 RALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILIS 380

Query: 369 ILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGS 428
           +LS  NS+ Y  SR+L +L+K   AP+  + + R G P F +++ S+   +AF   S   
Sbjct: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440

Query: 429 GKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFF 488
            + F+WLL I+G++  F W  I  SHIRF +A++ +G S ++L YK+Q+  + + YA+  
Sbjct: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500

Query: 489 IALIVLIQGFTAFAPTFQP----IDFVAAYISIFLFLAIWLSFQVWFK 532
           + LI++ Q + A  P         +F   Y+++ + L  +  ++ W K
Sbjct: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  277 bits (708), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 164/511 (32%), Positives = 264/511 (51%), Gaps = 15/511 (2%)

Query: 28  FVDE-QYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXX 86
           FVD  + + +N    + ++ +   DAA    +       +K+ +K RH            
Sbjct: 56  FVDSFKPAEDNKHSEVDSDVERNGDAAYSVNTDTH----LKKAMKTRHVIMMTLGTGIGT 111

Query: 87  XXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSP 145
                    L   GP   +I Y  +  V Y + Q+ GEM    P +  +F+ +A  F+S 
Sbjct: 112 GLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSK 171

Query: 146 ALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYY 205
             G    +++ + W     LEL     +I+YWTE V    ++VIF+  L  ++   VK Y
Sbjct: 172 PFGFATVWLFCIQWLTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAY 231

Query: 206 GEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGR 265
           GE EF     K++ + GFIIFS  V CG    DG IG +YW +PGA+     +      R
Sbjct: 232 GETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAF-----AGTNAAER 286

Query: 266 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLL 325
           F G    L++  F+Y GTEL  ++  E  NPRK+ P A K+ + RILV Y+L++  IG  
Sbjct: 287 FKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFT 346

Query: 326 VPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVL 384
           VP+ND +L  + G    +SP++++    G +V+P I NAV+LI ++S  NS++Y   R+L
Sbjct: 347 VPFNDDQLMGAGGSATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLL 406

Query: 385 YSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGF 444
            SL++   AP+F++ V R G P +++L+ +VFG +AF   S    + F WL  I G++  
Sbjct: 407 CSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSEL 466

Query: 445 FAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT 504
           F W  I  SH+RF QA++ +G   +++ Y A    + + Y   F  L+ + Q + A AP 
Sbjct: 467 FTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPP 526

Query: 505 FQPI---DFVAAYISIFLFLAIWLSFQVWFK 532
             PI    F  +Y++  +++A +  + +W K
Sbjct: 527 KSPITAQSFFESYLAFPIWIAFYFGYMIWNK 557

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  276 bits (706), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 163/512 (31%), Positives = 264/512 (51%), Gaps = 27/512 (5%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           + QYS  N+ +      K   D + +T +       +KR LK RH               
Sbjct: 49  NHQYSNRNIFQRCVDSFKPPLDGSFDTSN-------LKRTLKPRHLIMIAIGGSIGTGLF 101

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 +A  GP+G ++ +   G+ I      LGE+    PV  +F+ +  RFL P++  
Sbjct: 102 VGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISF 161

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
               +Y L W F   LE+      +QYW  ++    W+ IF+ ++ S+N+F V+ +GE E
Sbjct: 162 VVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVVWVAIFYVIIVSINLFGVRGFGEAE 221

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F  ++IK I + GFII    ++ G G     +G +YW +PG    G          F G 
Sbjct: 222 FAFSTIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPGCLANG----------FPGI 271

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
           +S L+ A+++  G E+  + +GE  +P K LP AIK+V  RIL F+++SL  +G LVPY 
Sbjct: 272 LSVLVVASYSLGGIEMTCLASGET-DP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYT 329

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           +  L   G  V +SPF+I+I+    KVLP I N V+LI++LS GNS ++  SR L S++ 
Sbjct: 330 NQNL-LGGSSVDNSPFVIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAH 388

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
             L P +   + R G P   +++ S+FG LAFL  S   G  FNWL+ I G+A    WL 
Sbjct: 389 QGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLS 448

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP------ 503
           I+ SHIRF  A++ +G   D+L + + +  + + Y++    LI+L Q + +  P      
Sbjct: 449 INVSHIRFRMAMKAQGKKLDELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKN 508

Query: 504 -TFQPIDFVAAYISIFLFLAIWLSFQVWFKCR 534
            + +   F   Y+   + L I+++ ++++KC+
Sbjct: 509 SSDRAKIFFQNYLCALIVLFIFIAHKIYYKCQ 540

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  276 bits (707), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 163/491 (33%), Positives = 262/491 (53%), Gaps = 20/491 (4%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           +  A  T ++P  RR     LK RH                     LA AGP G LI + 
Sbjct: 72  EKLAIRTAAAPLSRR-----LKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWG 126

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
              T+I  +  SLGE+    PV+  +  +A RF+  + G  N + Y +       LE+  
Sbjct: 127 LTATMILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVA 186

Query: 170 LGKVIQYW-TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
               + YW T+     A++ +FW ++ S+N+F V+ +GE E   + IKVI ++GFII   
Sbjct: 187 ASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGV 246

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            ++ G G     IG +YW +PG +  G   SDK    F G  S  + AAF++ G+EL+G+
Sbjct: 247 VLISGGGPDHEVIGGKYWNDPGPF-VGNAPSDK----FKGVCSVFVTAAFSFAGSELIGL 301

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMI 347
            A E   PRK++P+A K+V  RI +FYILSL  +GLLVP N+  L     I  + SPF+I
Sbjct: 302 AAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVI 361

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           +++    +VLP I N V+L  ++S GNS+VY  SR + +L+++   P+    + R G P 
Sbjct: 362 AMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPL 421

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
           F++  TS+FG L F+  +   G+ F+WLL I+G++ FF WL I+ +H+RF  A++ +G +
Sbjct: 422 FAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRT 481

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTF--------QPIDFVAAYISIFL 519
            ++L + +      + YA   I ++++ Q + A  P           PI F   Y+S  +
Sbjct: 482 TNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAV 541

Query: 520 FLAIWLSFQVW 530
            + ++L+ ++W
Sbjct: 542 AIVMYLAHKIW 552

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  275 bits (704), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 175/524 (33%), Positives = 268/524 (51%), Gaps = 19/524 (3%)

Query: 29  VDEQYSGENVTKAITTERKVEDDAAKETESSPQE-RREVKRKLKQRHXXXXXXXXXXXXX 87
           VD+Q +G+ V +   T    + +      + PQ     +K+ LK  H             
Sbjct: 16  VDKQ-TGQ-VYELDLTSYSNDSEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTG 73

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-------VTSSFSVFAQ 140
                   L   GP G  ISY  M T+IY V  +L EMV F+P          S S    
Sbjct: 74  LFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCT 133

Query: 141 RFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMF 200
           R++  +LG   G+ Y   +    A E +    V+ YWT AVP AAWI IF  ++  +N  
Sbjct: 134 RYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCT 193

Query: 201 PVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSD 260
            V++YG  E    S+K+  +LG II S  +  G G +   +GFR+W++PGAW   +  +D
Sbjct: 194 AVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHL--AD 251

Query: 261 KNEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSL 319
              GR    ++ +I A F +  G ELV +T+ EA + R+ + +A ++ V R++ FY +S 
Sbjct: 252 GGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSS 311

Query: 320 FFIGLLVPYNDP----KLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNS 375
              G++V  NDP     L        SSPF+I I+N+G KVLP I N  +L +  S+GNS
Sbjct: 312 LCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNS 371

Query: 376 NVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWL 435
            +Y  +R L SLS+   AP+  + V R GVPY  V   + F  LA+L VS+ +   FNW 
Sbjct: 372 FMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWF 431

Query: 436 LNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLI 495
            NI+ ++GF  W+    +++RF +A+    +  D LP+K    P+  ++    IA+I LI
Sbjct: 432 SNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLI 490

Query: 496 QGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
            G+ +F   +   DF+AAYI++ LFL +WL  + + +    W +
Sbjct: 491 NGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMI 533

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  275 bits (704), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 159/501 (31%), Positives = 264/501 (52%), Gaps = 18/501 (3%)

Query: 49  EDDAAKETESSPQERRE----VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGA 104
           E  A +  +S+ QE  +      + L  RH                     L   GP   
Sbjct: 51  ETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSL 110

Query: 105 LISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFA 164
           +I ++ + T ++++  +LGE+ +  PV   F+V+  RF+ P+ G      Y   W     
Sbjct: 111 VIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLP 170

Query: 165 LELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFI 224
           LEL      I+YW   +   AW+ IF+ ++   N+  VK +GE EF ++ +K++A++GF 
Sbjct: 171 LELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFT 230

Query: 225 IFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTE 284
           I    + CG G   G IG +YW NPGA+  G  + D    RF G  S  + AAF+Y GTE
Sbjct: 231 ILGIVLTCGGGPKGGYIGGKYWSNPGAF-VGHTAGD----RFHGLCSVFVTAAFSYSGTE 285

Query: 285 LVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSS 342
           L+ ++A E+ NPR  LP+A K+    I V YI+ L  +G LV  +DP+L   S  + V++
Sbjct: 286 LIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAA 345

Query: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402
           SP +I+IEN G K LP + NA++LI +LS  NS VY  SR + S+++    P+  + V R
Sbjct: 346 SPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDR 405

Query: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462
            G P +++++T +FG L+F+  S    + F WL  ++G++  F W  I+ SHIRF + ++
Sbjct: 406 KGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMK 465

Query: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISIF 518
           +RG + D+LP+ +    + +YY    I +++++  +T+  P          F   Y+S  
Sbjct: 466 ERGRTLDELPFVSMTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFP 525

Query: 519 LFLAIWLSFQVWFKCRLLWKL 539
           + LA +   +++ +    W+L
Sbjct: 526 ILLACYFGHKLYTRS---WRL 543

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  275 bits (704), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 169/479 (35%), Positives = 262/479 (54%), Gaps = 13/479 (2%)

Query: 66  VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM 125
           +K +LK RH                     L   GP   LI +  MGT+IY++  +LGE+
Sbjct: 85  LKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGEL 144

Query: 126 VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLA 184
               P++  F+ +A RF+  + G    + Y L W  T  LE+      + YW T+     
Sbjct: 145 AVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRD 204

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244
            ++ +FW ++  +NMF VK YGE EF  + IKVI ++GFII    + CG G   G IG +
Sbjct: 205 GFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGGK 264

Query: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304
           Y+ +PGA+     + D    +F G  S  + AAF++ G+ELVG+ A E+ +PRK++P+A 
Sbjct: 265 YFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKAA 319

Query: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNA 363
           K+V  RI +FYILSL  IGLLVPYND +L  +  +  ++SPF+I+I   G K LP + N 
Sbjct: 320 KQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSVVNV 379

Query: 364 VVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLE 423
           V+LI +LS GNS ++  SR   +L++    P+  + V R G P   ++ TS  G +AF+ 
Sbjct: 380 VILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIAFVA 439

Query: 424 VSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAY 483
            S      FNWLL ++G++  F W  I   HIRF +A+  +G S D+L +K+    + +Y
Sbjct: 440 ASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVWGSY 499

Query: 484 YASFFIALIVLIQGFTAFAP---TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
           +  F I ++ + Q + A  P   +     F  AY+S  L LA+++  +++   +  WKL
Sbjct: 500 WGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIY---KRNWKL 555

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  277 bits (708), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 257/485 (52%), Gaps = 15/485 (3%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
           E   +K+ +K RH                     L +AGP G +I Y  MG+ IY + Q+
Sbjct: 138 EEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQA 197

Query: 122 LGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA 180
            GEM V +  +   F+ +    + P  G    ++Y L W     LEL      I+YWT  
Sbjct: 198 AGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTT 257

Query: 181 VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP 240
           V   A++VIF+ ++  + +F  + Y E EF     K++ ++GF I    +  G   +DG 
Sbjct: 258 VNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGY 317

Query: 241 IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL 300
           +G +YW +PGA+            RF G +++ ++AAF +  TE + +TA E +NPRKA+
Sbjct: 318 LGAKYWHDPGAF-----RGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAI 372

Query: 301 PRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIENSGTKVLPD 359
           P A KKV+ R++  ++ ++  +G LVP++ D  + + G    +SP++++I   G +V+P 
Sbjct: 373 PSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPH 432

Query: 360 IFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFL 419
             NAV+LI++ S  NS  Y  SR+L  L++   AP+F   V R G P+ ++   ++FG +
Sbjct: 433 FINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVI 492

Query: 420 AFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMP 479
           AF   S    + F WLL I+G++  F W+ I  SHIRF +A+  +G S  ++ +KAQ+  
Sbjct: 493 AFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGV 552

Query: 480 FLAYYASFFIALIVLIQGFTAFAPTFQPID-----FVAAYISIFLFLAIWLSFQVWFKCR 534
           + +YYA+  + L ++ Q + A AP     D     F   Y+++ + +A +  +++W   +
Sbjct: 553 YGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLW---K 609

Query: 535 LLWKL 539
             W+L
Sbjct: 610 RDWRL 614

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  275 bits (703), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 155/494 (31%), Positives = 261/494 (52%), Gaps = 11/494 (2%)

Query: 47  KVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           +V +DA     ++      + + L  RH                     LA  GP   +I
Sbjct: 51  EVVNDATSTVSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVI 110

Query: 107 SYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALE 166
            ++ + T +++V  +LGEM    PV   F+V+  RF+ P++G      Y   W     LE
Sbjct: 111 DWVIISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLE 170

Query: 167 LSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIF 226
           L      I+YW + +   AW+ IF+ ++   NM  VK +GE EF ++ +K++A++GF I 
Sbjct: 171 LVAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTIL 230

Query: 227 SFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELV 286
              + CG G   G +G +YW NPG++  G  S  K    F G  S  + AAF+Y G E+ 
Sbjct: 231 GIVLSCGGGPQGGYLGGKYWHNPGSF-VGHTSGTK----FKGLCSVFVTAAFSYSGIEMT 285

Query: 287 GITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSSSP 344
            ++A E+ +PR+ +P+A K+    I   YI  L  IG LVPY++P+L   S  +  +SSP
Sbjct: 286 AVSAAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSP 345

Query: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGG 404
            +I+IEN G K LP + NA++LI+I+S  NS VY  SR + +++     P+ L ++ + G
Sbjct: 346 LVIAIENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKG 405

Query: 405 VPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKR 464
            P  ++L T  FG L+F+  S    + F WL  ++G++  F W+ I+ SHIRF QA++K+
Sbjct: 406 RPVNAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQ 465

Query: 465 GISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFVAAYISIFLF 520
             S D+LPY +Q   + ++Y    + L++++  +T+  P          F   Y+S  + 
Sbjct: 466 RKSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPIL 525

Query: 521 LAIWLSFQVWFKCR 534
           +A ++  ++ ++ +
Sbjct: 526 IACYVGHKLVYRKK 539

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  275 bits (703), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 156/496 (31%), Positives = 256/496 (51%), Gaps = 13/496 (2%)

Query: 46  RKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGAL 105
           +   D A+  +         + + L  RH                     LA  GP   +
Sbjct: 55  QTTTDFASVISHEDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLV 114

Query: 106 ISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
           I ++ + T +++V  +LGEM    PV   F+V+  RF+ P++G      Y   W     L
Sbjct: 115 IDWIIISTCLFTVINALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPL 174

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           EL      I+YW E +   AW+ IF+C++   NM  VK +GE EF ++ IK++A++GF I
Sbjct: 175 ELVAASMTIKYWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTI 234

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEG-RFLGWVSSLINAAFTYQGTE 284
               + CG G   G IG +YW +PG++         N G +F G  S  + AAF+Y G E
Sbjct: 235 LGIVLACGGGPHGGFIGGKYWNHPGSF------VGHNSGTKFKGLCSVFVTAAFSYSGIE 288

Query: 285 LVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSS 342
           +  ++A E+ +PR  +P+A K+    I   Y+  L  IG LVPY+DP+L   +  +  +S
Sbjct: 289 MTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAAS 348

Query: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402
           SP +I+IEN G K LP + NA++LI+I+S  NS VY  SR + +++     PR L+ V  
Sbjct: 349 SPLVIAIENDGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDT 408

Query: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462
            G P  +++ T  FG L+F+  S      F WL  ++G++  F W+ I+ SHIRF Q++ 
Sbjct: 409 KGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMA 468

Query: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISIF 518
           K+  S D+LP+ +Q   + ++Y +  + L+++   +T+  P    +     F   Y+S  
Sbjct: 469 KQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFP 528

Query: 519 LFLAIWLSFQVWFKCR 534
           + LA +   +++ + R
Sbjct: 529 ILLACYFGHKLYVRKR 544

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  275 bits (703), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 160/491 (32%), Positives = 255/491 (51%), Gaps = 20/491 (4%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D+ K       +   +KR LK RH                     +A  GP+G +I +  
Sbjct: 63  DSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAI 122

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
            G+ I      LGE+    PV  +F+ +  RFL P++      +Y L W F   LE+   
Sbjct: 123 AGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAA 182

Query: 171 GKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCV 230
              +QYW  ++    W+ IF+ ++ S+N+F V+ +GE EF  ++IK I + GFII    +
Sbjct: 183 AMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVL 242

Query: 231 VCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITA 290
           +CG G     IG +YW +PG    G          F G +S L+ A+++  G E+  + +
Sbjct: 243 ICGGGPDHEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLAS 292

Query: 291 GEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIE 350
           GE  +P K LP AIK+V  RIL F+++SL  +G LVPY +  L   G  V +SPF+I+I+
Sbjct: 293 GE-TDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNL-LGGSSVDNSPFVIAIK 349

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
               K LP I NAV+LI++LS GNS ++  SR L S++   L P +   + R G P   +
Sbjct: 350 LHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGI 409

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
           ++ S+FG LAFL  S    + FNWL+ I G+A    WL I+ SHIRF  A++ +G S D+
Sbjct: 410 MANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDE 469

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-------TFQPIDFVAAYISIFLFLAI 523
           L + + +  + + Y++    LI++ Q + +  P         +   F   Y+   + L I
Sbjct: 470 LEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFI 529

Query: 524 WLSFQVWFKCR 534
           ++  ++++KC+
Sbjct: 530 FIVHKIYYKCQ 540

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  275 bits (702), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 162/519 (31%), Positives = 268/519 (51%), Gaps = 39/519 (7%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           D QY+  N+ +      K   D + +T +       +KR LK RH               
Sbjct: 49  DGQYNNRNIFQRCVDSFKPPLDGSFDTSN-------LKRTLKPRHLIMIAIGGSIGTGLF 101

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 +A  GP+G ++ +   G+ I      LGE+    PV  +F+ +  RFL P++  
Sbjct: 102 VGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHGLGEITVRFPVVGAFANYGTRFLDPSISF 161

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
               +Y L W F   LE+      +QYW  ++    W+ IF+ ++ S+N+F  + +GE E
Sbjct: 162 VVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGARGFGEAE 221

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F  +++K I + GFII    ++CG G     IG +YW +PG    G          F G 
Sbjct: 222 FAFSTVKAITVGGFIILCIVLICGGGPDHEFIGAKYWHDPGCLAHG----------FPGV 271

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
           +S L+ A+++  G E+  + +GE  +P K LP AIK+V  RI+ F+++SL  +G LVPY 
Sbjct: 272 LSVLVVASYSLGGIEMTCLASGET-DP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYT 329

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           +  L   G  V +SPF+I+I+    KVLP I NAV+LI++LS GNS ++  SR L S++ 
Sbjct: 330 NQNL-LGGSSVDNSPFVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAH 388

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
             L P +   + R G P   +++ S+FG LAFL  S    + FNWL+ I G+A    WL 
Sbjct: 389 QGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLS 448

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----- 504
           I+ SH+RF  A++ +G S D+L + + +  + + Y++    LI++ Q + +  P      
Sbjct: 449 INLSHVRFRLAMKAQGKSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTS 508

Query: 505 --------FQPIDFVAAYISIFLFLAIWLSFQVWFKCRL 535
                   FQ  +++ A I +F+F+      +++++C++
Sbjct: 509 SKERAKIFFQ--NYLCALIMVFIFVI----HKIYYRCQM 541

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  277 bits (708), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 167/528 (31%), Positives = 275/528 (52%), Gaps = 30/528 (5%)

Query: 65  EVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124
           E+K+ +K RH                     L  AGP G +I +  MG+ +Y + Q++GE
Sbjct: 157 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGE 216

Query: 125 M-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPL 183
           + V +  +   F+ +    +  A      ++Y + W     LEL      I+YWT  V  
Sbjct: 217 LAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDP 276

Query: 184 AAWIVIFWCLLTSMNMFP-VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIG 242
             +++IF+ L+  +N+      Y E EF   S K++ ++GF I    V+CG   +DG IG
Sbjct: 277 DIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIG 336

Query: 243 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPR 302
            +YW +PGA     +  D +  RF G +++L+NAAF +  +E +G+TA E +NPRKA+P 
Sbjct: 337 AKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 391

Query: 303 AIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361
           A KK++ RIL  ++ S+  +G LVPYN D  L S G  V +SP++++I   G +V+P   
Sbjct: 392 AAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFI 451

Query: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421
           NAV+LI++LS  NS  Y  SR+L SL++   AP+  S + R G P   + + ++FG +AF
Sbjct: 452 NAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAF 511

Query: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481
              S    + F WLL I+G++  F W+ I  SHIRF +A+  +G S  +L +++Q+  + 
Sbjct: 512 CATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYG 571

Query: 482 AYYASFFIALIVLIQGFTAFAP-------TFQPIDFVAAYISIFLFLAIWLSFQVWFKCR 534
           + YA+  + +I++ Q + A  P            +F   Y+++ + LA +  +++W K  
Sbjct: 572 SAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKD- 630

Query: 535 LLWKLXXXXXXXXXXXX-----EELVWIEPE-------CKTRWQRVWD 570
             WKL                 EEL+  E +          +W+RV+D
Sbjct: 631 --WKLFIRAKNIDLISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYD 676

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  275 bits (702), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 166/509 (32%), Positives = 270/509 (53%), Gaps = 12/509 (2%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           +E+Y+G +   + T ER   +D  +       + + +K+ +K RH               
Sbjct: 52  EEEYNGGDGIHS-THERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGML 110

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALG 148
                 L + GP   LI Y  + T++Y V QS  E+ + +  ++  F+ +    +  A  
Sbjct: 111 VGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFA 170

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
            +  ++Y L W     LEL      I+YW +++   A++VIF+ +L  +N      Y E 
Sbjct: 171 FSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEA 230

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF   + KV+ L+GF I    V CG   +DG +G  YW +PGA+       +    RF G
Sbjct: 231 EFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKG 285

Query: 269 WVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY 328
            V+ L+NAAF Y G E   +TA E  NP+K++  A KK+V RI+  Y+++   +G LVPY
Sbjct: 286 LVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPY 345

Query: 329 NDPKLDSDGIFVS-SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           N P+L   G   + +SPF+I+I + G KV+P I NAV+L+++LS  NS +Y  SR+L SL
Sbjct: 346 NSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSL 405

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           S+   AP+  + V R G P   +L + VFG L F+  S      F WLL I+G++  F W
Sbjct: 406 SEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTW 465

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT--- 504
             IS SH+RF +++  +G S D+L Y++    + AYYA   I LI++ Q + A +P    
Sbjct: 466 FSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSN 525

Query: 505 -FQPIDFVAAYISIFLFLAIWLSFQVWFK 532
                +F   Y+++ + + ++L +++W++
Sbjct: 526 KLDANNFFENYLAMPILIGLYLGYKLWYR 554

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  274 bits (700), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 165/507 (32%), Positives = 270/507 (53%), Gaps = 22/507 (4%)

Query: 46  RKVEDDAAKETES------SPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           R       +E +S         E   +K+ L+ RH                     L  A
Sbjct: 33  RHTHSSTDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRA 92

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSW 159
           GP   LI+Y  MG V+++V   LGEM  +IP+   F+ +A R+  PALG   G+ Y   +
Sbjct: 93  GPGSILIAYSIMGWVVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKY 151

Query: 160 CFTFALELSVLGKVIQYWTEA--VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKV 217
                 +L+    VIQ+W  A  V    WI +   ++  +N   V+++GEFEF ++S KV
Sbjct: 152 LVLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKV 211

Query: 218 IALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNE------GRFLGWVS 271
           + +L  +I    +  G G +   +GFRYW +PGA+      S K+       G+F+ ++S
Sbjct: 212 LVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKE---YSKKDTHIKGGLGKFVAFLS 268

Query: 272 SLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDP 331
             + A F Y GTEL GI A E  +PR+ +PRAIK  + RI+VFY++++F +G+ V YNDP
Sbjct: 269 VFVYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDP 328

Query: 332 KL---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLS 388
            L    S  +  ++SP++++IEN+   VLP++FNA VL  + SA NS++Y+GSR LY L+
Sbjct: 329 LLMQASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLA 388

Query: 389 KNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWL 448
            +  AP+  +   + GVPY ++   ++F  LA++ VS  +  AF + +N+T + G  +W+
Sbjct: 389 IDGKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWV 448

Query: 449 LISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQP 507
            I  ++I F +A R +GI +  L Y A   P+  + A  F   + LI+ F AF       
Sbjct: 449 SILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDV 508

Query: 508 IDFVAAYISIFLFLAIWLSFQVWFKCR 534
             F+  YI + +++  ++ +++  K +
Sbjct: 509 PTFITGYIGLPIYIFCFIGYKIVHKTK 535

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  273 bits (698), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 262/510 (51%), Gaps = 23/510 (4%)

Query: 33  YSGENVTKAITTERKVED---DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           YS     + + T+R +     D+ K       +   +KR LK RH               
Sbjct: 27  YSSGESPEPVVTKRNIFQRCVDSFKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLF 86

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 LA  GP+  +I +   G+ I      LGE+    PV  +F+ ++ RFL P++  
Sbjct: 87  IGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISF 146

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
               +Y + W F   LE+      IQYW  ++    W+ IF+ ++ S+N+F  + +GE E
Sbjct: 147 VVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAE 206

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F  ++IK I + GFII    ++CG G     IG +YW +PGA   G          F G 
Sbjct: 207 FVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWHDPGALAHG----------FPGV 256

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
           +S L+ A+++  GTE+  + +GE  +P K LP AIK+V  RIL F++ SL  +G LVPY 
Sbjct: 257 LSVLVVASYSLGGTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLASLTLVGFLVPYT 314

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           +  L   G  V +SPF+I+I+    K LP I NAV+LI+ILS GNS ++  SR L S++ 
Sbjct: 315 NENL-LGGSSVDNSPFVIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAH 373

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
             L PRF   + R G P   +++ S+FG LAFL  S+   + F+WL+ I G+A    WL 
Sbjct: 374 QGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLS 433

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPID 509
           I+ SHIRF  A++ +  + D+L + + +  + + Y++    LI++ Q + +  P     D
Sbjct: 434 INLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTD 493

Query: 510 -------FVAAYISIFLFLAIWLSFQVWFK 532
                  F  +Y+   + L I+   +V+++
Sbjct: 494 SSQRAKKFFQSYLCALIMLLIFCIHKVYYR 523

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  273 bits (699), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/462 (32%), Positives = 250/462 (54%), Gaps = 7/462 (1%)

Query: 44  TERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVG 103
           ++R  ED+  ++   S +    +K+ +K RH                     L+ AGP  
Sbjct: 64  SQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGS 123

Query: 104 ALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFT 162
            +I Y+ +  V Y + Q+ GEM VT+  +  +F+ +   F+S + G    +++ + W   
Sbjct: 124 LVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTV 183

Query: 163 FALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLG 222
             LEL      ++YW + +    +IVIF+  L  ++ F VK YGE EF   S K++ + G
Sbjct: 184 LPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAG 243

Query: 223 FIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQG 282
           FII S  + CG    DG IG +YWR+PG++  G         RF G    L++A F++ G
Sbjct: 244 FIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGG 298

Query: 283 TELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVS 341
            EL  ++  E +NPRK+ P A K+ V RIL+ Y+L++  IG  VP+N+ +L  S G    
Sbjct: 299 IELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATH 358

Query: 342 SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT 401
           +SP++++      +V+P I NAV+LI+++S  NS +Y   R++ SL++   AP+FL+ + 
Sbjct: 359 ASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYID 418

Query: 402 RGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAI 461
           R G P  +++  S+ G + F+  S    +AF WL  I G++  F W  I  SHIRF +A+
Sbjct: 419 REGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAM 478

Query: 462 RKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
           + +G S D++ YKA    + +YY  FF  L+ + Q + A +P
Sbjct: 479 KVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSP 520

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  271 bits (694), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 165/489 (33%), Positives = 258/489 (52%), Gaps = 19/489 (3%)

Query: 31  EQYSGENVTKAITTERKVEDDAAKETESSPQE-RREVKRKLKQRHXXXXXXXXXXXXXXX 89
           +  S E+ T +  T  ++E    K   +S  + +  VKR LK RH               
Sbjct: 15  DDASCESYTSSGITPDQIETGEGKNHNASLYDPKTGVKRALKDRHISLLALGGIIGPGCL 74

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 LA  GP+  L+ +  +G + +++ +S+GEM+T  P    F+  A+RF S +L A
Sbjct: 75  VGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEMITLYPSGGGFTTLARRFHSDSLSA 134

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
             GY Y + +    A E + L  + Q+W   VPL  +I+IFW    +  M  V  +GE E
Sbjct: 135 VCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYGYILIFWAAFQAFQMAGVGAFGEIE 194

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           + ++  K++ L+ F IFS   + G  +     GF YW NPGA   G          F G 
Sbjct: 195 YWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHYWNNPGALSHG----------FKGI 244

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
               +  +  Y GTE V  +A E+ NP +A+P AI++   RILV YI   FF G+ VPYN
Sbjct: 245 AEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIRQTFWRILVVYIGIGFFYGVTVPYN 304

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           D  L++ G     SP  I+I  +G +    + NA +L+T +SA N +++IGSR + +L+ 
Sbjct: 305 DHNLNA-GTKALKSPISIAITRAGWEGGTHLVNAFILVTCISAINGSLFIGSRTITNLAH 363

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
             LAP+FL+   R GVP  ++   +  G ++ + VS G+  A+++++N++GV  F  W  
Sbjct: 364 EGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGT 423

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPF---LAYYASFFIALIVLIQGFTAFAPTFQ 506
           I  +H+RF +A  K+G +  +LPYKA   P+   +   A+ F+A   LIQG+T+F P F+
Sbjct: 424 IGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIGIAANIFLA---LIQGWTSFVP-FK 479

Query: 507 PIDFVAAYI 515
             DFV AY+
Sbjct: 480 AGDFVDAYV 488

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  272 bits (696), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 160/512 (31%), Positives = 262/512 (51%), Gaps = 27/512 (5%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           D ++S  N+ +      K   D + +T +       +KR LK RH               
Sbjct: 50  DGEHSNRNIFQRCVDSFKPPLDGSFDTSN-------LKRTLKPRHLIMIAIGGSIGTGLF 102

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 +A  GP+G ++ +   G+ I      LGE+    PV  +F+ +  RFL P++  
Sbjct: 103 VGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISF 162

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
               +Y L W F   LE+      +QYW  ++    W+ IF+ ++  +N+F  + +GE E
Sbjct: 163 VVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGARGFGEAE 222

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F  +++K I + GFII S  ++CG G     IG +YW +PG    G          F G 
Sbjct: 223 FAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCLANG----------FPGV 272

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
           ++ L+ A+++  G E+  + +GE  +P K LP AIK+V  RIL F++ SL  +G LVPY 
Sbjct: 273 LAVLVVASYSLGGIEMTCLASGE-TDP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPYT 330

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           +  L   G  V +SPF+I+++    KVLP I NAV+LI++LS GNS ++  SR L S++ 
Sbjct: 331 NQNL-LGGSSVDNSPFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAH 389

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
             L P +   + R G P   +++ S+FG LAFL  S      FNWL+ I G+A    WL 
Sbjct: 390 QGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLS 449

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP------ 503
           I+ SHIRF  A++ +G S D+L + + +  + + Y++    LI++ Q + +  P      
Sbjct: 450 INLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSS 509

Query: 504 -TFQPIDFVAAYISIFLFLAIWLSFQVWFKCR 534
              +   F   Y+   + L I++  ++++KC+
Sbjct: 510 GKERAKLFFQNYLCALIMLFIFVVHKIYYKCQ 541

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  272 bits (695), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 157/489 (32%), Positives = 255/489 (52%), Gaps = 10/489 (2%)

Query: 49  EDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISY 108
           +D+  +    S      +K+ +K RH                     L  +GP   +++Y
Sbjct: 84  DDNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAY 143

Query: 109 LFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 167
             +  V Y + Q+ GEM VT+  +  +F+ +   F+S   G    +++ L W     LEL
Sbjct: 144 GLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLEL 203

Query: 168 SVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFS 227
                 I+YW + +    ++VIF+  L  ++ F V+ YGE EF   S K++ + GFIIFS
Sbjct: 204 ITSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFS 263

Query: 228 FCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 287
             V CG    DG IG +YW +PGA+     +S  N GRF G    L+ A F+Y GTEL  
Sbjct: 264 IVVNCGGAGHDGYIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYV 318

Query: 288 ITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY-NDPKLDSDGIFVSSSPFM 346
           ++  E  NPRK+ P+A K+ + RI+V Y+L++  IG  VP+ ND  + S G    +SP++
Sbjct: 319 LSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYV 378

Query: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVP 406
           ++    G +++P   NAV+LI+++S  NS++Y   R+L SL++   AP+FL+ + R G P
Sbjct: 379 LAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRP 438

Query: 407 YFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGI 466
             ++ + S+FG + F   S    + F WL  I G++  F W  I  SH+RF QA++ +G 
Sbjct: 439 LTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGR 498

Query: 467 SRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP---IDFVAAYISIFLFLAI 523
             ++L YKA    + + Y  FF  L+   Q + A AP       + F  +Y++  +F   
Sbjct: 499 DLNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTF 558

Query: 524 WLSFQVWFK 532
           +  + +W K
Sbjct: 559 YFGYMLWNK 567

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 162/507 (31%), Positives = 261/507 (51%), Gaps = 23/507 (4%)

Query: 35  GENVTKAITTERKVED---DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXX 91
           G  V K     R +     D+ K  E    +   +K+ LK RH                 
Sbjct: 52  GPPVAKGTKPPRNIFQRAIDSFKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIG 111

Query: 92  XXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATN 151
               LA  GP+  +I +   G+ I      LGE+    PV  +F+ ++ RFL P++    
Sbjct: 112 SGQALATGGPLAVIIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVV 171

Query: 152 GYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFC 211
             +Y + W F   LE+      +QYW E++    W+ IF+  + S+N+F V+ +GE EF 
Sbjct: 172 STIYVIQWFFVLPLEIISSAMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFI 231

Query: 212 IASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVS 271
            ++IKVI + GFI+    ++ G G     +G RYW NPG    G          F G +S
Sbjct: 232 FSTIKVITISGFILLCIILIAGGGPDHVYVGSRYWHNPGCLANG----------FPGVLS 281

Query: 272 SLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDP 331
            ++ A+++  GTE+  + +GE  +P K LP AIK+V  RIL F+++SL  +G LVPY + 
Sbjct: 282 VMVVASYSLGGTEMTCLASGE-TDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNE 339

Query: 332 KLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNS 391
            L   G  V +SPF+I+I+    KVLP I NAV+LI+ILS GNS ++  SR L S++   
Sbjct: 340 NL-LGGSSVDNSPFVIAIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQH 398

Query: 392 LAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLIS 451
           L P +   + R G P   +++ S+FG LAFL  S    + F+WL+ I G+A    WL I+
Sbjct: 399 LLPWWFGYIDRAGRPLVGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSIN 458

Query: 452 FSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-------T 504
            SHIRF  A++ +G S ++L + + +  + + Y++    LI++ Q + +  P        
Sbjct: 459 VSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSE 518

Query: 505 FQPIDFVAAYISIFLFLAIWLSFQVWF 531
            +   F  +Y+   + + IW+  ++++
Sbjct: 519 DRAKKFFQSYLCALIMVCIWIGHKIYY 545

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 156/482 (32%), Positives = 257/482 (53%), Gaps = 19/482 (3%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
           +   +K+ +K RH                     L   GP G+ I +L MG  +Y V Q+
Sbjct: 86  KHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 122 LGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW--T 178
            GE+ V +  +   F+ +    + PALG    ++Y L W   F LEL      I++W  +
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 179 EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD 238
            +V    ++ IF+ L+  +N F  + Y E EF   S KV+ ++GF I    +  GA  + 
Sbjct: 206 RSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 239 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 298
           G IG +YWR+PG+ G        +   F G V++L+NAAF+   +E V +TA E ANPRK
Sbjct: 266 GYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRK 320

Query: 299 ALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL----DSDGIFVSSSPFMISIENSGT 354
           ++P A KK++ +I V ++ S+  IG LVP +  +L    DSD   +  SP++I++   G 
Sbjct: 321 SIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSD---LHVSPYVIAVRMHGV 377

Query: 355 KVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTS 414
            V+P   NAV+L+++LS GNS  Y  SR+L+SL++ + AP+    + R G P  +++ + 
Sbjct: 378 NVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISI 437

Query: 415 VFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYK 474
           +FG + F+  S    + F WLL I+G++  F W  I  SHIRF +A+  +G S D+L +K
Sbjct: 438 LFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFK 497

Query: 475 AQMMPFLAYYASFFIALIVLIQGFTAFAP--TFQPI--DFVAAYISIFLFLAIWLSFQVW 530
           AQ     +Y ++  + L ++ Q + +  P    +P    F   Y+++ +FL  +  +++W
Sbjct: 498 AQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIW 557

Query: 531 FK 532
            K
Sbjct: 558 NK 559

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/492 (32%), Positives = 252/492 (51%), Gaps = 15/492 (3%)

Query: 45  ERKVEDDAAKETESSPQERRE--VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPV 102
           +R V      ET S   +  +  ++R ++ RH                     L + GP 
Sbjct: 56  KRSVPQGGDLETASVQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPG 115

Query: 103 GALISYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161
           G +I Y  +  V Y + Q+ GEM    P +  +F+ ++  F+S   G  + ++Y L W  
Sbjct: 116 GLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLT 175

Query: 162 TFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221
            F LEL      I+YWT++V    +I IF+  +  ++ F  + YGE EF     KV+ + 
Sbjct: 176 VFPLELITASLTIKYWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIA 235

Query: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281
           GF+I +  + CG   + G IG RYW +PGA+  G  +S     +F G+   L+   F+Y 
Sbjct: 236 GFVILAIVINCGGAGNSGYIGARYWHDPGAFAVGDPAS-----KFKGFCYVLVTGYFSYG 290

Query: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDG--IF 339
           GTEL  +T  E ++PR+A+  A K+ + RILV Y+L++  IG LVP+   +L   G    
Sbjct: 291 GTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSA 350

Query: 340 VSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN 399
             +SP+++++   G KV+P I NAV+LI ++S GNS +Y G RVL +L++   AP+FL+ 
Sbjct: 351 THASPYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAY 410

Query: 400 VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQ 459
           + R G P  ++++ SV G LAF+  S      F WL  I G++  F W  I  SHIRF Q
Sbjct: 411 IDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQ 470

Query: 460 AIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFL 519
           A++  G S   L YK+    + + Y   F  L+ + Q + A AP             +  
Sbjct: 471 AMKYHGYSLSQLGYKSITGLWGSIYGVCFNILVFVAQFWVALAPIGN-----NGKTDVLS 525

Query: 520 FLAIWLSFQVWF 531
           F   +L+F +WF
Sbjct: 526 FFQSYLAFPLWF 537

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  271 bits (693), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/498 (34%), Positives = 261/498 (52%), Gaps = 17/498 (3%)

Query: 50  DDAAKETESSPQE--RREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALIS 107
           D    E E   Q   +  ++  LK R                      L   GP G +I 
Sbjct: 85  DPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIG 144

Query: 108 YLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 167
           +    T+IYS+  +LGE+    PV   F+ +A RF+  + G  N + Y L W     LE+
Sbjct: 145 WGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEI 204

Query: 168 SVLGKVIQYW-TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIF 226
                 + YW T       ++ +FW ++  +NMF VK +GE EF  + IKV  ++GFII 
Sbjct: 205 VSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIIL 264

Query: 227 SFCVVCGAGQSDGPIGFRYWRNPGAW-GPGIISSDKNEGRFLGWVSSLINAAFTYQGTEL 285
              +VCG G   G +G +YW +PGA+ G G      +  +F G  S  + AAF++ G+EL
Sbjct: 265 GIVLVCGGGPKGGFVGAKYWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSEL 318

Query: 286 VGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSP 344
           +GITA EAANPRK++P A K+VV RI++FY+ +L  IGLLVPYND +L  +  +  ++SP
Sbjct: 319 IGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASP 378

Query: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGG 404
           F+I+I   G K LP + N V+LI +LS GNS ++  SR + +LS     P+    + R G
Sbjct: 379 FVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSG 438

Query: 405 VPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKR 464
            P   +  TS FG LAF+  S   G+ FNWLL ++G++  F W  I   HIRF  A++ +
Sbjct: 439 RPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQ 498

Query: 465 GISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPID---FVAAYISIFLFL 521
           G   ++L + +      +Y+  F I L+ + Q + A  P     D   F  +Y+S  + +
Sbjct: 499 GRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVV 558

Query: 522 AIWLSFQVWFKCRLLWKL 539
           A +   +++   +  WKL
Sbjct: 559 ATYFGHKIY---KRNWKL 573

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 169/521 (32%), Positives = 273/521 (52%), Gaps = 32/521 (6%)

Query: 28  FVD--EQYSGENVTKAIT-TERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXX 84
           FVD   +Y  ++V   ++ TER     AA  T  SP     +KR LK RH          
Sbjct: 53  FVDGFREYKLDDVDPNLSSTER-----AAIATARSP-----LKRHLKNRHLQMIAIGGSI 102

Query: 85  XXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLS 144
                      L   GP   +++++  G+++YSV Q++GE+   +PV+ S+  +  RF+ 
Sbjct: 103 GTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVALPVSGSYLSYVSRFID 162

Query: 145 PALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLA-AWIVIFWCLLTSMNMFPVK 203
           P+ G    Y Y +    T  LE+      + YW      A  ++ +F+  +  +N   VK
Sbjct: 163 PSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVK 222

Query: 204 YYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD-GPIGFRYWRNPGAWGPGIISSDKN 262
            YGE EF  + IKV+A++GFII    +VCG G ++ G IG +YW NPG +  G       
Sbjct: 223 GYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG------- 275

Query: 263 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFI 322
              F G+ +  + +AF++ G+E+  + A E+ NPR+ LP+A K+V  RI +FY++SL  I
Sbjct: 276 ---FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLI 332

Query: 323 GLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGS 381
           G LVPY +  L  S  +  S+SPF+I+I+ +G   LP + N V+L+ +LS GN+ V+  S
Sbjct: 333 GCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASS 392

Query: 382 RVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGV 441
           R   SL+     P+  + V R G P   ++ + VFG L+FL  S   G  F W+L ++G+
Sbjct: 393 RATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGL 452

Query: 442 AGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF 501
             FF W  I   H+RF Q +R +G S D+L +KAQ   + + Y    I++++  Q + A 
Sbjct: 453 CSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVAL 512

Query: 502 APTFQ---PIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
            P  +      F   Y+S+ + +  ++  +V+ +    W+L
Sbjct: 513 FPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRN---WRL 550

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 159/503 (31%), Positives = 258/503 (51%), Gaps = 13/503 (2%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQE--RREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           +++ K  T E   +  A  E  S  ++     + + L  RH                   
Sbjct: 56  DDILKGDTKEYPRDVKATPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSG 115

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
             L   GP   +I ++ + T +++V  SLGE+    PV   F+V+  RF+ P+       
Sbjct: 116 ASLTTGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINL 175

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
            Y   W     LEL      I+YW + +   AW+ IF+  +   NM  VK +GE EF ++
Sbjct: 176 NYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILS 235

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
            +K++A++GF I    + CG G   G IG +YW NPGA+            +F G  S  
Sbjct: 236 MVKILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAF-----VGHSAGSQFKGLCSVF 290

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           + AAF+Y G E+  ++A E+ NP++ +P+A K+    I V Y+  L  IG LVPYNDP+L
Sbjct: 291 VTAAFSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRL 350

Query: 334 --DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNS 391
              S  +  ++SP +I+IEN G K LP + NA++LI I+S  NS VY  SR + S++   
Sbjct: 351 LNGSSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIG 410

Query: 392 LAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLIS 451
             P+FLS V + G P  ++L T  FG L+F+  S    + F WL  ++G++  F W+ I+
Sbjct: 411 NLPKFLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAIN 470

Query: 452 FSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQP 507
            S IRF  A++ +G S D++P+ +Q   + A+Y    + L+++   +T+  P    T   
Sbjct: 471 LSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASA 530

Query: 508 IDFVAAYISIFLFLAIWLSFQVW 530
             F   Y+S+ + +A ++  ++W
Sbjct: 531 KSFFEGYLSLPILIACYVGHKLW 553

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  270 bits (689), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 156/496 (31%), Positives = 260/496 (52%), Gaps = 12/496 (2%)

Query: 44  TERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVG 103
           ++R  +D+  ++   S +    +K+ +K RH                     L  AGP  
Sbjct: 64  SQRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGS 123

Query: 104 ALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFT 162
            +I Y+ +  V Y + Q+ GEM VT+  +  +F+ +   F+S + G    +++ + W   
Sbjct: 124 LVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTV 183

Query: 163 FALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLG 222
             LEL      I+YW + +    +I IF+  L  ++ F VK YGE EF   S K++ + G
Sbjct: 184 LPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAG 243

Query: 223 FIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQG 282
           FII S  + CG    DG IG  YWRNPG++  G      +  RF G    L+ A F++ G
Sbjct: 244 FIILSVIINCGGAGVDGYIGGEYWRNPGSFADG-----SSATRFKGICFILVTAYFSFGG 298

Query: 283 TELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY-NDPKLDSDGIFVS 341
            EL  ++  E ANPRK+ P A K+ + RIL+ Y+L++  IG  VP+ ND  + S      
Sbjct: 299 IELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATH 358

Query: 342 SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT 401
           +SP++++    G KV+P I NAV+LI+++S  NS +Y   R++ SL++   AP+FL+ + 
Sbjct: 359 ASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYID 418

Query: 402 RGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAI 461
           R G P  +++  S  G + F+  S+   +AF WL  I G++  F W  I  SHIRF +A+
Sbjct: 419 REGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAM 478

Query: 462 RKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVAAYIS 516
           + +G S D++ YK+    + +YY   F  L+ + Q + A +P           F  +Y++
Sbjct: 479 KVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQSYLA 538

Query: 517 IFLFLAIWLSFQVWFK 532
             L++ ++L + ++ K
Sbjct: 539 APLWIFMYLGYMIYNK 554

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  270 bits (689), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 178/482 (36%), Positives = 269/482 (55%), Gaps = 13/482 (2%)

Query: 63  RREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSL 122
           R  ++ KLK RH                     L  AGP G LI +   GT+I+++  +L
Sbjct: 85  RSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMAL 144

Query: 123 GEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVP 182
           GE+    PV+  F  +A RF+  + G  N + Y   W     LE+      + YW   V 
Sbjct: 145 GELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVR 204

Query: 183 LA-AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
               ++ +FW ++  +NMF V+ YGE EF  + IKVIA++GFII    +VCG G   G +
Sbjct: 205 YTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYV 264

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           G RYW +PGA+     +      RF G+ S  + AAF++ G+ELVGI + E+ NPRK++P
Sbjct: 265 GGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVP 319

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDI 360
           +A K+V  RIL+FYIL L  +GLLVPY DP+L  S G+  S+SPF+I+I   G   LP +
Sbjct: 320 QAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGLPSV 379

Query: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA 420
            N V+LI++LS GNS++Y  SR L +LS+    P+ ++ + R G P   +   S FG +A
Sbjct: 380 VNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIA 439

Query: 421 FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF 480
           F+  S    + FNWLL I+G++ F  W  I F HIRF  A++  G S D+LP+K+ +   
Sbjct: 440 FVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGII 499

Query: 481 LAYYASFFIALIVLIQGFTAFAP---TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLW 537
            +Y+      L+++ Q + A  P   +    DF +AY++  + LA +++ ++W   +  W
Sbjct: 500 GSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLW---KRNW 556

Query: 538 KL 539
           KL
Sbjct: 557 KL 558

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  268 bits (686), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 157/499 (31%), Positives = 258/499 (51%), Gaps = 22/499 (4%)

Query: 45  ERKVEDDAAKETESSPQE---RREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGP 101
            RK E +  KE +   +E     ++K+ +K RH                     LA AGP
Sbjct: 46  RRKGESEDVKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGP 105

Query: 102 VGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 160
            G +I Y     ++Y + Q+ GE+ + +  +  +++ ++   + PALG +  ++Y + W 
Sbjct: 106 AGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWM 165

Query: 161 FTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIAL 220
               L+L      ++YWT A P   ++ +F+ ++  +NMF  K Y E EF     KV+ +
Sbjct: 166 TVLPLQLVTAAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMI 224

Query: 221 LGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY 280
            GF+I    + CG   + G IG +YW +PG++  G          F G       AAF+Y
Sbjct: 225 AGFVILGIAINCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFSY 274

Query: 281 QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIF 339
            G E++ +TA E  NPRK++P A KKV+ RIL+ Y+L+   +  LVPYN  +L  S G  
Sbjct: 275 GGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGES 334

Query: 340 VS-SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLS 398
            S +SP +I++ + G K++P I NAV+LI+++S GNS++Y   R+L SLS+   AP+FL+
Sbjct: 335 ASHASPLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLN 394

Query: 399 NVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFM 458
            V R G P      T +   +AF+  S      F WLL I+G++  F W  I  SH+RF 
Sbjct: 395 YVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFR 454

Query: 459 QAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT-----FQPIDFVAA 513
            A+  +G+S   + YK+Q   + +++A     L+++ Q + A AP           F   
Sbjct: 455 DAMHAQGLSLGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQN 514

Query: 514 YISIFLFLAIWLSFQVWFK 532
           Y++  + L  +  ++V+ K
Sbjct: 515 YLAFPILLGAYFGYKVYHK 533

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  268 bits (686), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 155/465 (33%), Positives = 241/465 (51%), Gaps = 15/465 (3%)

Query: 39  TKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAH 98
           TK    +R V  D+ K           +K+ LK RH                     LA 
Sbjct: 48  TKRNIIQRMV--DSFKPPLDGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAV 105

Query: 99  AGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLS 158
            GP+  +I +   GT +      LGE+    PV  +F+ +  RFL P++      +Y L 
Sbjct: 106 GGPLALIIGWTVAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQ 165

Query: 159 WCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVI 218
           WCF   LE+      ++YW  +VP  AW+ IF+  +  +N+  V+ +GE EF  + IKV+
Sbjct: 166 WCFVLPLEIIAAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVL 225

Query: 219 ALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 278
            ++GFII    ++CG G     +G +YW +PG    G          F G  +  + A++
Sbjct: 226 TIIGFIILCVVLICGGGPKHEFVGAKYWSDPGPLANG----------FKGVAAVFVIASY 275

Query: 279 TYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGI 338
           +  GTE+  + +GE  +P K LP AIK+V  RI+ F+++SL  +G LVPY +  L   G 
Sbjct: 276 SLGGTEMACLASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENL-MGGS 332

Query: 339 FVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLS 398
            V +SPF+I+I   G K LP + NAV+L+++LS GNS ++  SR L S++   L PR   
Sbjct: 333 SVDNSPFVIAIRLHGIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFG 392

Query: 399 NVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFM 458
            + R G P   +L+   FG LAFL  S+ S   F WL+ I G+A    WL I+ SHIRF 
Sbjct: 393 YIDRAGRPLVGILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFR 452

Query: 459 QAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
            A++ +G+S D+L + + +  + + Y++    LI++ Q + +  P
Sbjct: 453 MAMKAQGVSLDELEFVSAVGVYGSVYSATINVLILVAQFYVSLWP 497

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  269 bits (687), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 158/517 (30%), Positives = 264/517 (51%), Gaps = 26/517 (5%)

Query: 29  VDEQYSGENVTKAITTERKVED------DAAKETESSPQERREVKRKLKQRHXXXXXXXX 82
           +D+ +   +    I+ + K         D+ K  E        +K+ LK RH        
Sbjct: 35  IDDNFIPHDTLSTISRKEKKPPIYRRIIDSFKPPEDGSFHTGNLKKSLKSRHLIMIAIGG 94

Query: 83  XXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRF 142
                        LA  GP+  +I +   G+ I      LGE+    PV  +F+ +  RF
Sbjct: 95  SIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGTIHGLGEITVRFPVVGAFASYTTRF 154

Query: 143 LSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPV 202
           L P++      +Y L W F   LE+      +QYW +++    ++ IF+C++ S+N+F  
Sbjct: 155 LDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWNDSIDPVVFVAIFYCVIVSINLFGA 214

Query: 203 KYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKN 262
           + +GE EF  +++K+I + GFII    ++ G G     IG +YW NPG+   G       
Sbjct: 215 RGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDHEYIGAKYWHNPGSLAHG------- 267

Query: 263 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFI 322
              F G +S L+ A+++  GTE+  + +GE  +P K LP AIK+V  RIL F+++SL  +
Sbjct: 268 ---FKGVLSVLVVASYSLGGTEMTCLASGE-TDP-KELPSAIKQVFWRILFFFLVSLTLV 322

Query: 323 GLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSR 382
           G LVPY +P L   G  V +SPF+I+I+    KVLP I NAV+L++ILS GNS ++  SR
Sbjct: 323 GFLVPYTNPNL-LGGSSVDNSPFVIAIKIHNIKVLPSIVNAVILVSILSVGNSCIFASSR 381

Query: 383 VLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVA 442
            L S++   L P +   + R G P   ++  S+FG LAFL  S+   + F+WL+ I G+A
Sbjct: 382 TLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLA 441

Query: 443 GFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFA 502
               WL I+  H+RF  A++ +  + D+L + + +  + + Y+    ALI++ Q + A  
Sbjct: 442 TCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAVGIWGSVYSGIVNALILVAQFYIALW 501

Query: 503 PTFQPID-------FVAAYISIFLFLAIWLSFQVWFK 532
           P     D       F   Y+   + + +++  +++++
Sbjct: 502 PIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKIYYR 538

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  270 bits (689), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 166/514 (32%), Positives = 270/514 (52%), Gaps = 19/514 (3%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERRE-VKRKLKQRHXXXXXXXXXXXX 86
           FVD     E++   I  + K+ +    E E+      + +K+ +K RH            
Sbjct: 74  FVDSFKRAEHM---IPADDKINEMTTAEPEAEMASVEDNLKQTIKPRHVIMISLGTGIGT 130

Query: 87  XXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSP 145
                    L  AGP G +  Y  MGT +Y + QS GEM V +  +   F+ +    + P
Sbjct: 131 GLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEP 190

Query: 146 A--LGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVK 203
              +    G ++ +  C +F +         +YWT  V    ++VIF+ L+  +N+F  +
Sbjct: 191 GFWVCCRLGVLFTMVDCLSFGIGYCF--DDYKYWTTRVDPDVFVVIFYVLIIVINVFGAR 248

Query: 204 YYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNE 263
            Y E EF     KV+ + GF I    +  G   +DG +G  YWRNPGA+       DK  
Sbjct: 249 GYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGI 303

Query: 264 GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIG 323
             F G V++L+ AAF + GTE + +TA E +NPRKA+P A KKV+ RI++ Y+ S+  IG
Sbjct: 304 DHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIG 363

Query: 324 LLVPYNDPKLDSDG-IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSR 382
            LVP+  P+L   G    ++SP++I++ + G +V+P   NAV+L+++LS GNS  Y  SR
Sbjct: 364 FLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSR 423

Query: 383 VLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVA 442
           +L SLSK   AP++   V R G P  +++ +++FG +AF   S    + F WLL I+G++
Sbjct: 424 LLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLS 483

Query: 443 GFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFA 502
             F W+ I  SHIRF  A++ +G S  ++ +KAQ   + +YY+ F + L ++ Q + A A
Sbjct: 484 QIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIA 543

Query: 503 P----TFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
           P         +F   Y+++ + +  +  +++W K
Sbjct: 544 PIGTAELSARNFFENYLAMPILIGFYFGYKIWKK 577

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  268 bits (684), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/490 (33%), Positives = 258/490 (52%), Gaps = 17/490 (3%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           DA  + E   + R  + R L  RH                     L   GP    I+Y  
Sbjct: 42  DAVTDLEDHDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTI 101

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
           MG V+Y     LGEM TF+P++ SF  +A++F   +        YW +   + A +L+ L
Sbjct: 102 MGGVVYLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTAL 161

Query: 171 GKVIQYWTEA---VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFS 227
             V+ YW  +    P  A  ++FW  L  +N+  V+ YGE E+ +A +KVIA++ F I +
Sbjct: 162 QLVLDYWKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILA 221

Query: 228 FCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 287
             V  G       IGF+YW    A  P +         F G+V+  +++AF+Y GTE + 
Sbjct: 222 IVVNVGHNPDHEYIGFKYWSYKEA--PFV-------NGFKGFVTIFVSSAFSYGGTESIT 272

Query: 288 ITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMI 347
           +TAGEA NP +  PR +K V  RIL+FY+ ++FFI + +PY+ P L +    V +SPF I
Sbjct: 273 LTAGEARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS--VMTSPFTI 330

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA-PRFLSNVTRGGVP 406
             + +GTK      NAV+L +I+SAGN  ++ GSRVLY++       P+ ++   R   P
Sbjct: 331 IFQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAP 390

Query: 407 YFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGI 466
           Y +V+ T   G L F     G+G  + WL NI GV+   AWL I+ + IRF + + ++G 
Sbjct: 391 YVAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGK 450

Query: 467 SRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLS 526
           ++ +L +K    P+  Y+   F+ LI+L+QG++AF P +   DF + Y+ +F+F   WL 
Sbjct: 451 TQ-ELQFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLI 508

Query: 527 FQVWFKCRLL 536
           + ++ + R +
Sbjct: 509 WWIFKRDRFV 518

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  269 bits (687), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 154/466 (33%), Positives = 242/466 (51%), Gaps = 12/466 (2%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
           +  T  IT+  +  D+   + E        + + L  RH                     
Sbjct: 58  KQTTNDITSSERSRDN--DDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTA 115

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMY 155
           L+  GP   +I ++ +GT +++V  SLGE+    PV   F+V+  RF+ P+        Y
Sbjct: 116 LSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNY 175

Query: 156 WLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASI 215
              W     LEL      I+YW + +   AW+ IF+  +   NM  VK +GE EF ++ I
Sbjct: 176 LAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMI 235

Query: 216 KVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEG-RFLGWVSSLI 274
           K+++++GF I    + CG G   G IG +YWRNPGA+         N G +F G  S  +
Sbjct: 236 KILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF------VGHNSGTKFKGLCSVFV 289

Query: 275 NAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL- 333
            AAF+Y G E+  ++A E+ NPR+ +P+A K+    I   Y+  L  IG LVP NDP+L 
Sbjct: 290 TAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLL 349

Query: 334 -DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392
             S  +  +SSP +I+IEN   K LP + NA++LI ++S  NS VY  SR + +++    
Sbjct: 350 NGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGN 409

Query: 393 APRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISF 452
            P+FL+ V + G P  ++L T  FG L+F+  S    + F WL  ++G++  F W+ I+ 
Sbjct: 410 LPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINL 469

Query: 453 SHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGF 498
           SHIRF +A++ +  S D+LP+ +Q     ++Y  F +  +VLI  F
Sbjct: 470 SHIRFRKAMKVQERSLDELPFISQTGVLGSWYG-FVVLFLVLIASF 514

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  268 bits (685), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 169/479 (35%), Positives = 252/479 (52%), Gaps = 18/479 (3%)

Query: 66  VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM 125
           +KR LK RH                     LA AGP G LI +   GT+IY +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 126 VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLA 184
               P+   F+ +A RF+  + G     +Y L W     LE+      + YW T      
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244
            ++ +F+ ++ ++N F VK YGE EF  + IKVI ++G+II    +VCG G   G IG R
Sbjct: 196 GFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGR 255

Query: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304
            W NPGA+  G          F G  S  + AAF++ G+ELVG+ A E ANPRK+LP A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAA 305

Query: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNA 363
           K+V  RI +FYIL+L  +GLLVPY   +L     +  ++SPF+ISI+N+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 364 VVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLE 423
           V+LI +LS GNS V+  SR + +L+     P+    + R G P   ++ T VFG L+F+ 
Sbjct: 366 VILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIA 425

Query: 424 VSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAY 483
            S   G+ F+WLL ++G++  F W  I   HIR  +A+  +  +  +L + A    + + 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSV 485

Query: 484 YASFFIALIVLIQGFTAFAPTFQPID---FVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
           Y    I LI++ Q + A  P         F  AY+S  + +A ++  ++W K    WKL
Sbjct: 486 YGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKN---WKL 541

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  269 bits (688), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/507 (31%), Positives = 259/507 (51%), Gaps = 19/507 (3%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           D +  G+   +    ER V D A        +   ++ + L  RH               
Sbjct: 81  DMEVDGKRYKEMTDVERAVCDAA--------RNSSQLSKNLSIRHLLTLAVGGAIGTGLF 132

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 L   GP   LI++  + T ++++  SLGE+ +  PV   F+V+  RF+ P+ G 
Sbjct: 133 VNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGF 192

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
                Y   W     LEL+     I+YW   +   AW+ IF+  +   NM  VK +GE E
Sbjct: 193 AVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETE 252

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F ++ +K++A+ GF I    ++CG G   G IG +YW +PGA+       D    +F G 
Sbjct: 253 FVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQFKGL 307

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
            S  + AAF+Y GTELVG++A E+ NPR  +PRA K+    I   Y+L L   G LVP N
Sbjct: 308 CSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSN 367

Query: 330 DPKL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           DP+L      + V++SP +I+IEN G + +P + NA++LI I+S  NS+VY  SR + S+
Sbjct: 368 DPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSM 427

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           ++    P+  + + R G P  ++L+T VFG L+F+  S      F WL  ++G++  F W
Sbjct: 428 AQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCW 487

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTF-- 505
             I+ SHIRF +A+  +  S D+LPY +      ++Y +  +  ++++  +T+  P    
Sbjct: 488 FAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSS 547

Query: 506 --QPIDFVAAYISIFLFLAIWLSFQVW 530
                 F   Y+S  +FL  ++S +++
Sbjct: 548 GPSAESFFEGYLSFPIFLICYISHKLY 574

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  266 bits (681), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 154/453 (33%), Positives = 241/453 (53%), Gaps = 13/453 (2%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D+ K  E+   +   +KR LK RH                     LA  GP+  +I +L 
Sbjct: 62  DSFKPPENGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLI 121

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
            GT +      LGE+    PV  +F+ +  RFL P+L      +Y L W F   LE+   
Sbjct: 122 AGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIAS 181

Query: 171 GKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCV 230
              IQ+W  ++    W+ IF+  + ++N+F V+ +GE EF  +SIKVI + GFII    +
Sbjct: 182 AMTIQFWNTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVL 241

Query: 231 VCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITA 290
           + G G +   +G RYW +PGA   G          F G  S  + A+++  G+E+  + +
Sbjct: 242 IVGGGPTHEYVGARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEMACLAS 291

Query: 291 GEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIE 350
           GE  +P K LP AIK+V  RI+ F+++SL  +G LVPY +  L   G  V++SPF+I+  
Sbjct: 292 GE-TDP-KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNL-LGGSSVNNSPFVIACN 348

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
               KVLP I NAV+L++I+S GNS ++  SR L S++   L P+    V R G P   +
Sbjct: 349 LYHIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGI 408

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
           ++ S+FG LAFL  S+   + FNWL+ I G+A    WL I+ SHIRF  A++ +  + D+
Sbjct: 409 ITNSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDE 468

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
           L + + +  + + Y++    LI++ Q + +  P
Sbjct: 469 LEFVSAVGIWGSVYSAVVNVLILIAQFYISLWP 501

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  268 bits (685), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 155/498 (31%), Positives = 260/498 (52%), Gaps = 12/498 (2%)

Query: 40  KAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           K   ++   +D+  ++   S +    +K+ +K RH                     L  A
Sbjct: 60  KRAESQHLEDDNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLA 119

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLS 158
           GP   +I Y+ +  V Y + Q+ GEM VT+  +  +F+ +   F+S + G    +++ + 
Sbjct: 120 GPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQ 179

Query: 159 WCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVI 218
           W     LEL      I+YW + +    +IVIF+  L  ++ F VK YGE EF  +S K++
Sbjct: 180 WLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKIL 239

Query: 219 ALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 278
            + GFII S  + CG    DG IG +YWR+PG++  G         RF G    L+ A F
Sbjct: 240 MIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----NGATRFKGICFILVTAYF 294

Query: 279 TYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGI 338
           ++ G EL  ++  E +NPRK+ P A K+ V RIL+ Y+L++  IG  VP+N+ +L   G 
Sbjct: 295 SFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGS 354

Query: 339 FVS-SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL 397
             + +SP++++      +V+P I NAV+LI+++S  NS +Y   R++ SL++   AP+FL
Sbjct: 355 AATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414

Query: 398 SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457
             + R G P  ++    + G + F+  S    +AF WL  I G++  F W  I  SHIRF
Sbjct: 415 DYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRF 474

Query: 458 MQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVA 512
            +A++ +G S D++ YKA    + +YY  FF  L+ + Q + A +P           F  
Sbjct: 475 RKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFE 534

Query: 513 AYISIFLFLAIWLSFQVW 530
           +Y++  L+L ++L + ++
Sbjct: 535 SYLAAPLWLCMYLGYMLY 552

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  268 bits (684), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/505 (31%), Positives = 262/505 (51%), Gaps = 14/505 (2%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQ---ERREVKRKLKQRHXXXXXXXXXXXX 86
           +E  SG  V + + + ++ +D    + E   +   +   +K+ +K RH            
Sbjct: 37  EESRSGL-VHRFVDSFKRAQDSTENDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGT 95

Query: 87  XXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSP 145
                    L++ GP   +I Y+ +  V Y + Q+ GEM    P +  +F+ +   F+S 
Sbjct: 96  GLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISK 155

Query: 146 ALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYY 205
             G    +++++ W   F LEL      I+YW + +    +IVIF+  L  ++ F VK Y
Sbjct: 156 PFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAY 215

Query: 206 GEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGR 265
           GE EF   S KV+ + GFII S  + CG    DG IG +YWR+PG++  G    D  E +
Sbjct: 216 GEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEG----DSVE-K 270

Query: 266 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLL 325
           F G    L+ A F+Y G EL  ++  E  NPRK+ P+A K+ + RIL+ Y+L++  IG  
Sbjct: 271 FKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFN 330

Query: 326 VPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVL 384
           VP+N+ +L  S G    +SP++++    G KV+P   NAV+LI+++S  NS +Y   R++
Sbjct: 331 VPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLM 390

Query: 385 YSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGF 444
            SL++   AP+FL  V R G P  +++  +VFG + F+  S+   + F WL  I G++  
Sbjct: 391 CSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSEL 450

Query: 445 FAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT 504
           F W  I  SH+RF Q ++  G S +++ ++A    + + Y   F  L+ + Q + A AP 
Sbjct: 451 FTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPP 510

Query: 505 --FQPIDFVAAYISIFLFLAIWLSF 527
                +D   ++   +L   IWL F
Sbjct: 511 SLHGKVD-AESFFQSYLAAPIWLFF 534

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  268 bits (685), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 161/507 (31%), Positives = 258/507 (50%), Gaps = 9/507 (1%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           F D     E  T  I    +   D     +S   + + +K+ +K RH             
Sbjct: 54  FTDSFKRAEGSTTKIKPINENTSDLEDGIQSFTSDSK-LKKSMKSRHVVMMSLGTGIGTG 112

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPA 146
                   L + GP   +I Y+ +  + Y + Q+ GEM VT+  + ++F+ ++  F+S  
Sbjct: 113 LLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKP 172

Query: 147 LGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYG 206
            G    ++Y   W     LEL      IQ+W + +    +I+IF+  L  ++ F VK YG
Sbjct: 173 FGFATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYG 232

Query: 207 EFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRF 266
           E EF     K++ + GFI+ S  + CG   +DG IG  YW  PGA+     + D +  RF
Sbjct: 233 ETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARF 287

Query: 267 LGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV 326
                 L+ A F++ G EL  ++  E  NPRK+ P A K+ + RI+V Y+L++  IG  V
Sbjct: 288 KNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNV 347

Query: 327 PYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLY 385
           PYND +L  + G    +SP++++    G +++P I NAV+LI+++S  NS++Y G R++ 
Sbjct: 348 PYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLIC 407

Query: 386 SLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFF 445
           SL++   AP+FL  V R G P  +++   V G +AF+  S+     F WL  I G++  F
Sbjct: 408 SLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELF 467

Query: 446 AWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTF 505
            W  I  SH+RF QA++ +G S ++L YKA    + + Y SFF  L+ + Q + A AP  
Sbjct: 468 TWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLG 527

Query: 506 QPIDFVA-AYISIFLFLAIWLSFQVWF 531
                 A A+   +L   IWL F + +
Sbjct: 528 NGGKCNAEAFFESYLAAPIWLIFYIGY 554

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  268 bits (684), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 161/514 (31%), Positives = 262/514 (50%), Gaps = 16/514 (3%)

Query: 32  QYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXX 91
           Q +    TK I       D      E    +   + + L  RH                 
Sbjct: 57  QTTSSGATKNINGTSNPNDSNMLSKED--IDGSNLNKDLNIRHLLTLAVGGAIGTGLFVN 114

Query: 92  XXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATN 151
               L   GP   +I ++ + T +++V  SLGE+    PV   FSV+  RF+ P++  + 
Sbjct: 115 SGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSI 174

Query: 152 GYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFC 211
              Y + W     LEL      I+YW + +   AW+ IF+ ++  +NM  VK +GE EF 
Sbjct: 175 NLNYLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFV 234

Query: 212 IASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVS 271
           ++ IK++A++GF I    + CG G   G IG +YW +PGA+      S     +F G  S
Sbjct: 235 LSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAFVGHTAGS-----QFKGLCS 289

Query: 272 SLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDP 331
             + AAF+Y G E++ ++A E+ +PRK +P A K+    I   Y+  L  IG LVPY+DP
Sbjct: 290 VFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDP 349

Query: 332 KL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           +L   S  + V+SSP +I+IEN G K LP + NA++LI +LS  NS VY  SR + S++ 
Sbjct: 350 RLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAI 409

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
               P+ L  + + G P  + L T  FG ++F+  S    + F WL  ++G++  F W+ 
Sbjct: 410 IGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMG 469

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----F 505
           I+ SHIRF +A+  +G S +++PY +Q+  + ++Y    + L+++   +T+  P      
Sbjct: 470 INISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQA 529

Query: 506 QPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
               F   Y+S+ + LA ++  + +FK    W+L
Sbjct: 530 NATTFFEGYLSLPILLACYVGHKFYFKN---WRL 560

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  269 bits (688), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 160/492 (32%), Positives = 253/492 (51%), Gaps = 12/492 (2%)

Query: 48  VEDDAAKETES-SPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           + DD    T S +  E    K  +K RH                     L  +GP G ++
Sbjct: 135 LNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVV 194

Query: 107 SYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
            Y  +  V Y V Q+ GEM    P +   F+ +   F+S   G    +++ L+W     L
Sbjct: 195 GYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPL 254

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           EL      ++YWT ++    +++IF+  L  ++   ++ Y E EF   S K++ + GFII
Sbjct: 255 ELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFII 314

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTEL 285
           FS  V CG    DG IG +YW +PG +     +SD    RF      LINA F+Y GTEL
Sbjct: 315 FSIVVNCGGAGHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTEL 369

Query: 286 VGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPF 345
             ++  E  NPRKA+P A K  V R+ + Y+L++  IG  VPYN P L  +     +SP+
Sbjct: 370 YVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDASPY 429

Query: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGV 405
           +++ +  G K++P   NAV+L++++S  NS ++ G R+L +L++   AP+FL+ V R G 
Sbjct: 430 VLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGR 489

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           P  ++   S+FG +AF   S    + F WL  I G++  FAW  I  SHIRF  A++  G
Sbjct: 490 PLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHG 549

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-AP----TFQPIDFVAAYISIFLF 520
            S D++ YKA    + +YY  FF  L+++ Q + A  AP        I F  +Y++  ++
Sbjct: 550 KSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIW 609

Query: 521 LAIWLSFQVWFK 532
           +  +L + ++ K
Sbjct: 610 VFFYLCYMIYNK 621

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  266 bits (680), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 162/494 (32%), Positives = 254/494 (51%), Gaps = 19/494 (3%)

Query: 44  TERKVEDDAAKETESSPQERRE-------VKRKLKQRHXXXXXXXXXXXXXXXXXXXPPL 96
           TE +V+    +  E     R +       VKR+LK RH                     L
Sbjct: 27  TEMEVDPKNNEYAEEQSLNREDTFDPDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNAL 86

Query: 97  AHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYW 156
           A  GP+  L+ +  +G + + + +S+GEM+T  P    F+   +RF S AL A  GY Y 
Sbjct: 87  AIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYA 146

Query: 157 LSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIK 216
           + +    A E + L  ++Q+W   VPL  +I+IFW       +  V  +GE E+ +A  K
Sbjct: 147 VVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFK 206

Query: 217 VIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINA 276
           ++ LL + IFS   + G  ++    GF+YW +PGA   G          F G  +  +  
Sbjct: 207 ILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALSNG----------FKGIANVFVFC 256

Query: 277 AFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSD 336
           +  Y GTE V + A E+ NPR+A+P AI++   RIL+ Y+    F G+ VPYND  L+  
Sbjct: 257 STFYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNF- 315

Query: 337 GIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRF 396
              V  SP  I+I  +G      + NA +LIT +SA N ++YIGSR L  L+   LAP+ 
Sbjct: 316 ATKVLKSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKL 375

Query: 397 LSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIR 456
           L+   R GVP  ++   +  G ++ + VS  +  A+N+++N++GV  F  W +IS +H+R
Sbjct: 376 LAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLR 435

Query: 457 FMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYIS 516
           F +A + +G +RD+LPYKA++ P     +      + L+QG++ F P F   +FV AYI 
Sbjct: 436 FRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYIL 494

Query: 517 IFLFLAIWLSFQVW 530
           I   + ++L    W
Sbjct: 495 IPAGIILYLGVSYW 508

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  266 bits (681), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 165/490 (33%), Positives = 258/490 (52%), Gaps = 20/490 (4%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D+ K           +KRKLK RH                     LA  GP+  +I +  
Sbjct: 55  DSFKPPLDGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSI 114

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
            G+ +      LGE+    PV  +F+ ++ R L P++      +Y   W F   +EL   
Sbjct: 115 AGSQMVGTIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIAS 174

Query: 171 GKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCV 230
              +Q+WT  V    W+ IF+ ++ S+N+F VK +GE EF  + +KVI ++GFII S  +
Sbjct: 175 AMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIIL 234

Query: 231 VCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITA 290
           +CG G     IG  YW +PGA   G          F G  S  + A+++  G+E+V + +
Sbjct: 235 ICGGGPDHRFIGTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCS 284

Query: 291 GEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIE 350
            E  +P K LP AIK+V  RI+ F+++SL  +G LVPY +  L   G  V++SPF+I+I+
Sbjct: 285 AET-DP-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENL-LGGSSVNNSPFVIAIK 341

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
            SG +VLP I NAV+LI+ILS GNS ++  SR L S++   L PR    V R G P   +
Sbjct: 342 LSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGI 401

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
           +  S+FG LAFL  SA  G  F+WL+ I G+A    WL I+ SHIRF  A++ +  S D+
Sbjct: 402 IVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDE 461

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTF-------QPIDFVAAYISIFLFLAI 523
           L +K+ +  + + Y++    LI++ Q + +  P         +   F   Y+   + + +
Sbjct: 462 LEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFV 521

Query: 524 WLSFQVWFKC 533
           +++ +++FKC
Sbjct: 522 FVTHKIYFKC 531

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  266 bits (681), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 161/495 (32%), Positives = 251/495 (50%), Gaps = 9/495 (1%)

Query: 40  KAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           K +  E +   D  ++ E +     ++K+ +K RH                     L   
Sbjct: 46  KRVEGEVRNSSDL-EDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFG 104

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLS 158
           GP G LI Y F+  + Y + Q+ GEM    P +  +F+ ++  F+S   G    +++ + 
Sbjct: 105 GPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQ 164

Query: 159 WCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVI 218
           W     LEL     V++YWT  +    +++IF+  +  ++    + YGE EF   S KV+
Sbjct: 165 WTTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVL 224

Query: 219 ALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 278
            + GFII    + CGA   DG IG +YW  PGA+  G         RF G    L+ A F
Sbjct: 225 MVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTAYF 279

Query: 279 TYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGI 338
           +Y G EL  ++  E  NPRKA+P A  K V RIL+ Y+L++  IG LVP++  KL   G 
Sbjct: 280 SYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGS 339

Query: 339 F-VSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL 397
             V  SP+++++   G K++P I NAV+LI+++S GNS +Y G R+L SL++   AP+ L
Sbjct: 340 SGVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKIL 399

Query: 398 SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457
             V R G P  +++  SVFG +AF+  S      F WL  I+G++  F W  I  SH RF
Sbjct: 400 DYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRF 459

Query: 458 MQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDF-VAAYIS 516
            +A++ +G S + L Y++    + + YA  F   +++ Q + A  P      F V +   
Sbjct: 460 RRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFK 519

Query: 517 IFLFLAIWLSFQVWF 531
             L L +WLS  V +
Sbjct: 520 SCLALPLWLSMAVGY 534

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  265 bits (677), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 159/470 (33%), Positives = 246/470 (52%), Gaps = 16/470 (3%)

Query: 46  RKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGAL 105
           +++E D+  E +        VKR LK RH                     L   GP+  L
Sbjct: 26  QRLETDSLNEFD----PHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALL 81

Query: 106 ISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
           + +  +G V +S+ +S+GE+VT  P    F   A+RF S  L A +GY Y + +    A 
Sbjct: 82  LGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLAN 141

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           E + +  ++Q+W   VP+  + +IFW       +  V  +GE E+ +A  K++ L+ F I
Sbjct: 142 EYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYI 201

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTEL 285
           FS   + G      PIGF+YW+NPGA   G          F G     +  +  Y GTE 
Sbjct: 202 FSIVYMSGGIPGKPPIGFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTES 251

Query: 286 VGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPF 345
           V + A E+ NPRKA+P A+++   RIL+ Y+   FF G+ VPYNDP L +    +  SP 
Sbjct: 252 VALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSL-KSPI 310

Query: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGV 405
            I++  +G      + NA +L+T +SA NS++YIGSR L  L+   LAPR L+   + GV
Sbjct: 311 SIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGV 370

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           P  +++  +  G ++ + VS G+  A+N+++N++GV  F  W  IS +H+RF +A   +G
Sbjct: 371 PVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQG 430

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYI 515
            S  +LPY+A   P+   ++      + LIQG+T+  P F   DFV AYI
Sbjct: 431 RSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYI 479

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  268 bits (684), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 151/517 (29%), Positives = 266/517 (51%), Gaps = 15/517 (2%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           D++ + E++   + +            + +  +   +++ ++ RH               
Sbjct: 83  DDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVLMMSLGTGIGTGLL 142

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALG 148
                 L+ AGP   +I Y  MG+ +Y + Q+ GEM V +  +  +F+ +    +   + 
Sbjct: 143 VGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGMA 202

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
               ++Y L W     LEL      I YWT  V    ++VIF+ L+T +N F  K Y E 
Sbjct: 203 FGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLITLINTFGAKGYAEA 262

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF   S KV+ + GF I +  +  G   +DG IG +YW NPGA+       DK+  RF  
Sbjct: 263 EFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKD 317

Query: 269 WVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY 328
            +S+   AAF +  +E + I A E +NPR+A+P A K ++ RIL  ++ S+  +G LVPY
Sbjct: 318 VMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPY 377

Query: 329 NDPKL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYS 386
           +  +L          +SP++I++ + G +V+P   NAV+L+++LS  NS  Y   R+LYS
Sbjct: 378 DSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSSCRILYS 437

Query: 387 LSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFA 446
           L++   AP++   + R G P  ++L T++FG +AF   S      F WLL+I G++  F 
Sbjct: 438 LAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFT 497

Query: 447 WLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP--- 503
           W  I  SHIRF +A++ +G S D++ +K+Q+  + + YA+  + L ++ + + + AP   
Sbjct: 498 WTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVSIAPIGE 557

Query: 504 -TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
                 +F   Y+++ + + ++  ++++ K    WKL
Sbjct: 558 DHLDAQNFFENYLAMPILIVLYFGYKIYKKD---WKL 591

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  266 bits (681), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 152/461 (32%), Positives = 239/461 (51%), Gaps = 11/461 (2%)

Query: 43  TTERKVEDDAAKETESSPQE---RREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           TT      D  +  E + QE      + + L  RH                     L+  
Sbjct: 60  TTNDITSSDRFRRNEDTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTG 119

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSW 159
           GP   +I ++ + T +++V  SLGE+    PV   F+V++ RF+ P+        Y   W
Sbjct: 120 GPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQW 179

Query: 160 CFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIA 219
                LEL      I+YW + +   AW+ IF+  +   NM  VK +GE EF ++ IK+++
Sbjct: 180 LVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILS 239

Query: 220 LLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFT 279
           ++GF I    + CG G   G IG +YW +PGA+         +  +F G  S  + AAF+
Sbjct: 240 IIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFS 294

Query: 280 YQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDG 337
           Y G E+  ++A E+ NPR+ +P+A K+    I   Y+  L  IG LVP NDP+L   S  
Sbjct: 295 YSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSS 354

Query: 338 IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL 397
           +  +SSP +I+IEN G K LP + NA++LI ++S  NS VY  SR + +++     P+FL
Sbjct: 355 VDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFL 414

Query: 398 SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457
           + V + G P  ++L T  FG L+F+  S    + F WL  ++G++  F W+ I+ SHIRF
Sbjct: 415 NRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRF 474

Query: 458 MQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGF 498
            QA++ +  S D+LP+ +Q     ++Y  F +  +VLI  F
Sbjct: 475 RQAMKVQERSLDELPFISQTGVKGSWYG-FIVLFLVLIASF 514

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  266 bits (680), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 159/506 (31%), Positives = 262/506 (51%), Gaps = 17/506 (3%)

Query: 37  NVTKAITTERKVEDDAAKE-----TESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXX 91
           + TK + + R+ ED  A       ++S   +   +K+ +K RH                 
Sbjct: 44  HFTKFVDSFRRAEDKHADSDLEDGSKSITSDDDHMKKAMKSRHVIMMTLGTGIGTGLLVA 103

Query: 92  XXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGAT 150
               LA AGP   ++ Y  +  V Y + Q+ GEM VT+  + +SF+ +A  F+S   G  
Sbjct: 104 NGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFA 163

Query: 151 NGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEF 210
             +++ + W     LEL      I+YW + +    +IVIF+  L  ++ F VK YGE EF
Sbjct: 164 TVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEF 223

Query: 211 CIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWV 270
              S K++ + GFII S  + CG    DG IG +YW NPGA+     +S+    RF G  
Sbjct: 224 IFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAF-----ASESPAARFKGVA 278

Query: 271 SSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN- 329
             L+   F+Y GTEL  ++  E  NPRK+ P A K+ + RIL+ Y+L++  IG  VP++ 
Sbjct: 279 YILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDS 338

Query: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           D  + + G    +SP++++    G KV+P   NAV+LI+++S  NS +Y   R++ SL++
Sbjct: 339 DQLMGAGGSATHASPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAE 398

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
              AP++ + V R G P  ++    +FG + F+  S    +AF WL  I G++  F W  
Sbjct: 399 QGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSS 458

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----T 504
           I  SHIRF  A++ +G S ++L Y+A    + + Y+ FF  L+ + Q + A +P      
Sbjct: 459 IFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGK 518

Query: 505 FQPIDFVAAYISIFLFLAIWLSFQVW 530
           +    F  +Y++  L+L  +  + ++
Sbjct: 519 YDAEGFFESYLAAPLWLVFYFGYMIY 544

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  265 bits (678), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 155/508 (30%), Positives = 262/508 (51%), Gaps = 20/508 (3%)

Query: 31  EQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXX 90
           + +    V  A+  E K  D+   +T+ +      +K  +K RH                
Sbjct: 39  DSFKRAQVDTAVDLEGKDADNGLNKTQQT------LKHNIKTRHLTMISLGTGIGTGLLV 92

Query: 91  XXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGA 149
                L   GP G +I Y+   T++Y V Q+  E+ V +  +  +++ +    +    G 
Sbjct: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
               +Y L W     LEL      ++YWT +V    ++ IF+  L  ++ F  + Y E E
Sbjct: 153 AVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F   S+KV+ + GFII +  +  GA +  G IG +YW +PGA+G      D+   RF G 
Sbjct: 213 FIFNSLKVLLMAGFIIMAISLTAGASE-QGYIGGQYWHDPGAFG-----GDRAIDRFKGI 266

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
            S  + AAF Y G+E + +TA E ANPR+++P+A K+ + R++V ++L +  IG LVP+N
Sbjct: 267 CSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHN 326

Query: 330 DPKLDS--DGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
             +L S   G    +SPF+I+    G +V+P I N ++L +++S GNS +Y   R+L SL
Sbjct: 327 SDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSL 386

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           +++ + P+  + V R G P  +++  S+FG +AF+  S      F WL  I G++  F W
Sbjct: 387 AEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTW 446

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFA--PTF 505
             I+ SH+RF +A+R +G S  +L Y+A      +YYA FF  ++++ Q + A A  P  
Sbjct: 447 TAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKH 506

Query: 506 QPID---FVAAYISIFLFLAIWLSFQVW 530
             +D   F   Y++  + +  +L +++W
Sbjct: 507 GELDVEFFFQNYLAFPVLVVFYLGYKLW 534

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  265 bits (676), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 147/476 (30%), Positives = 252/476 (52%), Gaps = 11/476 (2%)

Query: 62  ERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQS 121
               + + L  RH                     L+  GP   ++ ++ + T +++V  S
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181
           LGE+    P+   F+V+  RF+ P++G      Y   W     LEL      I+YW + +
Sbjct: 99  LGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDKI 158

Query: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241
              AW+ IF+  +   NM  VK +GE EF ++ +K++A++GF I    +  G G S G +
Sbjct: 159 NSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYL 218

Query: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301
           GF+YW NPGA+  G      N  +F G  S  + AAF++ G E++ ++A E+ NPRK +P
Sbjct: 219 GFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIP 273

Query: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSSSPFMISIENSGTKVLPD 359
           +A K+    +   Y++ L  +G LVPYND +L   +  +  ++SP +I+IEN G K LP 
Sbjct: 274 KAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPS 333

Query: 360 IFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFL 419
           + NA++LI I+S  NS VY  SR + S++     P+ LS V + G P  +++ T +FG L
Sbjct: 334 LMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLL 393

Query: 420 AFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMP 479
           +F+  S    + F WL  ++G++  F W+ I++S IRF +A++ +  S D+LPY +Q   
Sbjct: 394 SFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGI 453

Query: 480 FLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISIFLFLAIWLSFQVWF 531
           + A+Y    + L+++   +T+  P          F  +++S+ + L  +   +++F
Sbjct: 454 WGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYF 509

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  266 bits (681), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 158/515 (30%), Positives = 267/515 (51%), Gaps = 16/515 (3%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQ----RHXXXXXXXXX 83
           F+D     EN       + ++    ++  E   ++  +   KLK+    RH         
Sbjct: 74  FIDSFKPAENPQPHTNLDMELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTG 133

Query: 84  XXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRF 142
                       LA AGP G +I Y  MG++IY + Q+ GEM V ++ +   F+ +    
Sbjct: 134 IGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFL 193

Query: 143 LSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP- 201
           + P       ++Y L W     LEL      I+YWT  V    +++IF+  +  +N+   
Sbjct: 194 IDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGINILGG 253

Query: 202 VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDK 261
            + Y E EF   S K++ ++GF I    ++CG   +DG IG RYW +PGA+       ++
Sbjct: 254 ARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAF-----RGER 308

Query: 262 NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFF 321
              RF G V++L+ AAF++  +E + +TA E +NPR+A+P A KK++ R L  Y+ S+  
Sbjct: 309 AVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIIL 368

Query: 322 IGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVY 378
           +G LVPYN  +L    S+GI   +SP+++++ N G +V+P   NAV++I++LS  NS  Y
Sbjct: 369 LGFLVPYNSSQLLGAQSNGI--KASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFY 426

Query: 379 IGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNI 438
              R+L +LS+   AP+  S V R G P   ++  S+F  +AF   S    + F WLL +
Sbjct: 427 SSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAV 486

Query: 439 TGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGF 498
           +G++  F W+ I  SH+RF +A+  +G S  +  + +Q+  + + Y+ F +ALI++ Q +
Sbjct: 487 SGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFW 546

Query: 499 TAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKC 533
            A  P         ++   +L   IW++  + +KC
Sbjct: 547 VALKPVGSKKVDANSFFENYLAAPIWIALYIGYKC 581

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  265 bits (676), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 154/485 (31%), Positives = 257/485 (52%), Gaps = 28/485 (5%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D+ K       +   +KR LK RH                     LA  GP+  LI +  
Sbjct: 53  DSFKPPVDGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTL 112

Query: 111 MGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170
            GT +      LGE+    PV  +F+ ++ RFL P++      +Y L W F   LE+   
Sbjct: 113 AGTQMVGTIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIAS 172

Query: 171 GKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCV 230
              +++WT +V    W+ +F+ L+ S+N+F V+++G+ +F  + IK++ + GFII    +
Sbjct: 173 AITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVL 232

Query: 231 VCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITA 290
           + G G +   IG RYW +PGA   G          F G  + ++ A+++  G+E+  + +
Sbjct: 233 ILGGGPTHEFIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLAS 282

Query: 291 GEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIE 350
           GE  +P K +P AIK++  RI+ F+++SL  +G LVPY + +L   G  V++SPF+I+I+
Sbjct: 283 GET-DP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQL-LGGSNVNNSPFVIAIK 339

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
               +VLP I N V+L++ILS GNS ++  SR L S++   L PR    V R G P   +
Sbjct: 340 MHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGI 399

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
           L+ S+FG LAFL  S+ +G  F WL+ + G+A    WL I+ SHIRF  A++ +G S D+
Sbjct: 400 LTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDE 459

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT-------------FQPIDFVAAYISI 517
           L + + +  + + Y+     ++++ Q + +  P              FQ  +++ A I +
Sbjct: 460 LEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQ--NYLCALILL 517

Query: 518 FLFLA 522
           F+F+A
Sbjct: 518 FMFVA 522

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  265 bits (676), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 157/499 (31%), Positives = 259/499 (51%), Gaps = 14/499 (2%)

Query: 43  TTERKVEDDAAKETESSPQER---REVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           + +  +ED+    ++SS  +    + + + L  RH                     LA  
Sbjct: 52  SKDSPIEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASG 111

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSW 159
           GP   +I ++ + T +++V  SLGE+    PV   F+V+  RF+ P+        Y   W
Sbjct: 112 GPASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQW 171

Query: 160 CFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIA 219
                LEL      I+YW   +   AW+ IF+ ++T  NM  VK +GE EF ++ +K++A
Sbjct: 172 LVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILA 231

Query: 220 LLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFT 279
           ++GF I    + CG G   G +G +YW NPGA+  G  S  K    F G  S  + AAF+
Sbjct: 232 IIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAF-VGHTSGTK----FKGLCSVFVTAAFS 286

Query: 280 YQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS--DG 337
           Y G E+  ++A E+ +PRK +P+A K+    I   Y+  L  +G LVPY+DP+L S    
Sbjct: 287 YSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSS 346

Query: 338 IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL 397
           +  ++SP +I+IEN G K L  + NA++LI+I+S  NS VY  SR + S++     P+ L
Sbjct: 347 VDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKL 406

Query: 398 SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457
             V + G P  + L T  FG L+F+  S    + F WL  ++G++  F W+ I+ SHIRF
Sbjct: 407 GKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRF 466

Query: 458 MQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFVAA 513
            QA+ K+  S D++PY +Q   + + Y    + L+++   +T+  P    +     F   
Sbjct: 467 RQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEG 526

Query: 514 YISIFLFLAIWLSFQVWFK 532
           Y+S+ + +  ++  +++FK
Sbjct: 527 YLSLPILIVCYIGHKLYFK 545

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  266 bits (681), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 164/519 (31%), Positives = 277/519 (53%), Gaps = 23/519 (4%)

Query: 32  QYSGENVTKAITTERKVEDD-----AAKETESSPQERR------EVKRKLKQRHXXXXXX 80
           + S E  T +IT+   + D+     +  + +  P  R+      E+K+ +K RH      
Sbjct: 104 KNSPEKDTASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSDELKKTIKPRHVLMISL 163

Query: 81  XXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFA 139
                          L  AGP G L+ +  MGT +Y + Q++GEM V +  +   F+ + 
Sbjct: 164 GTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYP 223

Query: 140 QRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM 199
              + PA G +  ++Y L W     LEL      I+YWT  V    +++IF+ L+ ++N+
Sbjct: 224 SFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVLILAINI 283

Query: 200 FP-VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIIS 258
                 Y E EF   S K++ ++GF I    ++CG   +DG IG +YW  PGA+      
Sbjct: 284 VGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAF-----R 338

Query: 259 SDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILS 318
            +    RF G +++L+NAAF +  +E +G+TA E +NPRKA+P A KK++ RI+  ++ S
Sbjct: 339 GEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLAS 398

Query: 319 LFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNV 377
           +  +G LVPY+ D  L S G  V +SP+++++   G KV+P   NAV+LI++LS  NS  
Sbjct: 399 ITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVANSAF 458

Query: 378 YIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLN 437
           Y  SR+L SL++   AP+    + R G P   +   S+FG +AF   S    + F WLL 
Sbjct: 459 YSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVWLLA 518

Query: 438 ITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQG 497
           I+G++  F W+ I  SH+RF +A+  +G S  +L +++Q+  + + YA+  +  I++ Q 
Sbjct: 519 ISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQF 578

Query: 498 FTAFAP----TFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
           + A AP         +F   Y+++ + LA++  ++++ K
Sbjct: 579 WVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTK 617

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  261 bits (667), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 149/447 (33%), Positives = 231/447 (51%), Gaps = 16/447 (3%)

Query: 43  TTERKVED---DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           +T R V     D+ K  E        +K+ LK RH                     LA  
Sbjct: 47  STNRNVLQRMVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALG 106

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSW 159
           GP+  +I +   GT +      LGE+    PV  +F+ +  RFL P++      +Y L W
Sbjct: 107 GPLALIIGWTIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQW 166

Query: 160 CFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIA 219
           CF   LE+      ++YW  +V    W+ IF+ ++  +N+  V+ +GE EF  + IKVI 
Sbjct: 167 CFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVIT 226

Query: 220 LLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFT 279
           ++GFII    ++CG G     +G +YW +PG    G          F G    L+ A+++
Sbjct: 227 IVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYS 276

Query: 280 YQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIF 339
             GTE+  + +GE  +P K LP AIK+V  RI+ F+++SL  +G LVPY +  L   G  
Sbjct: 277 LGGTEMACLASGE-TDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNL-MGGSS 333

Query: 340 VSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN 399
           V +SPF+I+I   G   LP I NAV+L+++LS GNS ++  SR L S++   L PR    
Sbjct: 334 VDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGY 393

Query: 400 VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQ 459
           + R G P   +L+  +FG LAFL  S  +G  F WL+ I G+A    WL I+ SHIRF  
Sbjct: 394 IDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRL 453

Query: 460 AIRKRGISRDDLPYKAQMMPFLAYYAS 486
           A++ +G+  ++L + + +  + + Y++
Sbjct: 454 AMKAQGVDLEELEFVSGVGIYGSVYSA 480

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  264 bits (675), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 158/486 (32%), Positives = 247/486 (50%), Gaps = 21/486 (4%)

Query: 28  FVDEQYSGENVTKAI----------TTERKVEDDAAKETESSPQE---RREVKRKLKQRH 74
           FV EQ S  + T  +          TT      D  + +E   QE      + + L  RH
Sbjct: 35  FVTEQKSKTDSTFLLSSKGSPGINQTTNDVTSSDHFRGSEGIEQEDINNTNLSKDLSVRH 94

Query: 75  XXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSS 134
                                L+  GP   +I ++ + T +++V  SLGE+    PV   
Sbjct: 95  LLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGG 154

Query: 135 FSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLL 194
           F+V++ RF+ P+        Y   W     LEL      I+YW + +   AW+ IF+  +
Sbjct: 155 FNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATI 214

Query: 195 TSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGP 254
              NM  VK +GE EF ++ IK+++++GF I    + CG G   G IG +YW +PGA+  
Sbjct: 215 ALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF-- 272

Query: 255 GIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVF 314
                  +  +F G  S  + AAF+Y G E+  ++A E+ NPR+ +P+A K+    I   
Sbjct: 273 ---VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITAS 329

Query: 315 YILSLFFIGLLVPYNDPKL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSA 372
           Y+  L  IG LVP NDP+L   S  +  +SSP +I+IEN G K LP + NA++LI ++S 
Sbjct: 330 YVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSV 389

Query: 373 GNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAF 432
            NS VY  SR + +++     P+FL+ V + G P  ++L T  FG L+F+  S    + F
Sbjct: 390 ANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVF 449

Query: 433 NWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALI 492
            WL  ++G++  F W+ I+ SHIRF QA++ +  S D+LP+ +Q     ++Y  F +  +
Sbjct: 450 TWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYG-FIVLFL 508

Query: 493 VLIQGF 498
           VLI  F
Sbjct: 509 VLIASF 514

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  263 bits (672), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 172/499 (34%), Positives = 263/499 (52%), Gaps = 22/499 (4%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESS--PQE--RREVKRKLKQRHXXXXXXXXXXX 85
           ++ Y G N T     E  VE D +  TE    P+   R +++R LK RH           
Sbjct: 15  EDYYKGLN-TPPKKNEVVVELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIG 73

Query: 86  XXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSP 145
                     L   GP    ++Y  MG V+Y     LGEM T++P++ SF  +A++F S 
Sbjct: 74  TGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSE 133

Query: 146 ALGATNGYMYWLSWCFTFALELSVLGKVIQYW-TEAVPLAAWIV--IFWCLLTSMNMFPV 202
           +      + YW +   + A +++ L  V+ YW TEA     W    +FW L+  +N+  V
Sbjct: 134 SFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHV 193

Query: 203 KYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKN 262
           ++YGE E+ +A +KVIA++ F I S  V  G       IGF+ W +  A  P +      
Sbjct: 194 RFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYIGFKNWNHGEA--PFV------ 245

Query: 263 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFI 322
              F G+ S  ++A+F Y GTE + +T GEAANP +  P+ +K V  RILVFY+ S FFI
Sbjct: 246 -DGFKGFASLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFI 304

Query: 323 GLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSR 382
            + +PY+ P LD+    V +SPF +  + +GTK      NAV++ +++SA N  ++ GSR
Sbjct: 305 AMNIPYDYPGLDTKS--VVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSR 362

Query: 383 VLYSLSKNSLAP-RFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGV 441
           V+Y++      P + +S   R  VPY SVL TS  G L F     G+G  + WL NI GV
Sbjct: 363 VMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGV 422

Query: 442 AGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF 501
           +   AWL I  + IRF + + K+G +  +L YK    P+  Y+   F+  I+L+QG++AF
Sbjct: 423 SNQIAWLCIGITSIRFRKGLEKQGKTH-ELRYKNWTYPYGPYFLVIFVTFIILVQGWSAF 481

Query: 502 APTFQPIDFVAAYISIFLF 520
            P +   +F + Y+ +F+F
Sbjct: 482 DP-WDVTNFFSYYLDLFVF 499

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  264 bits (674), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 159/483 (32%), Positives = 255/483 (52%), Gaps = 11/483 (2%)

Query: 54  KETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGT 113
           ++ E +  +  +++++++ RH                     L + GP G LI YL +  
Sbjct: 51  EDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSI 110

Query: 114 VIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGK 172
           V Y +  + GEM    P +  +F+ ++  F+S   G    +++ L W   F LEL     
Sbjct: 111 VSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATI 170

Query: 173 VIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVC 232
           VI+YW  +V    ++VIF+  +  ++ F  + YGE EF     KV+ ++GF+I    +  
Sbjct: 171 VIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINV 230

Query: 233 GAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292
           GA    G IG RYWRNPG++  G    DK +G        L+ A F++ G EL  ++  E
Sbjct: 231 GAIGDTGYIGDRYWRNPGSFVSGT-PLDKLKGT----AYVLVTAYFSFGGMELYALSVNE 285

Query: 293 AANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIF-VSSSPFMISIEN 351
             NP+ A+P A KK V RIL+ Y+L++  IG LVP++  +L   G   V  SP++++IE 
Sbjct: 286 LPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEM 345

Query: 352 SGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVL 411
            G KVLP I NAV+LI+++S GNS +Y   R+L +L++   AP+ L  + R G P  S++
Sbjct: 346 HGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLI 405

Query: 412 STSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDL 471
             ++FG +AF   S    K F WL  I G++  F W  I  SH RF QA++ +G S + L
Sbjct: 406 LCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETL 465

Query: 472 PYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP----IDFVAAYISIFLFLAIWLSF 527
            Y+A    + + YA FF  L+ + Q + A  P  +     + F   Y++  L+L ++L +
Sbjct: 466 GYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGY 525

Query: 528 QVW 530
            V+
Sbjct: 526 MVY 528

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  264 bits (675), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 246/452 (54%), Gaps = 8/452 (1%)

Query: 54  KETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGT 113
           ++  +S Q +  +K+ LK RH                     LA+ GP   +I Y+ +  
Sbjct: 78  EDGTASIQSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSF 137

Query: 114 VIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGK 172
           ++Y + Q+ GEM VT+  +  +F+ +   F+S + G    +++ + W     LEL     
Sbjct: 138 IVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSL 197

Query: 173 VIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVC 232
            IQYWT+ +    ++VIF+  L  ++   VK YGE EF     K++ + GFIIFS  V C
Sbjct: 198 TIQYWTD-LNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNC 256

Query: 233 GAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292
           G   +DG IG +YW  PG++  G  +S     RF G    L+   F+Y GTEL  ++  E
Sbjct: 257 GGAGNDGYIGGKYWHTPGSFAEGGPTS-----RFKGICYVLVAGYFSYGGTELYVLSVNE 311

Query: 293 AANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIEN 351
            A PRKA P A KK + RILV Y+L++  IG  VP+N D  + + G    +SP++++   
Sbjct: 312 QAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASI 371

Query: 352 SGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVL 411
            G KV+P I NAV+LI+++S  NS++Y   R+L SL++   AP+ L+ + R G P  ++L
Sbjct: 372 HGVKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALL 431

Query: 412 STSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDL 471
             +VFG +AF+  S    + F WL  I G++  F W  I FSH+RF  A++ +    D++
Sbjct: 432 LCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEV 491

Query: 472 PYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
            YKA    + +++ S F  L+++ Q + A +P
Sbjct: 492 GYKATAGIYGSWFGSIFGVLVLIAQFWVALSP 523

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  261 bits (667), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 149/447 (33%), Positives = 231/447 (51%), Gaps = 16/447 (3%)

Query: 43  TTERKVED---DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHA 99
           +T R V     D+ K  E        +K+ LK RH                     LA  
Sbjct: 47  STNRNVLQRMVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALG 106

Query: 100 GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSW 159
           GP+  +I +   GT +      LGE+    PV  +F+ +  RFL P++      +Y L W
Sbjct: 107 GPLALIIGWTIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQW 166

Query: 160 CFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIA 219
           CF   LE+      ++YW  +V    W+ IF+ ++  +N+  V+ +GE EF  + IKVI 
Sbjct: 167 CFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVIT 226

Query: 220 LLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFT 279
           ++GFII    ++CG G     +G +YW +PG    G          F G    L+ A+++
Sbjct: 227 IVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYS 276

Query: 280 YQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIF 339
             GTE+  + +GE  +P K LP AIK+V  RI+ F+++SL  +G LVPY +  L   G  
Sbjct: 277 LGGTEMACLASGE-TDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNL-MGGSS 333

Query: 340 VSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN 399
           V +SPF+I+I   G   LP I NAV+L+++LS GNS ++  SR L S++   L PR    
Sbjct: 334 VDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGY 393

Query: 400 VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQ 459
           + R G P   +L+  +FG LAFL  S  +G  F WL+ I G+A    WL I+ SHIRF  
Sbjct: 394 IDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRL 453

Query: 460 AIRKRGISRDDLPYKAQMMPFLAYYAS 486
           A++ +G+  ++L + + +  + + Y++
Sbjct: 454 AMKAQGVDLEELEFVSGVGIYGSVYSA 480

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  264 bits (674), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 156/489 (31%), Positives = 253/489 (51%), Gaps = 16/489 (3%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           DD  ++  +S      + + L  RH                     L   GP   +I + 
Sbjct: 75  DDIKEDIHTS-----NMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWT 129

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
            + T +++V  SLGE+    PV   F+V+  RF+ P+   +    Y + W     LEL  
Sbjct: 130 IVSTALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVA 189

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
               I+YW + +   AW+ IF+ L+   N+  VK +GE EF ++ +K++A++GF I    
Sbjct: 190 ASLTIRYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIV 249

Query: 230 VVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289
           + CG G   G IG +YW +PGA+       D    +F G  S  + AAF+Y G E++ ++
Sbjct: 250 LTCGGGPKGGYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVS 304

Query: 290 AGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSSSPFMI 347
           A E+ NPRK +P A K+    I   YI  L  +G LV YND +L   S  + V++SP +I
Sbjct: 305 AAESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVI 364

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           +IEN G K LP + NA++LI ILS  NS VY  SR + S++     P+ LS V + G P 
Sbjct: 365 AIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPL 424

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
            ++ +T  FG L+F+  S    + F WL  ++G++  F W+ I+ +HIRF QA+  +  S
Sbjct: 425 RAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRS 484

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFVAAYISIFLFLAI 523
            D++PY +Q   + +YY +  + L+++   +T+  P          F   Y+S  + +A 
Sbjct: 485 LDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIAC 544

Query: 524 WLSFQVWFK 532
           ++  +++FK
Sbjct: 545 YIGHKLYFK 553

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  263 bits (673), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 175/508 (34%), Positives = 266/508 (52%), Gaps = 32/508 (6%)

Query: 51  DAAKETES-------SPQERREV-------KRKLKQRHXXXXXXXXXXXXXXXXXXXPPL 96
           D+ +E E+       +P E+  +       KR LK RH                     L
Sbjct: 47  DSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSL 106

Query: 97  AHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYW 156
           A AGP G LI +   GT+IY +  ++GE+    PV   ++ +A RF+  + G     +Y 
Sbjct: 107 ATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAFNTVYA 166

Query: 157 LSWCFTFALELSVLGKVIQYW-TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASI 215
           + W  T  LE+      + YW T A    A++ +F+ ++  +N+F VK YGE EF  + I
Sbjct: 167 MGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFI 226

Query: 216 KVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLIN 275
           KVIA++GFII    +VCG G   G IG R W NPGA+  G          F G  S  + 
Sbjct: 227 KVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG----------FKGVCSVFVT 276

Query: 276 AAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-D 334
           AAF++ G+ELVG+ A E ANPRK++P A K+V  RI +FYIL+L  +GLLVPY   +L  
Sbjct: 277 AAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIG 336

Query: 335 SDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAP 394
              +  ++SPF+ISI+N+G K LP + N V+LI +LS GN  V+  SR + +L+     P
Sbjct: 337 QSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLP 396

Query: 395 RFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSH 454
           +    + R G P   ++ T VFG L+F+  S   G+ F+WLL ++G++  F W  I   H
Sbjct: 397 KIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCH 456

Query: 455 IRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTF---QPIDFV 511
           IR  +A+  +  +  +L + A    + + Y+   I LI++ Q + A  P         F 
Sbjct: 457 IRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIGGKPSAAAFF 516

Query: 512 AAYISIFLFLAIWLSFQVWFKCRLLWKL 539
            AY+S  +++  ++  ++W K    WKL
Sbjct: 517 EAYLSFPIYIVFYIGHKIWKKN---WKL 541

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  263 bits (672), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 154/509 (30%), Positives = 260/509 (51%), Gaps = 11/509 (2%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           D   S ++    I+T   ++ D+      + +    + + L  RH               
Sbjct: 42  DLGQSSKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSIGTGLF 101

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149
                 L   GP   +I ++ + + +++V  +LGE+    P+   F+V+  RF+ P+   
Sbjct: 102 VNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAF 161

Query: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209
                Y + W  +  LEL      I+YW   +   AW+ IF+  +  +NM  VK++ E E
Sbjct: 162 AVNLNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSEAE 221

Query: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269
           F ++ IK++A++GF I    +  G G + G IG +YW +PGA+       D    RF G 
Sbjct: 222 FVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAF-----HGDSAGSRFKGL 276

Query: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329
            S  + AAF+Y G E+  ++A E+ NPRK +P+A K+    I   YI  L  IG+LVPYN
Sbjct: 277 CSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYN 336

Query: 330 DPKL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           D +L   S  +  S+SP +I+IEN+G K LP + NA++LI +LS  NS VY+ SRV+ S+
Sbjct: 337 DKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSM 396

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           +  +  P+  S V + G P +S+ +T   G L+F+  S    + F WL  I G++  F W
Sbjct: 397 ALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCW 456

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP 507
           + I+ +HIRF  A++ +  S D+L Y +Q   + ++Y    + L+++   + +  P  + 
Sbjct: 457 IGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVSLFPVGES 516

Query: 508 I----DFVAAYISIFLFLAIWLSFQVWFK 532
                 F   Y+S  + +A ++  +V+ K
Sbjct: 517 SADAEAFFEGYLSFPILIASYIGHKVYIK 545

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 163/515 (31%), Positives = 262/515 (50%), Gaps = 17/515 (3%)

Query: 34  SGEN-VTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXX 92
           SG N  T  IT+  +   D   + +        + ++L  RH                  
Sbjct: 55  SGVNQTTNDITSSGRFHSD--DDVQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNT 112

Query: 93  XPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNG 152
              L+  GP   +I ++ + T +++V  SLGE+    PV   F+V++ RF+ P+      
Sbjct: 113 GAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVN 172

Query: 153 YMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCI 212
             Y   W     LEL      I+YW + +   AW+ IF+  +   NM  VK +GE EF +
Sbjct: 173 LNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVL 232

Query: 213 ASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSS 272
           + IK++A++GF I    + CG G   G IG +YW +PGA+    +  D    +F G  S 
Sbjct: 233 SMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAF----VGHDSGT-KFKGLCSV 287

Query: 273 LINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPK 332
            + AAF+Y G E+  ++A E+ NPR+ +P+A K+    I + Y+  L  IG LVP NDP+
Sbjct: 288 FVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPR 347

Query: 333 L--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKN 390
           L   S  +  +SSP +I+IEN   K LP + NA++LI ++S  NS VY  SR + +++  
Sbjct: 348 LLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHI 407

Query: 391 SLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLI 450
              P+FL  V + G P  +++ T  FG L+F+  S    + F WL  ++G++  F W+ I
Sbjct: 408 GNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAI 467

Query: 451 SFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGF-TAFAPT----F 505
           + SHIRF QA++ +  S D+LP+ +Q   + + Y  F +  +VLI  F T+  P      
Sbjct: 468 NLSHIRFRQAMKFQERSLDELPFISQTGVWGSIYG-FVVLFLVLIASFWTSMFPIGSSGA 526

Query: 506 QPIDFVAAYISIFLFLAIWLSFQVWFKC-RLLWKL 539
               F   Y+S  + +  +   +++ +  RLL KL
Sbjct: 527 NAESFFEGYLSFPILIVCYFGHKIYTRDWRLLVKL 561

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  263 bits (673), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 149/491 (30%), Positives = 264/491 (53%), Gaps = 11/491 (2%)

Query: 45  ERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGA 104
           E++   D        P E  ++K+ +K+RH                     L  AGP G 
Sbjct: 96  EKQTTSDLESGLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGL 155

Query: 105 LISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTF 163
           +I Y  MG+ +Y + Q+ GE+ V +  + S+F+++    +  A G    ++Y L W    
Sbjct: 156 VIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVC 215

Query: 164 ALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGF 223
            LEL      I+YWT +V    ++ IF+ L+  +N F  + Y E EF   S KV+ + GF
Sbjct: 216 PLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGF 275

Query: 224 IIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGT 283
            I    + CG   + G IG +YW +PGA+     + ++    F G +++   AAF +  +
Sbjct: 276 FILGIIITCGGAGTSGYIGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGAS 330

Query: 284 ELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVS-S 342
           E + +TA E +NPRKA+P+A K ++ RIL  ++ S+  IG LVPYN P L   G   + +
Sbjct: 331 EFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKA 390

Query: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402
           SP+++++ + G +V+P   NAV+L+++LS GNS  Y  SR+L SL++   AP+  + + +
Sbjct: 391 SPYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDK 450

Query: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462
            G P  +++ +++F  +AF   S    + F WLL I+G++  F W+ I  SH+RF +A++
Sbjct: 451 RGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALK 510

Query: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFVAAYISIF 518
            +G S  ++ +K+Q+  + + YA+  + L ++ Q + A AP         +F   Y+++ 
Sbjct: 511 VQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMP 570

Query: 519 LFLAIWLSFQV 529
           + L ++  +++
Sbjct: 571 ILLVLYFGYKI 581

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  263 bits (671), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 165/509 (32%), Positives = 263/509 (51%), Gaps = 16/509 (3%)

Query: 35  GENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXP 94
           G+  + ++T +        ++ +  PQ    + + L  RH                    
Sbjct: 69  GKGDSHSLTRDEAGSGVMKEDVDGHPQ----MNKDLDVRHLLTLAVGGAIGTGLFVNSGA 124

Query: 95  PLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYM 154
            L+  GP   +I ++ + T +++V  SLGE+    PV   F+V+  RF+ P+ G      
Sbjct: 125 ALSSGGPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNIN 184

Query: 155 YWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIAS 214
           Y   W     LEL      I+YW + +   AW+ IF+  +   NM  VK +GE EF ++ 
Sbjct: 185 YLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSM 244

Query: 215 IKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 274
           IK++A++GF I    + CG G   G IG +YW +PGA+       + +  +F G  S  +
Sbjct: 245 IKILAIVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAF-----VGETSGTKFKGLCSVFV 299

Query: 275 NAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL- 333
            AAF+Y G EL  ++A E+ NPR+ +P+A K+    I + Y+  L  IG LVPYN+PKL 
Sbjct: 300 TAAFSYSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLL 359

Query: 334 -DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392
             S  +  +SSP +I+IEN G + LP + NA++LI I+S  NS VY  SR + S+++   
Sbjct: 360 NGSSSVDAASSPLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRN 419

Query: 393 APRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISF 452
            PRFL  V R G P  + L T  FG L+F+  S    + F WL  ++G++  FAW+ I+ 
Sbjct: 420 LPRFLGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINL 479

Query: 453 SHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPI 508
           SHIRF QA+  +GIS D+LPY +      ++Y    + L+++   +T+  P         
Sbjct: 480 SHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADAT 539

Query: 509 DFVAAYISIFLFLAIWLSFQVWF-KCRLL 536
            F   Y+S  + +  ++  +++  K RLL
Sbjct: 540 SFFEGYLSFPILIVCYVGHKLYIRKKRLL 568

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  261 bits (667), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/496 (33%), Positives = 253/496 (51%), Gaps = 27/496 (5%)

Query: 45  ERKVEDDAAKETESSPQERR-----------EVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           +    DD +K ++  P                VKR LK RH                   
Sbjct: 12  DESRSDDLSKFSKEEPDTHNIKSFEQFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAG 71

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
             L+  GP+  L+ +  +G V ++V +S+GEM+T  P  S FS  ++RF S AL A +GY
Sbjct: 72  NALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFHSDALSAVSGY 131

Query: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213
            Y + +    A E + L  ++Q+W   VPL  +I+IF        M  V  +GEFE+ +A
Sbjct: 132 AYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLA 191

Query: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273
             K+I L+ + IFS   + G  ++    GF YW NPGA   G          F G     
Sbjct: 192 WFKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWNNPGALADG----------FKGIAVVF 241

Query: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333
           +  +  Y GTE V + A E+ NP KA+P AIK+   RI++ Y+    F G  VPYND  L
Sbjct: 242 VFCSSFYSGTESVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSL 301

Query: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393
            +    +  SP  I+I  +G +    + NA +LIT +SA N ++YIGSR L  L+   LA
Sbjct: 302 GAHTKAL-KSPIAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLA 360

Query: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453
           P+FL    + GVP  ++   +  G ++ + VS G+  A+++++N++GV  F  W +IS +
Sbjct: 361 PKFLKWTDKRGVPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLT 420

Query: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA 513
           H+RF +A   +G S  +LPYK+ + P+   ++      + LIQG+T F P F   DFV A
Sbjct: 421 HLRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFVP-FSAKDFVDA 479

Query: 514 YI----SIFLFLAIWL 525
           YI    ++ L++ I L
Sbjct: 480 YILLPAAVILYIVISL 495

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  261 bits (667), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 149/493 (30%), Positives = 261/493 (52%), Gaps = 8/493 (1%)

Query: 49  EDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISY 108
           E   + E ++   E R  +RKL  R                      + H GP   LI++
Sbjct: 28  ETIRSLEGQAPSLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAF 87

Query: 109 LFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELS 168
                V   ++Q +  MVT++PVT SF  F +RF+  + G + G+ Y++        E++
Sbjct: 88  CLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEIT 147

Query: 169 VLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSF 228
            +  V+++WT+ +P AA I I   L  S+N+F V  +GE EF ++  KVI  +G I F+ 
Sbjct: 148 AVCLVVEFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTI 207

Query: 229 CVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGI 288
            V+ G       +GF+ W NPGA+   I  S  + G+F G++S LI A + + G + +G 
Sbjct: 208 VVMAGGNPQHKVLGFKNWSNPGAFAEYI--SKGSAGKFHGFMSCLIFALYVFWGVDYLGN 265

Query: 289 TAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL----DSDGIFVSSSP 344
            A EA NPRK +P + +KV  R+++FYI     +G+LVP+ND  +        +   +SP
Sbjct: 266 AASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASP 325

Query: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGG 404
           ++ +++  G  VLP I N ++L +I+SAGNS++Y  SRVL+ L+    AP+ L  +T+ G
Sbjct: 326 YVSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPK-LFKITKRG 384

Query: 405 VPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKR 464
           VP +  ++  +   LA+L VS  +     W LN+   A    ++ I  S+++F +  + +
Sbjct: 385 VPIYCCVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQ 444

Query: 465 GISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAI 523
            I    LPY +  +P+L +++ F++ L++ + G+  F   ++    F+ +Y  I  F+ +
Sbjct: 445 NIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVL 504

Query: 524 WLSFQVWFKCRLL 536
           +   +++ K R +
Sbjct: 505 FAGHKLYKKTRFV 517

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  263 bits (672), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 154/486 (31%), Positives = 247/486 (50%), Gaps = 11/486 (2%)

Query: 53  AKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMG 112
           A++ +       ++ + L  RH                     L   GP   +I ++ + 
Sbjct: 128 ARDKDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVS 187

Query: 113 TVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGK 172
           T +++V  SLGE+    PV   FSV+  +F+ P+        Y L W     LEL     
Sbjct: 188 TALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASI 247

Query: 173 VIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVC 232
            I+YW  ++   AW+ IF+  +   NM  VK +GE EF ++ +K++A++GF I    + C
Sbjct: 248 TIRYWNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDC 307

Query: 233 GAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292
           G G S   IG +YW +PGA+  G  S  K    F G  S  + AAF++ G E+  ++A E
Sbjct: 308 GGGPSHEYIGGKYWHDPGAF-VGTTSGSK----FKGLCSVFVTAAFSFSGIEMTAVSAAE 362

Query: 293 AANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSSSPFMISIE 350
           + NPR+ +P+A K+    I   Y+  L  +G LVPYNDP+L   S  +  +SSP +I+IE
Sbjct: 363 SRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIE 422

Query: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSV 410
           N     LP + NA++LI ILS  NS+VY  SR + S+SK    P+  + V R G P  ++
Sbjct: 423 NGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAI 482

Query: 411 LSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDD 470
                FG L+F+  S    + F WL  ++G++  F W+ I+  HIRF Q +  + IS D+
Sbjct: 483 CFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDE 542

Query: 471 LPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFVAAYISIFLFLAIWLS 526
           LP+ +Q   + + Y    + L+++   +T+  P          F   Y+S  + L  +++
Sbjct: 543 LPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIA 602

Query: 527 FQVWFK 532
            +V+FK
Sbjct: 603 HKVYFK 608

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  261 bits (666), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 155/486 (31%), Positives = 252/486 (51%), Gaps = 12/486 (2%)

Query: 47  KVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           ++E++  ++   S   +  +K+ +K RH                     L  +GP   +I
Sbjct: 34  ELEENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLII 93

Query: 107 SYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
            Y+ +  V Y + Q+ GEM    P +  SF+ +   F+S   G    +++++ W   F L
Sbjct: 94  GYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPL 153

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           EL      ++YW + +    +I+IF+  L  ++ F VK YGE EF   S KV+ + GFII
Sbjct: 154 ELITASLTVKYWNDKINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFII 213

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAW--GPGIISSDKNEGRFLGWVSSLINAAFTYQGT 283
            S  + CG   +DG IG +YW +PG++  GP I        RF G    L++A F+Y G 
Sbjct: 214 LSIVINCGGAGTDGYIGAKYWHDPGSFADGPPIT-------RFKGVCFILVSAYFSYGGA 266

Query: 284 ELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVS-S 342
           EL  ++  E  NPRK+ P A K+ + RIL+ Y+ ++  IG  VP+N  +L   G   + +
Sbjct: 267 ELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHA 326

Query: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402
           SP++++      KV+P   NAV+LI+++S  NS +Y   R++ SL++   AP+FL+ V R
Sbjct: 327 SPYVLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDR 386

Query: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462
            G P   ++  ++FG + F+  S+   + F WL  I G++  F W  I  SHIRF QA++
Sbjct: 387 EGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMK 446

Query: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVA-AYISIFLFL 521
             G S D++ +KA    + +YY   F  L+ + Q + A +P        A A+   +L  
Sbjct: 447 FNGKSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAA 506

Query: 522 AIWLSF 527
            IWL F
Sbjct: 507 PIWLVF 512

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  262 bits (669), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 159/502 (31%), Positives = 259/502 (51%), Gaps = 31/502 (6%)

Query: 45  ERKVEDDAA-KETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVG 103
            +KV +D    ETE+      ++ + +K RH                     L+ +GP G
Sbjct: 90  RQKVRNDGEFAETET------QLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAG 143

Query: 104 ALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFT 162
            +I Y     +IY V Q+ GE+ + +  +T +++ +    + PA+G     +Y L W   
Sbjct: 144 LVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTV 203

Query: 163 FALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLG 222
             L+L      I+YWT  V    ++     L+ ++NMF  K Y E EF     K++ + G
Sbjct: 204 LPLQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAG 263

Query: 223 FIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQG 282
           F+I    + CG       IG +YW+ PGA+  G          F G  +    AAF+Y G
Sbjct: 264 FVILGIVINCGGAGDKEYIGVKYWQTPGAFANG----------FKGVAAVFCYAAFSYGG 313

Query: 283 TELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIF 339
            E++ +TA E ANPRKA+P A +KVV R+L  Y+L+   +  LVPYN P L   ++DG  
Sbjct: 314 IEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSG 373

Query: 340 VSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN 399
             +SPF+I++ + G +V+P I NA +LI+++S  NS++Y G R+L SLS+   AP+  + 
Sbjct: 374 SDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNY 433

Query: 400 VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQ 459
           + R G P   VL +   G +AFL       + F WLL ++G++  F W+ I+ SH+RF  
Sbjct: 434 IDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRD 493

Query: 460 AIRKR--GI-SRDDLPYKAQMMPFLAYYASFFIALIVLIQGF-TAFAPTFQ--PID---F 510
           AIR +  G+ +RD + Y AQ   ++    +  I++ +L+  F  A AP      +D   F
Sbjct: 494 AIRSQLGGLRARDVVEYTAQ-TGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIF 552

Query: 511 VAAYISIFLFLAIWLSFQVWFK 532
              Y++  + L  +L++++W +
Sbjct: 553 FENYLAAPVLLGGYLAYKIWHR 574

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  261 bits (666), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 154/477 (32%), Positives = 246/477 (51%), Gaps = 8/477 (1%)

Query: 54  KETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGT 113
           ++  +S Q    +K+ +K RH                     L  AGP   +I Y  +  
Sbjct: 65  EDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSF 124

Query: 114 VIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGK 172
           + Y V Q+ GEM VT+  +   F+ +A  F+S   G    +++ + W     LEL     
Sbjct: 125 ITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASM 184

Query: 173 VIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVC 232
            I+YW + +    ++VI +  L  ++ F V+ YGE EF   S K++ + GF+I S  V C
Sbjct: 185 TIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNC 244

Query: 233 GAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292
           G    DG IG +YWR+PGA+     +SD    RF G    L+ A F+Y G EL  ++  E
Sbjct: 245 GGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNE 299

Query: 293 AANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIEN 351
             NPR++ P A K+ + RIL+ Y+L++  IG  VP+N D  + + G    +SP+++++  
Sbjct: 300 QENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSI 359

Query: 352 SGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVL 411
            G KV+P I NAV+LI++ S  NS +Y   R+L SL++   AP++ + V R G P  +++
Sbjct: 360 HGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALI 419

Query: 412 STSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDL 471
             S+FG +AF   S      F WL  I G++  F W  I  SH+RF  A++ +G S ++L
Sbjct: 420 LCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNEL 479

Query: 472 PYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVA-AYISIFLFLAIWLSF 527
            Y +    + + Y  FF  L+ + Q + A +P      + A A+   +L   +WL F
Sbjct: 480 GYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFF 536

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  261 bits (666), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 149/459 (32%), Positives = 244/459 (53%), Gaps = 8/459 (1%)

Query: 48  VEDDAAKETESSP-QERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           +E++   E  + P +    +K+ +K RH                     L  AGP   +I
Sbjct: 67  LEENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVI 126

Query: 107 SYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
            Y+ +  + Y + Q+ GEM V +  +  +F+ +   F+S + G    +++ + W     L
Sbjct: 127 GYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPL 186

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           EL      I+YW +++    +IVIF+  L  ++ F VK YGE EF   S K++ + GFII
Sbjct: 187 ELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFII 246

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTEL 285
            S  + CG    DG IG +YWR+PG++  G      N  RF G    L+ A F++ G EL
Sbjct: 247 LSVVINCGGAGVDGYIGGKYWRDPGSFADG-----SNATRFKGICFILVTAYFSFGGIEL 301

Query: 286 VGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVS-SSP 344
             ++  E +N RK+ P A K+ V RIL+ Y+L++  IG  VP+N+ +L   G   + +SP
Sbjct: 302 FVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASP 361

Query: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGG 404
           ++++      +V+P I NAV+LI+++S  NS +Y   R++ SL++   APRFL+ + R G
Sbjct: 362 YVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREG 421

Query: 405 VPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKR 464
            P  ++   ++ G + F+  S    +AF WL  I G++  F W  I  SHIRF +A++ +
Sbjct: 422 RPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQ 481

Query: 465 GISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
           G S  +L YKA    + +YY  FF  L+ + Q + A +P
Sbjct: 482 GRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSP 520

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  259 bits (663), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 162/489 (33%), Positives = 257/489 (52%), Gaps = 21/489 (4%)

Query: 42  ITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGP 101
           + T   V DD   +       R  + R L  RH                     L   GP
Sbjct: 41  VDTNNSVSDDPESQ---DAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGP 97

Query: 102 VGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161
              LI+Y+ MG VIY    SLGEM TF+P++ S+  ++++F+S +         W S   
Sbjct: 98  GSLLINYVIMGGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAV 157

Query: 162 TFALELSVLGKVIQYW---TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVI 218
           + A +L+ L  V+ YW   T   P  A  ++FW L+  +N+  VK YGE E+ +A +KV+
Sbjct: 158 SVASDLTALQLVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVV 217

Query: 219 ALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 278
           A++ F I +    CG  Q    IGF+ W +  A  P +      +G F G+V+  + ++F
Sbjct: 218 AVIIFFIMAIIANCGHNQQHEYIGFKNWSHGDA--PFV------QG-FKGFVTIFVTSSF 268

Query: 279 TYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGI 338
           +Y GTE V +T GEA NP +  P+ IK V  RILVFY+ ++FF+G+ +PY+ P L +  +
Sbjct: 269 SYGGTETVTLTGGEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKSV 328

Query: 339 FVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAP--RF 396
              +SPF I  + +GTK      NAV++ + +SA N  ++ GSR+LY++      P  RF
Sbjct: 329 L--TSPFTIVFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRF 386

Query: 397 LSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIR 456
            +   R   PY +V++T   G L F     G+G+ F+WL NI GV+   +WL I+   IR
Sbjct: 387 FTKTNRNKAPYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIR 446

Query: 457 FMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYIS 516
           F + +  +G    +L ++    P+  ++   FI+LI+L+QG++AF P +    F + Y+ 
Sbjct: 447 FRKGLEAQG-KVHELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLE 504

Query: 517 IFLFLAIWL 525
           + +F A W+
Sbjct: 505 LIVFPACWI 513

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  260 bits (664), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 163/516 (31%), Positives = 268/516 (51%), Gaps = 16/516 (3%)

Query: 28  FVDEQYSGENVTKAITT--ERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXX 85
                +S      AI T  E+ +E  +  + ++  +   EV R LK RH           
Sbjct: 25  LTSRDHSTNQKKDAIITAVEQDIERGSLSDIDT-IKPSTEVSRGLKSRHVQFIALGGAIG 83

Query: 86  XXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVT--SSFSVFAQRFL 143
                     L+  GP   LISY  M   ++++   + EMV  IP++  SS +  A  +L
Sbjct: 84  TGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYL 143

Query: 144 SPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVK 203
           +       G+  + +       E++    +I+YWT+A   A ++ IF  L T +++ PVK
Sbjct: 144 NRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTDA-NAAIFVTIFMILATLLSLLPVK 202

Query: 204 YYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI-GFRYWRNPGAWGPGIISSDKN 262
            +GE EFC++ IK++ +LG I+    +  G G +   + GF YW  PGA+   ++    +
Sbjct: 203 IFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKG--S 260

Query: 263 EGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFF 321
            G FL    ++I + F +    E+    + EAA PRK +PRA ++ V R+ VFY+L    
Sbjct: 261 TGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLV 320

Query: 322 IGLLVPYNDPKLD----SDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNV 377
           IG++V Y++  L+    S     ++SPF+I I+ +G ++LP I NA +L +  S   S +
Sbjct: 321 IGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSEL 380

Query: 378 YIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLN 437
           Y  SRVL+SL+    AP+F S V + GVPY+SV +TS+FG LA+L  S  S   FNWL N
Sbjct: 381 YGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSN 440

Query: 438 ITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQG 497
           I  ++GF  W+ +S +++RF +      I+ D +PY+ +    LAY ++ F AL+ +  G
Sbjct: 441 IATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRRGQRALAYASAIFFALLAITNG 499

Query: 498 FTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
           F  F A  +   DF   Y++I     +++   +++K
Sbjct: 500 FYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYK 535

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  259 bits (663), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 156/520 (30%), Positives = 262/520 (50%), Gaps = 17/520 (3%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           F+D     E   + I  E+         T      ++++K+ +K RH             
Sbjct: 38  FMDSFKRAEPQGQTIREEKLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTG 97

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPA 146
                   L   GP G +I Y+   T++Y V Q+  E+ V++  +  +++ +    +   
Sbjct: 98  LLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSG 157

Query: 147 LGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYG 206
                 ++Y L W     LEL      I+YW +++    ++ IF+C +  ++ F  + Y 
Sbjct: 158 FNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYA 217

Query: 207 EFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRF 266
           E EF   S KV+ ++GFII    V CGA +S G IG +YW  PGA+       +K    F
Sbjct: 218 ESEFIFNSCKVLMMVGFIIMGISVNCGASKS-GYIGGKYWHTPGAF-----VGEKAIDHF 271

Query: 267 LGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV 326
            G  S  + +AF Y G+E + +TA E  NPRK++P+A K+ + R+L+ ++  +  +G LV
Sbjct: 272 KGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLV 331

Query: 327 PYNDPKL-DSDGIFVS-SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVL 384
           PY+ P L  S G   S +SPF+I+  + G KV+P I NAV+LI+++S GNS  Y   R+L
Sbjct: 332 PYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRIL 391

Query: 385 YSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGF 444
            SL++  + P+  + V R G P  ++L  ++FG ++F+  S      F WL  I  ++  
Sbjct: 392 LSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQL 451

Query: 445 FAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP- 503
           F W  IS SHIRF  A++ +G S  +L YKA    + ++YA  F  +++  Q + A AP 
Sbjct: 452 FTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPI 511

Query: 504 ----TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
                    +F   Y++  + +  +  +++W++    WKL
Sbjct: 512 GNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRD---WKL 548

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  260 bits (665), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 163/525 (31%), Positives = 263/525 (50%), Gaps = 31/525 (5%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQ---------------ERREVKRKLKQ 72
           F+D    GE      TT R  + +    T  SPQ               ++ E+KR + Q
Sbjct: 70  FIDSFKRGE------TTARIADLENDLTTAVSPQLSNYHGSIPSDEVVIKKEELKRDINQ 123

Query: 73  RHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPV 131
           RH                     L  AGP G LI Y  MGT +Y V Q+ GE+ VT+  +
Sbjct: 124 RHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANL 183

Query: 132 TSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFW 191
              F+ +    ++P+   + G++Y L W     LEL      I+YWT  V    ++VIF+
Sbjct: 184 IGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTKVDPDVFVVIFY 243

Query: 192 CLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGA 251
            L+  +N F  K Y E +F    +K+  + GF I    V CG    DG +G +YW NPGA
Sbjct: 244 LLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGA 303

Query: 252 WGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRI 311
           +       +K    F G  S  + +AF + G+E V ++A E ANPRK++P A K ++ RI
Sbjct: 304 F-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRI 358

Query: 312 LVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILS 371
           +  Y+ S+  +G LVP++ P+L        +SP++++I   G KV+P + NAV+L+ +LS
Sbjct: 359 IWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVLS 418

Query: 372 AGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKA 431
             NS  +  SR+L SLS+   AP++   V R G P  ++L +++FG + F   S      
Sbjct: 419 VSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDV 478

Query: 432 FNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIAL 491
           F+WLL I+G++  F +  I  SHIR   A++ +G S  +L +++Q+  + ++YA   + L
Sbjct: 479 FSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVL 538

Query: 492 IVLIQGFTAFAP----TFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
            ++ + + A AP          F   Y++  + +  +  + +W K
Sbjct: 539 SLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKK 583

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  258 bits (659), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 165/544 (30%), Positives = 275/544 (50%), Gaps = 22/544 (4%)

Query: 39  TKAITTERKVEDDAAKETESS------------PQERREVKRKLKQRHXXXXXXXXXXXX 86
           + ++T E+   D+A  + E                +R ++K+ LK RH            
Sbjct: 7   SSSLTKEKVAIDEAEVQLEEGVTLDETIKQGVLHNDRTKLKQGLKARHIKMLTLVGVFGT 66

Query: 87  XXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPA 146
                    L   GPVG LI+Y+ +G V+     ++ E+ +F+P T +    +++F+  A
Sbjct: 67  GLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEA 126

Query: 147 LGATNGYMYWLS-WCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYY 205
           +G T G   W+S +      ELS    V+ YWT+  P A +I IF  L    N++ +++Y
Sbjct: 127 VGFTFG---WISTYSSLMPGELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFY 182

Query: 206 GEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGR 265
           GE E+    +K +AL+  +I +  V+   G     +GF YWRNPG +   ++  D   G+
Sbjct: 183 GEIEYFFGWLK-LALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGDT--GK 239

Query: 266 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLL 325
           F+G+ ++L +  ++Y G + + I AGE  N R A+    K V VRI++ Y++++F + L+
Sbjct: 240 FVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLI 299

Query: 326 VPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLY 385
           VPYND  + +      SSPF+I++E +G KVLP I NA++L +  SAGN  +  GSR L+
Sbjct: 300 VPYNDKLIATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLF 359

Query: 386 SLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFF 445
            L+  + AP+     ++ G+P+  VL  S F  LA++  S  S   F+W   +       
Sbjct: 360 CLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLL 419

Query: 446 AWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APT 504
            W+LIS +HI   +A+R +G SR DLPY   + P+ A+++     + +L  GF  F    
Sbjct: 420 RWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGN 479

Query: 505 FQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLXXXXXXXXXXXXEELVWIEPECKTR 564
           F    F + Y  I L +A++  ++++ K R L               E   +I PE    
Sbjct: 480 FDIESFFSRYFIIPLAIALFTFWKLFKKTRYLRPHEVDLQSIFEDIRENPEYI-PETTPL 538

Query: 565 WQRV 568
           W+R+
Sbjct: 539 WKRL 542

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  259 bits (662), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 159/490 (32%), Positives = 261/490 (53%), Gaps = 13/490 (2%)

Query: 49  EDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISY 108
           E+D  +E+     +  ++K+ ++ RH                     L + GP G  + +
Sbjct: 74  END--QESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGF 131

Query: 109 LFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 167
             MGT +Y V Q+ GEM V +  ++  F+ +    + P  G    ++Y + W   F LEL
Sbjct: 132 FVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLEL 191

Query: 168 SVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFS 227
                 I+YWT A+    ++ +F+ L+  +N F  + Y E EF   + KV+ ++GF I  
Sbjct: 192 VTASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVG 251

Query: 228 FCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 287
             V  GA  +DG IG +YWR PG++G G  + D     F G VS+L+NAAF+   +E V 
Sbjct: 252 ILVNTGAAGNDGYIGAKYWREPGSFG-GHTAID----HFKGVVSTLVNAAFSLGCSEFVA 306

Query: 288 ITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSDGIFVSSSPFM 346
           +TA E ANPRK++P A KK++ ++ V ++ S+  IG LVP N  +L  S    V  SP++
Sbjct: 307 LTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYV 366

Query: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVP 406
           I++ + G +V+P   NAV+L+++LS GNS  Y  SR+L SL++   AP     + R G P
Sbjct: 367 IAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRP 426

Query: 407 YFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGI 466
             +++ +   G L F+  S      F WLL I+G++  F W  I  SHIRF +A+  +G 
Sbjct: 427 LMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGR 486

Query: 467 SRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP--TFQPI--DFVAAYISIFLFLA 522
             D L +KAQ   + +YY++  + L  + Q +T   P  + +P    F   Y++  +F+A
Sbjct: 487 GWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVA 546

Query: 523 IWLSFQVWFK 532
           ++  ++++ K
Sbjct: 547 LYFGYKIYNK 556

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  258 bits (658), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/490 (30%), Positives = 242/490 (49%), Gaps = 13/490 (2%)

Query: 51  DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLF 110
           D    T  S      +KR +K RH                     L   GP G +I Y  
Sbjct: 68  DLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAA 127

Query: 111 MGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
           +  V Y + Q+ GEM    P +  +F+ ++ + +S   G    ++Y + W     LEL  
Sbjct: 128 VSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELIT 187

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
               I+YW +++    +I IF+  +  ++ F  + YGE EF     KV+ ++GF+I S  
Sbjct: 188 ASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIV 247

Query: 230 VVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289
           + CG       IG +YW +PGA+  G         +F G    L+   F+Y GTEL  +T
Sbjct: 248 INCGGAGDRKYIGAKYWYDPGAFAVG-----SGATKFKGVAYVLVTGYFSYGGTELYAMT 302

Query: 290 AGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVSSSPFMI 347
             E +NPR+A+    K+ + RIL+ Y+L++  IG LVP+   +L   S      +SP+++
Sbjct: 303 VNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVL 362

Query: 348 SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPY 407
           ++   G K++P I NAV+LI ++S GNS +Y G R+L +L++   APRFL+ V R G P 
Sbjct: 363 AVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPL 422

Query: 408 FSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGIS 467
            ++++ SVFG LAF+  S      F WL  I G++  F W  I  SH+RF QA+R     
Sbjct: 423 VALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRP 482

Query: 468 RDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVAAYISIFLFLA 522
             +L YKA      +     F  L+ + Q + + AP         + F  +Y++  L++ 
Sbjct: 483 LSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVV 542

Query: 523 IWLSFQVWFK 532
           ++  + + F+
Sbjct: 543 LFFGYMIVFR 552

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  257 bits (656), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 158/514 (30%), Positives = 264/514 (51%), Gaps = 22/514 (4%)

Query: 31  EQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXX 90
           + ++ E     +     VED + +  E    +  +V RKLK RH                
Sbjct: 35  DSWNNEKSAYQVDQIIDVEDASMELIEG---QEHQVARKLKSRHIQLIALGGAIGTGLFI 91

Query: 91  XXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQR--FLSPALG 148
                L+  GP   LISY+ M   ++ +   L EMV  +P++   S+FA    +L+  L 
Sbjct: 92  GSGGALSVCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLS 151

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
              G   + +       E++    +IQYWT+A   A +I IF  +  S+ M PV ++GE 
Sbjct: 152 FMCGINLFYAMSMIAPSEITATAILIQYWTDANS-AIFISIFIVVTVSLTMLPVHFFGES 210

Query: 209 EFCIASIKVIALLGFIIFSFCVV-CGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFL 267
           EF ++ IK+  + G +I    +   GA   D  +GF YW++PGA+ P ++    N G+FL
Sbjct: 211 EFWVSIIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPG--NTGKFL 268

Query: 268 GWVSSLINAAFTYQGT-ELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV 326
              +++I + F+Y    E+V   A EA +PR+ +PR  ++ V R+ +FY+     IG++V
Sbjct: 269 ACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMV 328

Query: 327 PYNDPKL-------DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYI 379
            Y++ +L       +S+    ++SPF+I I+  G +VLP I NA +L +  S G S +Y 
Sbjct: 329 GYDNSRLLNAIAAGESNA---AASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYG 385

Query: 380 GSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNIT 439
            SRVL+S++ N   P+  +   R G PY+S  + SVF  LA+L  S  S   F WL NI 
Sbjct: 386 ASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIA 445

Query: 440 GVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT 499
            ++GF  W+L+   ++RF + I    ++ D +P++ + M  LAY +  F A++ L  G+ 
Sbjct: 446 TISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYA 504

Query: 500 AF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFK 532
            F A  +   DF A Y ++ L   +++   +++K
Sbjct: 505 VFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYK 538

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  256 bits (655), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 170/529 (32%), Positives = 276/529 (52%), Gaps = 35/529 (6%)

Query: 29  VDEQYS-GENVTKAITTERK----VEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXX 83
           +D++Y   E++T    TE +       D+ K   +       +KR LK RH         
Sbjct: 34  IDDKYEHAESLTDYTKTENRNIFQRVIDSFKPPANGSFHTSNLKRSLKSRHLIMIAIGGS 93

Query: 84  XXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFL 143
                       LA+ GP+  ++ +   G+ I      LGE+    PV  +F+ +  RFL
Sbjct: 94  IGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGEITVRFPVVGAFANYQTRFL 153

Query: 144 SPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVK 203
            P+L      +Y L W F   LE+      +QYW + +    ++ IF+C + S+N+F V+
Sbjct: 154 DPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDTIDPVVFVAIFYCAIVSINLFGVR 213

Query: 204 YYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNE 263
            +GE EF  ++IKVI + GFII    ++CG G +   IG +YW +PG    G        
Sbjct: 214 GFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGAKYWHDPGCLANG-------- 265

Query: 264 GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIG 323
             F G++S LI A+++  GTE+  + +GE  +P K LP AIK+V  RIL F+++SL  +G
Sbjct: 266 --FRGFLSVLITASYSLGGTEMTCLASGE-TDP-KELPSAIKQVFWRILFFFLVSLTLVG 321

Query: 324 LLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRV 383
            LVPY +  L   G  V +SPF+I+I+    KVLP I NAV+LI+ILS GNS ++  SR 
Sbjct: 322 FLVPYTNENL-LGGSSVDNSPFVIAIKLHNIKVLPSIVNAVILISILSVGNSCIFASSRT 380

Query: 384 LYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAG 443
           L S++   L P +   + R G P   ++  S+FG LAFL  S+   + F+WL+ I G+A 
Sbjct: 381 LCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLVKSSSVSEVFDWLMAIAGLAT 440

Query: 444 FFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP 503
              WL I+  HIRF  A++ +  + D+L + + +  + + Y++   +LI+++Q + +  P
Sbjct: 441 CIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWGSVYSAIINSLILIVQFYVSLWP 500

Query: 504 T-------------FQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
                         FQ  +++ A +S+  F+   L F+  +K +  W++
Sbjct: 501 IGGWTDSKDRAGKFFQ--NYLCAIVSLIFFICHKLYFR--YKTKKWWEI 545

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  256 bits (654), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 267/508 (52%), Gaps = 24/508 (4%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           S E++T   TT +  +     E E       ++K+ +K  H                   
Sbjct: 45  SSEDITNDSTTGKTEKGHTGSENE-------KLKQSIKPYHVFMITMATGIGTGLLVGNG 97

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNG 152
             ++ AG  G L+ Y  +G+++    QS+GE+V   P +   F+ + +RF+ P+ G T  
Sbjct: 98  KSISDAGVGGTLVGYFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVA 157

Query: 153 YMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCI 212
           +++ L W     LEL      I+YW  ++  + ++ IF+ L+  ++ F  + Y + EF  
Sbjct: 158 WLFCLQWQIVLPLELVTASMTIKYWNNSLNPSIFVAIFYSLILGISFFGARGYADAEFLF 217

Query: 213 ASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSS 272
              KV+ + GFII    +  GA  + G IG +Y + PGA+             F    S+
Sbjct: 218 NLSKVLMITGFIILGIIISFGAAGTSGYIGIKYLKTPGAF--------NTRNTFKSICST 269

Query: 273 LINAAFTYQGTELVGITAGEAA--NPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYND 330
           L+NA F+  G E + ++A E A  N  K++ RA  +V+VR+ VFYILS+F IGLLVPYN 
Sbjct: 270 LVNACFSCGGVEFLALSAAEQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNS 329

Query: 331 PKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389
           P+L  S    + SSP++I++ + G KV+P + NAV+LI ++S  NS +Y  SR L++L++
Sbjct: 330 PELMGSSSEIIHSSPYVIAVASHGVKVVPHLINAVILIAVVSVANSAMYSSSRTLHALAE 389

Query: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449
              AP + + +   G P+  ++ + VFG L+F+         F WLL+I+G++  F W +
Sbjct: 390 QGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTM 449

Query: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP---TFQ 506
           I  +H+RF  A++ +  S ++L ++A    + +YY     +L +++Q + +  P     +
Sbjct: 450 ICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGR 509

Query: 507 P--IDFVAAYISIFLFLAIWLSFQVWFK 532
           P  ++F   Y+++   L +++  +++ +
Sbjct: 510 PDFVNFFQNYMAVPFALCLYVGHKIYTR 537

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  257 bits (657), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 164/519 (31%), Positives = 281/519 (54%), Gaps = 23/519 (4%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQERR-------EVKRKLKQRHXXXXXXXXXXXX 86
           S  ++  A++  R  EDD   ++ +S + R+       ++++ +K RH            
Sbjct: 85  SHASLVHAVSKAR--EDDEIMQSVASAEHRKVNNTESDDLQKTIKPRHVIMISLGTGIGT 142

Query: 87  XXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSP 145
                    L+ AGP   +I Y  MG+ +Y + Q+ GEM V +  +   F+ +    L P
Sbjct: 143 GLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDP 202

Query: 146 ALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYY 205
           ALG +  ++Y L W     LEL      I+YWT  V    +++IF+ L+ S+N+F  + Y
Sbjct: 203 ALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTKVDPDVFVIIFYVLIISINVFGARGY 262

Query: 206 GEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGR 265
            E EF     KV+ ++GF I    +  G   +DG +G +YW  PGA+       +    R
Sbjct: 263 AEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAF-----RGEHAVDR 317

Query: 266 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLL 325
           F G + + + AAF +  TE + +TA E +NPRKA+P A KKV+ RI++ +++S+  +G L
Sbjct: 318 FKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFL 377

Query: 326 VPYN-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVL 384
           VPY+ D  L S G  V +SP+++++   G +V+P   NAV+L+++LS GNS  Y  SR+L
Sbjct: 378 VPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLL 437

Query: 385 YSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGF 444
            SLS+   AP++   V R G P  ++L +++FG +AF   S      FNWLL I+G++  
Sbjct: 438 LSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQL 497

Query: 445 FAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP- 503
           F W  I  SH+RF  A++ +G S  ++ + +Q   + + YA+  + L ++ Q + A AP 
Sbjct: 498 FTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMILALMAQFWVAIAPL 557

Query: 504 ---TFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKL 539
                   +F  +Y+++ + +A++  ++++++    WKL
Sbjct: 558 NEGKLDAQNFFQSYLAMPILIALYFGYKLYYRD---WKL 593

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  254 bits (650), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 164/481 (34%), Positives = 250/481 (51%), Gaps = 24/481 (4%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           D+    +   PQ    VKR LK RH                     L   GP+  L+ + 
Sbjct: 35  DEDPDVSRYDPQT--GVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFS 92

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
            +G + +SV +S+GEM+T  P    F+  A+RF S AL A  GY Y + +    A E + 
Sbjct: 93  IIGIIAFSVMESIGEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNT 152

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
           L  ++Q+W   VPL  +I+IFW       +  V  +GE E+ +A +K++ L+ + IFS  
Sbjct: 153 LSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIV 212

Query: 230 VVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289
            + G  ++    GF YW +PGA   G          F G     +  +  Y GTE V + 
Sbjct: 213 YISGDIRNRPAFGFHYWNSPGALSHG----------FKGIAIVFVFCSTFYSGTESVALA 262

Query: 290 AGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI 349
           A E+ NP KA+P A+++ + RILV YI    F G  VP++DP L S    V  SP  I+I
Sbjct: 263 ATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL-SASTKVLKSPIAIAI 321

Query: 350 ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFS 409
             +G      + NA +LIT +SA N ++YIGSR L  L+   LAP+ L+   R GVP  +
Sbjct: 322 SRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPA 381

Query: 410 VLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRD 469
           +   +  G ++ + VS G+  A+++++N++GV  F  W +IS++H+R  +A   +G S +
Sbjct: 382 ITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIE 441

Query: 470 DLPYKAQM---MPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYI----SIFLFLA 522
           +LPY+A      P L+  A+ F+A   LIQG++ F P F   +FV AYI     I L++ 
Sbjct: 442 ELPYEALFYPWTPVLSLAANIFLA---LIQGWSYFVP-FDAGNFVDAYILLPVGILLYIG 497

Query: 523 I 523
           I
Sbjct: 498 I 498

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  253 bits (647), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 153/469 (32%), Positives = 249/469 (53%), Gaps = 15/469 (3%)

Query: 47  KVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           K+ DD    +E  P     VKR LK RH                     L   GP+  L+
Sbjct: 16  KIRDDR-DVSEFDPNT--GVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLL 72

Query: 107 SYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALE 166
            ++ +G + ++V +S+GEM+T  P    F+  A+RF S AL A  GY Y + +    A E
Sbjct: 73  GFVIIGIIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANE 132

Query: 167 LSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIF 226
            + L  ++Q+W   VPL A+ +IFW +     +  V  +GE E+ ++ +K++ L+ + IF
Sbjct: 133 YNTLSSILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIF 192

Query: 227 SFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELV 286
           S   + G  ++    GF YW++PG+   G          F G     +  +  Y GTE V
Sbjct: 193 SIIYMSGGVRNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESV 242

Query: 287 GITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFM 346
            +TA E+ NP K++P A+++ + RI+V YI    F G  VP+NDP L S    V  SP  
Sbjct: 243 ALTATESKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIA 301

Query: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVP 406
           I+I  +G      + NA +L + +SA N ++YIGSR L +L+   LAP+FL+   + GVP
Sbjct: 302 IAISRAGWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVP 361

Query: 407 YFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGI 466
             ++   +  G ++ + +S G+  A+++++N++GV  F  W +IS++H+R  +A   +G 
Sbjct: 362 IPAITIFNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGR 421

Query: 467 SRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYI 515
             ++LPYKA   P+   ++      + LIQG+T+  P F+  +FV AYI
Sbjct: 422 LLEELPYKALFYPWTPIFSLISNIFLALIQGWTSLVP-FKAPEFVDAYI 469

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  254 bits (649), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 155/478 (32%), Positives = 250/478 (52%), Gaps = 17/478 (3%)

Query: 51  DAAKETESSP-QERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           D ++E + S       VKR LK RH                     L   GP+  L+ + 
Sbjct: 33  DISEEPDVSKFDPNTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFS 92

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
            +G + ++V +S+GE++T  P    F+  A+RF   AL A  GY Y + +    A E + 
Sbjct: 93  IIGVIAFAVMESIGEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNT 152

Query: 170 LGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFC 229
           L  ++Q+W   VPL  +I+IFW       +  V  +GE E+ ++  K++ L+ + IFS  
Sbjct: 153 LSSILQFWGPQVPLYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSII 212

Query: 230 VVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289
            + G  +     GF YW +PG+   G          F G     +  +  Y GTE V + 
Sbjct: 213 YISGGIKDRPAFGFHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALA 262

Query: 290 AGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI 349
           A E+ NP KA+P A+++ + R+L+ YI    F G  VP++DP L S    V  SP  I+I
Sbjct: 263 ATESKNPGKAVPLAVRQTLWRVLIVYIGIAVFYGATVPFDDPNL-SATTKVLKSPISIAI 321

Query: 350 ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFS 409
             +G      + NA +L+T +SA N ++YIGSR L +L+   LAP+ L+   R GVP  +
Sbjct: 322 SRAGWAGGAHLVNAFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPA 381

Query: 410 VLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRD 469
           +   +  G ++ + VS G+  A+++++N++GV  F  W +IS++H+R  +A   +G S +
Sbjct: 382 ITVFNALGLISLMNVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLE 441

Query: 470 DLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYI----SIFLFLAI 523
           +LPYKA + P+   ++      + LIQG+T+F P F   +FV AYI    +I L++AI
Sbjct: 442 ELPYKALLYPWTPIFSLIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAI 498

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  254 bits (648), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 154/516 (29%), Positives = 266/516 (51%), Gaps = 15/516 (2%)

Query: 30  DEQYSGENVTKAITTERKVEDD----AAKETESS---PQERREVKRKLKQRHXXXXXXXX 82
           DE  + +   K    E  V+++    + +ET        +R ++K+ LK+RH        
Sbjct: 6   DESTNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQGLKERHIKMLTLVG 65

Query: 83  XXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRF 142
                        L   GPVG LI+YLF+G V+     ++ E+ +F+P T +    A++F
Sbjct: 66  VFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQF 125

Query: 143 LSPALGATNGYMYWLS-WCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP 201
           +  ++G T G   W+S +      ELS    +++YWT+  P A +I +F  L    N++ 
Sbjct: 126 IDESVGFTFG---WISTYSSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIYT 181

Query: 202 VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDK 261
           +++YGE E+    +K++ +   II    +  G  +    +GF YWR PG +   ++    
Sbjct: 182 IRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANYLVGG-- 239

Query: 262 NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFF 321
           + G+F+G+ +++ +  ++Y G + + I AGE  N R A+    K V +RI+V Y++++F 
Sbjct: 240 HIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFI 299

Query: 322 IGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGS 381
           + L+VPYND  + +      SSPF+I++  +G KVLP I NA++L +  SAGN  +  GS
Sbjct: 300 LTLIVPYNDKLIATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGS 359

Query: 382 RVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGV 441
           R L+ L+  + AP+     ++ G+PY  V+  S F  LA++  S  S   F W   +   
Sbjct: 360 RNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQELVSS 419

Query: 442 AGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF 501
                W+LIS +HI   +A++ +G SR DLPY   M PF A+++     + +L  GF  F
Sbjct: 420 NTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNF 479

Query: 502 APTFQPID-FVAAYISIFLFLAIWLSFQVWFKCRLL 536
                 I+ F   Y  I L + ++  ++++ K + L
Sbjct: 480 IHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYL 515

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  253 bits (647), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 162/501 (32%), Positives = 259/501 (51%), Gaps = 22/501 (4%)

Query: 28  FVDEQYSGENVT---KAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXX 84
           +++E Y   +++     +  E        +  +     R ++ R LK R           
Sbjct: 9   YIEENYYKTDLSPKENHVVCELDPSFTTDENYDPEANIREDLTRALKPRVVNMISIAGII 68

Query: 85  XXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLS 144
                      L   GP    ++Y  MG V+Y    +LGEM T++P++ SF V+A++F S
Sbjct: 69  GTGLYLSTSKSLHTGGPASLFMNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGS 128

Query: 145 PALGATNGYMYWLSWCFTFALELSVLGKVIQYWT---EAVPLAAWIVIFWCLLTSMNMFP 201
            +      + YW +   + A +L+ L  V+ YW       P  A  +IFW ++  +N+  
Sbjct: 129 ESFACALMWNYWFNDAVSVASDLTALQLVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIH 188

Query: 202 VKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYW-RNPGAWGPGIISSD 260
           V++YGE E+ +A +K+IA++ F I S  V  G       IGF+ W R    +  GI    
Sbjct: 189 VRFYGEAEYWLAMLKIIAIIIFFILSIVVNVGKNPQHEYIGFKNWTRGEAPFVDGI---- 244

Query: 261 KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLF 320
                  G+ S  ++A+F Y GTE + +T GEA NP +  P+ +K V  RIL+FY+ S F
Sbjct: 245 ------KGFASLFVSASFAYGGTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTF 298

Query: 321 FIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIG 380
           FI + +PY+ P LDS  I   +SPF +  + +GTK      NAV++ +++SA N  ++ G
Sbjct: 299 FIAMNIPYDYPGLDSKSIV--TSPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAG 356

Query: 381 SRVLYSLSKNSLAP-RFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNIT 439
           SR++Y++      P R +S   R  VPY SVL T+  G L F     G+G  + WL NI 
Sbjct: 357 SRIMYNMGLEGFLPARIVSRTNRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIV 416

Query: 440 GVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT 499
           GV+   AWL I  + IRF + + K+G +  +L YK    P+  Y+   F++ I+LIQG++
Sbjct: 417 GVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELIYKNWTYPYGPYFVIIFVSFIILIQGWS 475

Query: 500 AFAPTFQPIDFVAAYISIFLF 520
           AFAP +   +F + Y+ +F+F
Sbjct: 476 AFAP-WNVSNFFSYYLELFVF 495

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  254 bits (649), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 150/498 (30%), Positives = 253/498 (50%), Gaps = 19/498 (3%)

Query: 48  VEDDAAKETESS-----PQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPV 102
           VED   KE +        + ++++K  +K RH                     L + GP 
Sbjct: 48  VEDVHEKEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPG 107

Query: 103 GALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161
           G LI YL   T++Y V Q+  E+ V +  +  +++ +    +    G     +Y L W  
Sbjct: 108 GLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAI 167

Query: 162 TFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221
              LEL      I+YWTE+V    ++ IF+  +  ++ F  + Y E EF   ++KV+ + 
Sbjct: 168 VLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMA 227

Query: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281
           GFII    + CGA +  G IG +YW NPG +     + +++     G  S  + +AF Y 
Sbjct: 228 GFIIMGISLNCGASKL-GYIGAKYWSNPGTF-----AGERSINHLKGICSVWVQSAFAYG 281

Query: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIF 339
           G+E + +TA E ANPR+++P A K+ + R++V +++ +  I  LVPY   +L   S    
Sbjct: 282 GSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASA 341

Query: 340 VSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN 399
             +SPF+I+    G K++P I NA++L +++S GNS +Y   R+L SL++N L P+  + 
Sbjct: 342 SHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTY 401

Query: 400 VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQ 459
           V R G P  ++L   VFG L+F+  S      F WL  I G++  F W  I+ SHIRF  
Sbjct: 402 VDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRA 461

Query: 460 AIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-----TFQPIDFVAAY 514
           A++ +G S  +L Y +      +YYA FF  ++++ Q + A AP           F   Y
Sbjct: 462 AMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNY 521

Query: 515 ISIFLFLAIWLSFQVWFK 532
           ++  + +  ++ +++W++
Sbjct: 522 LAFAVLVLFYVGYKIWYR 539

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  254 bits (648), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 153/502 (30%), Positives = 254/502 (50%), Gaps = 25/502 (4%)

Query: 43  TTERKVED-----DAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLA 97
           T ERK        D+ K       +   +KR LK RH                     LA
Sbjct: 50  TEERKRNVVQRVIDSFKPPVDGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALA 109

Query: 98  HAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWL 157
             GP+  +I +   GT +      LGE+   +PV  +F+ ++ RFL P++      +Y +
Sbjct: 110 TGGPLALIIGWTLAGTQMIGTIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVM 169

Query: 158 SWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKV 217
            W F   LE+      +++WT++V    W+ +F+ ++ S+N+  V+ +GE EF  +S+KV
Sbjct: 170 QWFFVLPLEIIASCITMRFWTQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKV 229

Query: 218 IALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAA 277
           I + GFII    ++ G G +   +G RYW +PG    G          F G  + ++ A+
Sbjct: 230 ITICGFIILCIVLILGGGPTHQYVGSRYWHDPGPLANG----------FKGVAAVMVTAS 279

Query: 278 FTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDG 337
           ++  G+E+  + +GE  +P K LP AIK++  RIL F+++SL  +G LVPY +  L   G
Sbjct: 280 YSLGGSEMTCLASGE-TDP-KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENL-LGG 336

Query: 338 IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL 397
               +SPF++++     KV+P I N V+L++ILS GNS ++  SR L S++   L P   
Sbjct: 337 SSAENSPFVLALYLHHVKVVPHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIF 396

Query: 398 SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457
             V RGG P   +L+ S+FG LAFL   +     F+WL+ I G+A    WL I+ SH+RF
Sbjct: 397 GYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRF 456

Query: 458 MQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPID-------F 510
             A++ +  S D+L + + +  + + YA     L ++ Q + A  P     D       F
Sbjct: 457 RLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAF 516

Query: 511 VAAYISIFLFLAIWLSFQVWFK 532
              Y+   + +A++ + + +F+
Sbjct: 517 FKNYLCALILIAMFAAHKCYFR 538

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  253 bits (645), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 156/485 (32%), Positives = 248/485 (51%), Gaps = 17/485 (3%)

Query: 50  DDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYL 109
           D+   + +     R ++ R L  RH                     L + GP    ++Y 
Sbjct: 30  DELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYT 89

Query: 110 FMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169
            +G V+Y     LGEM TF+P++ SF  +A++F S +      + YW +   + A +L+ 
Sbjct: 90  IIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTA 149

Query: 170 LGKVIQYWTEA---VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIF 226
           L  V+ YW  A    P     +IFW  +  +N+  V+ YGE E+ +A +KVIA++ F I 
Sbjct: 150 LQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIM 209

Query: 227 SFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELV 286
           S  V  G       IGF+ W +  A  P +         F G+ S  ++A F Y GTE +
Sbjct: 210 SIIVNVGKNPQHEYIGFKNWTHGEA--PFV-------NGFKGFASLFVSACFAYGGTESI 260

Query: 287 GITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFM 346
            +T GEA+NP +  P+ +K V  RIL+FY+LS FFIG+ +PY+ P L +    V +SPF 
Sbjct: 261 TLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKS--VMTSPFT 318

Query: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAP-RFLSNVTRGGV 405
           +  + +GT+      NAV+L +++SA N  ++ GSR++Y+++ +   P + +    R   
Sbjct: 319 LVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKA 378

Query: 406 PYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRG 465
           PY +VL T   G L       G+G  + WL NI GV+   AWL I  + IRF + +  +G
Sbjct: 379 PYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG 438

Query: 466 ISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWL 525
              D L +K    PF  Y+   F   I+LIQG+ AF P +   DF + Y+ +F+F  +++
Sbjct: 439 -KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP-WSVTDFFSVYLELFVFPFVYI 496

Query: 526 SFQVW 530
            + +W
Sbjct: 497 IWWLW 501

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  253 bits (645), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 158/504 (31%), Positives = 271/504 (53%), Gaps = 19/504 (3%)

Query: 43  TTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPV 102
           +T  +V   +  + ES   ++  + R LK RH                     L+  GP 
Sbjct: 31  STGDEVSQGSVLDIES---QKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPA 87

Query: 103 GALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFA--QRFLSPALGATNGYMYWLSWC 160
             LI+Y  M   ++SV   + EMVT IP+    ++++  + +++  L    G+  + +  
Sbjct: 88  PLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQA 147

Query: 161 FTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIAL 220
                E++    ++QYWT+A P A +I IF  L  ++ M PVK +GE EF ++SIK++ +
Sbjct: 148 MIAPAEVTACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTI 206

Query: 221 LGFIIFSFCVVCGAGQS-DGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFT 279
           +G II    +  G G + +  +GF YW+ PGA+ P ++  +   G+FL + +++I + F+
Sbjct: 207 VGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPYLV--EGGTGKFLAFWTAIIKSGFS 264

Query: 280 YQGT-ELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL----D 334
           +    E+V   A EA  PR+ +PRA K+ + R+ +FY+  +  +G++V Y++ +L     
Sbjct: 265 FVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIA 324

Query: 335 SDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAP 394
           S     ++SPF+I I+ +G +VLP I NA +L +  S G   +Y  SR L+S++    AP
Sbjct: 325 SGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAP 384

Query: 395 RFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSH 454
           R L+ V + GVPY+    TS+F  LA+L  S  S   FNWL NI  ++GF +W+L+S ++
Sbjct: 385 RILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAY 444

Query: 455 IRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-TFQPIDFVAA 513
           IRF   I    ++ D +P++      LAY A  F +++ L  GF  F    +   +F AA
Sbjct: 445 IRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAA 503

Query: 514 YISIFLFLAIWLSFQVWFK---CR 534
           YI++   L +++   +++K   CR
Sbjct: 504 YITLGFVLVLFVGSTIYYKEWRCR 527

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  253 bits (645), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 262/508 (51%), Gaps = 18/508 (3%)

Query: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXX 89
           DE+ +G       +  R  + D   + ++      ++K+ +K RH               
Sbjct: 29  DERRTGIMRGFIDSFRRGRDVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLL 88

Query: 90  XXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALG 148
                 LA AGP G ++ Y+    ++Y + ++ GE+ + +  +T +++ ++   + PA+G
Sbjct: 89  VGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMG 148

Query: 149 ATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEF 208
            +  ++Y + W   F L+L     +IQYWT+  P   ++ I + ++  +N+F  K Y E 
Sbjct: 149 FSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDINP-DIFVAIIYAVIVFINLFGAKGYAEA 207

Query: 209 EFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLG 268
           EF     KV+ ++GF+I    + CG   + G IG +YW  P  +  G          F G
Sbjct: 208 EFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIGDKYWHEPRPFMNG----------FKG 257

Query: 269 WVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPY 328
                  AAF Y G E++ ++A E  NPRK++  A KKV+ RI++ Y+L+   +  LVP 
Sbjct: 258 LCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPA 317

Query: 329 NDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLS 388
           + P L S+G    +SP +I++   G K++P I NAV+LI ++S GNS++Y   R+L SL+
Sbjct: 318 DHPSLASEG--SRASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLA 375

Query: 389 KNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWL 448
           +   AP+  + + R G P  +     VFG LAFL  S      F WLL I+G++  F W+
Sbjct: 376 EQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWM 435

Query: 449 LISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT-FQP 507
            I  SHIRF  A++ +G S  ++ YKA+   + ++ A     LI++ Q + A +P   + 
Sbjct: 436 SICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKG 495

Query: 508 ID---FVAAYISIFLFLAIWLSFQVWFK 532
           +D   F  +Y++  + L  +  ++++ K
Sbjct: 496 VDARSFFQSYLAFPILLLAYFGYKIYHK 523

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  252 bits (644), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 155/503 (30%), Positives = 266/503 (52%), Gaps = 20/503 (3%)

Query: 40  KAITTERKVEDDAAKETESSPQERREVKRK-LKQRHXXXXXXXXXXXXXXXXXXXPPLAH 98
           +A + E   ED    E  +  Q ++EV R+ ++ RH                     +A 
Sbjct: 17  EADSVESVAED---VEAGAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIAC 73

Query: 99  AGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWL 157
           AG  G LI Y  +G ++    QS+GE+V   P ++  F+ + +RF+ P+LG +  +++ L
Sbjct: 74  AGIGGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCL 133

Query: 158 SWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKV 217
            W     LEL      I+YW  ++  + ++ +F+ L+  +N F    Y E EF   S+KV
Sbjct: 134 QWMIVLPLELVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKV 193

Query: 218 IALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAA 277
           + ++GFII    +  G   + G IGFRY  +PG +       +KN         +L+NAA
Sbjct: 194 VVIIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMF-------NKNYNIIKATAGTLVNAA 246

Query: 278 FTYQGTELVGITAGEAA--NPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS 335
           F+  G E + ++A E    N  K++ RA  +V +RI VFY+LS+  +GLLVP+N P L  
Sbjct: 247 FSCGGVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMG 306

Query: 336 DGI-FVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAP 394
            G   + SSP++ ++  +G  V+P I NAV+LI ++S  NS +Y  SR L+SL++ + AP
Sbjct: 307 SGSNMIHSSPYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAP 366

Query: 395 RFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSH 454
           ++ + + + G P   +  +++FG ++F+         F WLL+I+G++  F W  I  +H
Sbjct: 367 KYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAH 426

Query: 455 IRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP---TFQP--ID 509
           IRF  AI+ RG S + L YK+      +Y A+    +I+++Q + +  P     +P  + 
Sbjct: 427 IRFRDAIKSRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQ 486

Query: 510 FVAAYISIFLFLAIWLSFQVWFK 532
           F   Y+++ + L  ++  +V+ K
Sbjct: 487 FFQNYMAVPVALLFYIGHKVYTK 509

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  252 bits (644), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 153/509 (30%), Positives = 255/509 (50%), Gaps = 18/509 (3%)

Query: 28  FVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXX 87
           F+D     +           VED  A     S +   + K+ L  RH             
Sbjct: 44  FIDSYKRADPSQLHNARSEDVEDGIA-----SIRSDTQFKKSLSSRHVIMMSLGTGIGTG 98

Query: 88  XXXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPA 146
                   L + GP   +I Y+ +  V Y + Q+ GEM    P +  +F+ +   F+S +
Sbjct: 99  LLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKS 158

Query: 147 LGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFP-VKYY 205
            G    +++ + W     LEL      I+YW + +    +++IF+  L ++++   ++ Y
Sbjct: 159 WGFATVWLFCIQWLTVLPLELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAY 218

Query: 206 GEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGR 265
           GE EF   S K++ ++GFII S  +  G   +DG IG +YW  PG++  G  +S     R
Sbjct: 219 GETEFLFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAEGDATS-----R 273

Query: 266 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLL 325
           F G    L++  F+Y GTEL  ++  E A PRKA P A KK + RIL+ Y+L++  IG  
Sbjct: 274 FKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFN 333

Query: 326 VPYNDPKL-DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVL 384
           VP+N+ +L  + G    +SP++++    G K++P   NAV+LI+++S  NS+++ G R+L
Sbjct: 334 VPHNNDQLMGAGGSATHASPYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLL 393

Query: 385 YSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGF 444
            SL+    AP+ LS V R G P  ++  + + G +AF+  ++   + F WL  I G++  
Sbjct: 394 SSLATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEI 453

Query: 445 FAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT 504
           F W  I FSH+RF  A++ +G   ++L YKA    + + Y +FF  L+++ Q + A AP 
Sbjct: 454 FTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPI 513

Query: 505 FQPIDFVAAYISIFLFLAIWLSFQVWFKC 533
                          F   +L+F +W  C
Sbjct: 514 GN-----GGKCDAEAFFESYLAFPIWVAC 537

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  249 bits (636), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 150/501 (29%), Positives = 257/501 (51%), Gaps = 21/501 (4%)

Query: 34  SGENVTKAITTERKVEDDAAKETESSPQ-----ERREVKRKLKQRHXXXXXXXXXXXXXX 88
           S E V   I      E +    +E++ Q     +R  +K+ LK+RH              
Sbjct: 11  SQEKVKSKICETNVDEQELECGSETAKQGVLYNDRTRLKQGLKERHIKMLTLVGVFGTGL 70

Query: 89  XXXXXPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALG 148
                  L   GPVG LI+YLF+G V+     ++ E+ +F+P T +    A++F+  ++G
Sbjct: 71  FLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG 130

Query: 149 ATNGYMYWLS-WCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGE 207
            T G   W+S +      ELS    +++YWT+  P A +I +F  L  + N++ +++YGE
Sbjct: 131 FTFG---WISTYSSLMPGELSATAVIMKYWTDVSP-AVFITVFGVLFVATNIYTIRFYGE 186

Query: 208 FEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFL 267
            E+    +K++ +   II    +  G  +    +GF YWR+PG +   +++   + G+F+
Sbjct: 187 IEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFANYLVAG--HIGKFV 244

Query: 268 GWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVP 327
           G+ +++ +  ++Y G + + I AGE  N R A+    K V +RI+V Y++++F + L+VP
Sbjct: 245 GFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLVTVFVLTLIVP 304

Query: 328 YNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387
           YND  + +      SSPF+I++  +G KVLP I NA++L +  SAGN  +  GSR L+ L
Sbjct: 305 YNDKLIATGTGTAKSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCL 364

Query: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447
           +  + AP+     ++ G+PY  V+  S F  LA++  S  S   F W   +        W
Sbjct: 365 ATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGWFQELVSSNTLLRW 424

Query: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQP 507
           +LIS +HI   +A++ +G SR DLP   ++ PF A+++     + +   GF         
Sbjct: 425 ILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLFTGGF--------- 475

Query: 508 IDFVAAYISIFLFLAIWLSFQ 528
            +F+  +  I  FL   LSF 
Sbjct: 476 YNFMHGHFDIESFLLDTLSFH 496

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  250 bits (639), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 160/505 (31%), Positives = 263/505 (52%), Gaps = 14/505 (2%)

Query: 40  KAITTERKVEDDAAKETESS------PQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXX 93
           KA   E  VED   + T+ +        +R ++K+ LK+RH                   
Sbjct: 12  KATAYEADVEDCDIRSTDETLKQGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSG 71

Query: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153
             L   GPVG LI+YLF+G V+     ++ E+ +F+P T +    A++F+  ++G T G 
Sbjct: 72  GTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFG- 130

Query: 154 MYWLS-WCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCI 212
             W+S +      ELS    +++YWT+  P A +I IF  L    N++ +++YGE E+  
Sbjct: 131 --WISTYSSLMPGELSATAVIMRYWTDISP-AVFITIFGVLFVVTNIYTIRFYGEVEYVF 187

Query: 213 ASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSS 272
             +K+I +   II    +  G  +    +GF YWR+PG +   I+    + G+F+G+ S+
Sbjct: 188 GWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEYIVGG--SIGKFVGFWSA 245

Query: 273 LINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPK 332
           L +  ++Y G + + I AGE  N R A+    K V +RI+V Y++++F + L+VPYND  
Sbjct: 246 LSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDAL 305

Query: 333 LDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392
           + S      SSPF+I++  +G KVLP I NA+VL +  SAGN  +  GSR L+ L+  + 
Sbjct: 306 IASGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQ 365

Query: 393 APRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISF 452
           AP+     ++ G+PY  V+  S F  LA++  S  S   F W   +        W+LIS 
Sbjct: 366 APKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISA 425

Query: 453 SHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPID-FV 511
           +HI   +A++ +G SR DLPY   + P+ A+++     + +L  GF  F      I+ F 
Sbjct: 426 NHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFF 485

Query: 512 AAYISIFLFLAIWLSFQVWFKCRLL 536
             Y  I L + ++  ++++ K R L
Sbjct: 486 TRYFIIPLAIGLFTFWKLFKKTRYL 510

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  251 bits (642), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 158/480 (32%), Positives = 253/480 (52%), Gaps = 11/480 (2%)

Query: 59  SPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALISYLFMGTVIYSV 118
           S  + + +K+ ++ RH                     L + GP   +I Y  + +++Y V
Sbjct: 74  SASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCV 133

Query: 119 TQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW 177
            QS  E+ + +  +   F+ +    +  A G +  ++Y L W     LEL      I+YW
Sbjct: 134 IQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW 193

Query: 178 TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQS 237
            + +   A++ IF+ +L ++N      Y E EF     KV+ ++GF I    + CG   +
Sbjct: 194 NQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGN 253

Query: 238 DGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297
           DG +G RYW +PGA+         +  RF G V+ L+NAAF Y G E   +TA E  NP+
Sbjct: 254 DGYLGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308

Query: 298 KALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIENSGTKV 356
           K++  A KK+V RIL  YI++   +G LVP+N D  L S G    +SPF+I++ + G +V
Sbjct: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRV 368

Query: 357 LPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVF 416
           +P   NAV+L+++LS  NS +Y  SR+L SLS+   APRFL+ V R G P   +L + VF
Sbjct: 369 VPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVF 428

Query: 417 GFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQ 476
           G L+F+  S      F WLL I+G++  F W  IS SH+R  +A+  +G S D+L Y A 
Sbjct: 429 GLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAW 488

Query: 477 MMPFLAYYASFFIALIVLIQGFTAFAPT----FQPIDFVAAYISIFLFLAIWLSFQVWFK 532
              + AYYA   I  I++ Q + A +P         +F   Y+++ + + ++L +++W +
Sbjct: 489 TGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTR 548

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  252 bits (643), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 149/501 (29%), Positives = 254/501 (50%), Gaps = 21/501 (4%)

Query: 45  ERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGA 104
           +R++  D   E ES  QE+  +++ +K RH                     L  AGP G 
Sbjct: 71  KRQLPSDQNSELES--QEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGL 128

Query: 105 LISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTF 163
           ++ Y     ++Y + Q+ GE+ + +  +T +++ ++   + P+LG     +Y + W    
Sbjct: 129 VLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVL 188

Query: 164 ALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGF 223
            L+L      ++YWT  V    ++ + +  +  +N+F  + Y E EF     K++ + GF
Sbjct: 189 PLQLVTAAMTVKYWTN-VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGF 247

Query: 224 IIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGT 283
           +I +  + CG       IG  YW NPG +  G          F G  +    AAF+Y G 
Sbjct: 248 VILAIVINCGGAGDRRYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGI 297

Query: 284 ELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVS 341
           E++ ++A E  NP +++P A KKVV RIL+ Y+L+   IG LVPYN  +L          
Sbjct: 298 EVLLLSAAEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSH 357

Query: 342 SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT 401
           +SPF+I++ + G KV+P   NAV+LI+++S  NS++Y G R+L SL++  + P+ L+ V 
Sbjct: 358 ASPFVIAVSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVD 417

Query: 402 RGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAI 461
           R G P    L +  FG + F+  S    + F WLL I+ ++  F W+ +  SHIRF  A+
Sbjct: 418 RNGRPLLCFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAM 477

Query: 462 RKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQ--PID---FVAAYIS 516
            K+G S D++ YKAQ   + ++ A       ++ Q + A AP  +   +D   F   Y++
Sbjct: 478 AKQGRSMDEVGYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLA 537

Query: 517 IFLFLAIWLSFQVWFKCRLLW 537
           + + L  +   +++FK    W
Sbjct: 538 MPIVLLAYFGHKMYFKSWRFW 558

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  251 bits (641), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 150/512 (29%), Positives = 257/512 (50%), Gaps = 23/512 (4%)

Query: 36  ENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPP 95
           +N  K I +  K +   ++ +E   QE+  + + +K RH                     
Sbjct: 60  QNECKKILSSFKRQLPPSQNSELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQV 119

Query: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYM 154
           L  AGP G ++ Y     ++Y + Q+ GE+ + +  +T +++ +    + P+LG     +
Sbjct: 120 LGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVV 179

Query: 155 YWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIAS 214
           Y + W     L+L      ++YWT +V    ++ + +  +  +N+F  + Y E EF    
Sbjct: 180 YTIQWLTVLPLQLVTAAMTVKYWT-SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNI 238

Query: 215 IKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 274
            K++ ++GF+I +  + CG       IG  YW NPG +  G          F G  +   
Sbjct: 239 CKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPGPFAHG----------FKGVCTVFC 288

Query: 275 NAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL- 333
            AAF+Y G E++ ++A E  NP K++P A KKVV RIL+ Y+L+   +  LVPYN  +L 
Sbjct: 289 YAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELL 348

Query: 334 ---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKN 390
              DS G    +SPF+I++ + G KV+P   NAV+LI+++S  NS++Y G R+L SL++ 
Sbjct: 349 GSDDSSG--SHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQ 406

Query: 391 SLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLI 450
            + P+ L+ V R G P    L +  FG + F+  S    + F WLL I+ ++  F W+ +
Sbjct: 407 GVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSM 466

Query: 451 SFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT-----F 505
           S SHIRF  A+ K+G S +++ YKAQ   + ++ A       ++ Q + A AP       
Sbjct: 467 SLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKL 526

Query: 506 QPIDFVAAYISIFLFLAIWLSFQVWFKCRLLW 537
               F   Y+++ + L  +   +++FK    W
Sbjct: 527 NVKVFFQNYLAMPIVLVAYFGHKIYFKSWSFW 558

>Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C
           (ALP1) - Basic amino acid permease [contig 55] FULL
          Length = 544

 Score =  249 bits (635), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 168/494 (34%), Positives = 262/494 (53%), Gaps = 19/494 (3%)

Query: 41  AITTERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAG 100
           A T+   V+ D+  E + +   R  + R L  RH                     LA  G
Sbjct: 17  ARTSSSDVQYDS--EGQEADHVREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGG 74

Query: 101 PVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 160
           P   +I+Y  +G V+Y     LGEM TF+P++ SF  +A++F S +L  T    YW +  
Sbjct: 75  PASLVINYSIIGLVVYLTMLCLGEMSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDA 134

Query: 161 FTFALELSVLGKVIQYWTEA---VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKV 217
            + A +L+ L  ++ +W  +    P  A  +IFW +L  +N+  V+ YGE E+ +A +KV
Sbjct: 135 VSVASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVVHVRVYGEAEYWLAMLKV 194

Query: 218 IALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAA 277
           IA++ F I S  V  G  Q    IGF+ W          +        F G+ S  ++++
Sbjct: 195 IAIIIFFIISIVVNAGHNQDHSYIGFKNWS---------VGEAPFVNGFKGFASLFVSSS 245

Query: 278 FTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDG 337
           F Y GTE + +TAGEA NP +  P+ IK V  RIL+FY+ + FFIG+ VPYN PKL    
Sbjct: 246 FAYGGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYNYPKLSEKS 305

Query: 338 IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLS-KNSLAPRF 396
           +   +SPF I  +  GTK      NAV+L +++SAGN  ++ GSRVL++L  +    P  
Sbjct: 306 VM--TSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFPSI 363

Query: 397 LSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIR 456
           ++   R  +PY +VL T   G L F     G+G  + WL NI GV+   AWL IS   IR
Sbjct: 364 ITKTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVSIR 423

Query: 457 FMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYIS 516
           F + + K+G +  +L +     P+  Y+   F++ I+L+QG+++FAP +   DF + YI 
Sbjct: 424 FRRGLAKQGKTH-ELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAP-WNVTDFFSYYIE 481

Query: 517 IFLFLAIWLSFQVW 530
           + +F+A+++ + +W
Sbjct: 482 LIVFVALYVFWWLW 495

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  248 bits (633), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 146/499 (29%), Positives = 257/499 (51%), Gaps = 24/499 (4%)

Query: 47  KVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGALI 106
           K +   A++  S   E   +++ +K RH                     +A AG  G LI
Sbjct: 6   KEDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLI 65

Query: 107 SYLFMGTVIYSVTQSLGEMVTFIP-VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFAL 165
            YL +G ++    QS+GE+V   P +   F+ + ++F+ P+LG    +++ L W     L
Sbjct: 66  GYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPL 125

Query: 166 ELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFII 225
           EL      I+YW   +  + ++  F+ L+  +N F    Y E EF    +KV+ L  FI+
Sbjct: 126 ELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIV 185

Query: 226 FSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTEL 285
               ++ G   + GPIGF+Y + PGA+       + N   F     +L+NAAF+  G E 
Sbjct: 186 LGIVIITGGLGNSGPIGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEF 238

Query: 286 VGITAGEAA--NPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVS-S 342
           + ++A E    N  K++ RA ++V +R+ VFY+LS+  +GLLVPY+ P L   G   + +
Sbjct: 239 LALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHT 298

Query: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402
           SP++ +I   G +++P I NAV+LI ++S  NS +Y  SR L+SL++ + APR+ + + +
Sbjct: 299 SPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNK 358

Query: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462
            G P   ++ +++ G ++F+         F WLL+I+G++  F W  I  +HIRF  A++
Sbjct: 359 HGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALK 418

Query: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPT-----------FQPIDFV 511
            +G S D L Y++      +Y A+    +++++Q + +  P            FQ  +++
Sbjct: 419 LQGQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQ--NYM 476

Query: 512 AAYISIFLFLAIWLSFQVW 530
           A  +++ L+L   L    W
Sbjct: 477 AVPVAVLLYLGHKLYTNDW 495

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  249 bits (637), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 156/505 (30%), Positives = 252/505 (49%), Gaps = 29/505 (5%)

Query: 45  ERKVEDDAAKETESSPQERREVKRKLKQRHXXXXXXXXXXXXXXXXXXXPPLAHAGPVGA 104
           +R++  D   E ES  QER  + R +K RH                     L  AGP G 
Sbjct: 71  KRQLPADQNSELES--QERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGL 128

Query: 105 LISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTF 163
           ++ Y     ++Y + Q+ GE+ + +  +T +++ ++   + P+LG     +Y + W    
Sbjct: 129 VLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVL 188

Query: 164 ALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGF 223
            L+L      I+YWT  V    ++   +  +  +N+F  K Y E EF     K++ ++GF
Sbjct: 189 PLQLVTAAMTIKYWTN-VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGF 247

Query: 224 IIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGT 283
           +I +  + CG       IG +YW NPG +  G          F G  +    AAF+Y G 
Sbjct: 248 VILAIVINCGGAGDRKFIGTKYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGI 297

Query: 284 ELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL--DSDGIFVS 341
           E++ ++A E  NP K++P A KKVV RIL  Y+L+   I  LVPYN  +L          
Sbjct: 298 EVLLLSAAEQENPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSH 357

Query: 342 SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT 401
           +SPF+I++ + G KV+P   NAV+LI+++S  NS++Y   R+L SL++    P+ L+ V 
Sbjct: 358 ASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVD 417

Query: 402 RGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAI 461
           R G P    L + +FG + F+  S    + F WLL I+ ++  F W+ +S SHIRF  A+
Sbjct: 418 RNGRPLLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAM 477

Query: 462 RKRGISRDDLPYKAQMMPFLAYYASFFIALIVL----IQGFTAFAPTFQ--PID---FVA 512
            K+G S D++ YKAQ      Y+ S+   LI L     Q + A AP  +   +D   F  
Sbjct: 478 AKQGRSMDEVGYKAQT----GYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQ 533

Query: 513 AYISIFLFLAIWLSFQVWFKCRLLW 537
            Y+++ + L  +   +++ K    W
Sbjct: 534 NYLAMPIVLFAYFGHKIYTKSWKFW 558

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,199,846
Number of extensions: 2057486
Number of successful extensions: 8484
Number of sequences better than 10.0: 418
Number of HSP's gapped: 7471
Number of HSP's successfully gapped: 437
Length of query: 573
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 458
Effective length of database: 40,294,809
Effective search space: 18455022522
Effective search space used: 18455022522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)