Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YNL122C2.151ON1151155904e-80
Skud_14.2102.151ON103984514e-59
Suva_14.2182.151ON1121064482e-58
Smik_14.2062.151ON1131034473e-58
NCAS0G024702.151ON88712631e-30
KNAG0I021302.151ON921012623e-30
NDAI0F028202.151ON128782557e-29
CAGL0L04070g2.151ON95662511e-28
KAFR0J020902.151ON92662474e-28
SAKL0E10978g2.151ON95942414e-27
TDEL0B051302.151ON93812353e-26
ZYRO0G06490g2.151ON92722345e-26
ABR133W2.151ON961002345e-26
KLLA0F24068g2.151ON95832311e-25
Ecym_82022.151ON98982276e-25
KLTH0B05214g2.151ON91662266e-25
Kwal_33.147622.151ON91642267e-25
Kpol_505.212.151ON85812111e-22
TPHA0F018802.151ON99652033e-21
TBLA0B012302.151ON97671684e-16
TPHA0K006907.418ON278563700.38
KLLA0A01826g5.524ON146435680.62
TBLA0G006804.14ON315756642.6
Suva_8.1915.476ON75874633.5
KLLA0F03212g7.467ON30571624.1
NCAS0A054206.347ON59450624.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL122C
         (115 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...   231   4e-80
Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...   178   4e-59
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...   177   2e-58
Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...   176   3e-58
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...   105   1e-30
KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...   105   3e-30
NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...   102   7e-29
CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...   101   1e-28
KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...   100   4e-28
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...    97   4e-27
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...    95   3e-26
ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...    95   5e-26
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...    95   5e-26
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...    94   1e-25
Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...    92   6e-25
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    92   6e-25
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    92   7e-25
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...    86   1e-22
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    83   3e-21
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    69   4e-16
TPHA0K00690 Chr11 complement(135928..144285) [8358 bp, 2785 aa] ...    32   0.38 
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...    31   0.62 
TBLA0G00680 Chr7 (143994..153467) [9474 bp, 3157 aa] {ON} Anc_4....    29   2.6  
Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...    29   3.5  
KLLA0F03212g Chr6 (302915..303832) [918 bp, 305 aa] {ON} similar...    28   4.1  
NCAS0A05420 Chr1 complement(1071960..1073744) [1785 bp, 594 aa] ...    28   4.2  

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score =  231 bits (590), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%)

Query: 1   MKISLHNKRQRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKG 60
           MKISLHNKRQRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKG
Sbjct: 1   MKISLHNKRQRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKG 60

Query: 61  TAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115
           TAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH
Sbjct: 61  TAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score =  178 bits (451), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 88/98 (89%), Positives = 90/98 (91%)

Query: 18  MSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 77
           MS+FNVL PLLKGSNS + K NG LFNNV TITIRTLMKTHKGTAKRWRRTGNTFKRGIA
Sbjct: 6   MSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 65

Query: 78  GRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115
           GRKHGNIGWSHRSLKALTGRK AHPAY KHLKRLLPYH
Sbjct: 66  GRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score =  177 bits (448), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 89/106 (83%), Positives = 95/106 (89%), Gaps = 1/106 (0%)

Query: 10  QRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTG 69
           QRGD+  NMS+FN+  PLLKGSNSFK +LN  LFNNVSTITIRTLMKTHKGTAKRWRRTG
Sbjct: 8   QRGDR-TNMSLFNLFNPLLKGSNSFKPRLNQLLFNNVSTITIRTLMKTHKGTAKRWRRTG 66

Query: 70  NTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115
           NTFKRGIAGRKHGNIGWSHRSLK LTGRK A+ +Y KHLKRLLPYH
Sbjct: 67  NTFKRGIAGRKHGNIGWSHRSLKVLTGRKTANSSYLKHLKRLLPYH 112

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score =  176 bits (447), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 85/103 (82%), Positives = 94/103 (91%)

Query: 13  DQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTF 72
           +Q Q MS+F++  PLLKGSN+FK + +GFLFNNVST+TIRTLMKTHKGTAKRWRRTGNTF
Sbjct: 11  EQIQIMSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTF 70

Query: 73  KRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115
           KRGIAGRKHGNIGWSHRSLKALTGRK A+ AY KHLKRLLPYH
Sbjct: 71  KRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
           Anc_2.151 YNL122C
          Length = 88

 Score =  105 bits (263), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (84%), Gaps = 1/71 (1%)

Query: 45  NVSTITI-RTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPA 103
           N++T+TI R LMKTHKGTAKRWRRT  +FKRGIAGR HGN GWS RSLK L+GRK A P+
Sbjct: 17  NLTTLTITRNLMKTHKGTAKRWRRTAQSFKRGIAGRNHGNAGWSRRSLKHLSGRKDADPS 76

Query: 104 YSKHLKRLLPY 114
           Y +HLKRL+PY
Sbjct: 77  YLRHLKRLMPY 87

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
           YNL122C
          Length = 92

 Score =  105 bits (262), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 64/101 (63%), Gaps = 12/101 (11%)

Query: 18  MSVFNVLKPLLKGSNSFKVKLNGFL---FNNVSTITIRTLMKTHKGTAKRWRRTGNTFKR 74
           MS  + L PL K         NGF      + S I  R+LMKTHKG AKRWR+  N FKR
Sbjct: 1   MSFLSALSPLFK---------NGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKR 51

Query: 75  GIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115
           GI+GRKHGN GWS R LKALTGR  AH +  K LK+LLPYH
Sbjct: 52  GISGRKHGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score =  102 bits (255), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 57/78 (73%), Gaps = 2/78 (2%)

Query: 38  LNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGR 97
           L G  FN  S +  R LMKTHKG AKRWR++   FKRGIAGR HGN+GWSHR L  LTGR
Sbjct: 53  LKGQSFN--SLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGR 110

Query: 98  KIAHPAYSKHLKRLLPYH 115
           K A P + KHLKR+LPYH
Sbjct: 111 KEADPTHVKHLKRMLPYH 128

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
           similar to uniprot|P53921 Saccharomyces cerevisiae
           YNL122c
          Length = 95

 Score =  101 bits (251), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%)

Query: 49  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHL 108
           +  RTLMKTH+G  KRWR+T   FKRGIAGRKHGNIGWSHRSLK+LTGR  AHP   K L
Sbjct: 29  VFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKRL 88

Query: 109 KRLLPY 114
           +RL+PY
Sbjct: 89  RRLMPY 94

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
           YNL122C
          Length = 92

 Score = 99.8 bits (247), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 53/66 (80%)

Query: 49  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHL 108
           I  R LMKTHKGTAKRWR+T N FKRGIAGR HGN GWS RSLK LTGRK A P+ +K L
Sbjct: 26  IIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKRL 85

Query: 109 KRLLPY 114
           KRLLP+
Sbjct: 86  KRLLPF 91

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
           similarities with uniprot|P53921 Saccharomyces
           cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score = 97.4 bits (241), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 2/94 (2%)

Query: 22  NVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKH 81
           ++L+PL   S  F   L+     + S +  R LMKTHKG AKRW++T N++KRG AGR H
Sbjct: 4   SLLRPLSNISVKFGTSLSQI--QHPSLVLTRNLMKTHKGAAKRWKKTANSYKRGRAGRNH 61

Query: 82  GNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115
           GN GW+  +LK+L G+ +AHP + KHLKRLLPYH
Sbjct: 62  GNAGWNKSTLKSLDGKTLAHPTHIKHLKRLLPYH 95

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
           Anc_2.151 YNL122C
          Length = 93

 Score = 95.1 bits (235), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 34  FKVKLNGFL-FNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLK 92
           F+  LN F      S I  R+LMKTHKG AKRWR+T  +FKRG AGR HGN GWS RSLK
Sbjct: 12  FRTCLNTFSKVEAPSLILTRSLMKTHKGAAKRWRKTATSFKRGKAGRSHGNAGWSRRSLK 71

Query: 93  ALTGRKIAHPAYSKHLKRLLP 113
           +L+G+ +AH  + KHLKRL+P
Sbjct: 72  SLSGKTLAHETHIKHLKRLMP 92

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
           similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
           ribosomal protein L35 and some similarites with YNL122C
           uniprot|P53921 Saccharomyces cerevisiae YNL122C
           Hypothetical ORF
          Length = 92

 Score = 94.7 bits (234), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (77%)

Query: 43  FNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHP 102
           FN+ S +  R LMKTHKGTAKRW++T + FKRG AGR HGN+GWS RSLK L+G+  AH 
Sbjct: 21  FNSSSLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHE 80

Query: 103 AYSKHLKRLLPY 114
           ++ + L+RLLPY
Sbjct: 81  SHIQRLRRLLPY 92

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score = 94.7 bits (234), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 62/100 (62%), Gaps = 11/100 (11%)

Query: 21  FNVLKPLLK-----GSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRG 75
           FN+L+PL       GS +F            S I +RTLMKTHKG AKRWR+T   +KR 
Sbjct: 3   FNMLRPLTGLPVRFGSGAFAAT------TQPSLIMVRTLMKTHKGAAKRWRKTAGGYKRS 56

Query: 76  IAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115
            AGR HGN GW  R+LK L+GR +A  A+ K L+RLLPYH
Sbjct: 57  KAGRSHGNTGWGQRALKQLSGRTMAASAHLKRLRRLLPYH 96

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
           to uniprot|P53921 Saccharomyces cerevisiae YNL122C
           Hypothetical ORF
          Length = 95

 Score = 93.6 bits (231), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 56/83 (67%)

Query: 33  SFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLK 92
           S +  L G   N  S I  R LMKTHKG AKRWR+T N+FKRG AGR HGN GWS  SLK
Sbjct: 13  SARTGLLGSKTNVSSLILTRNLMKTHKGAAKRWRKTANSFKRGKAGRNHGNAGWSRNSLK 72

Query: 93  ALTGRKIAHPAYSKHLKRLLPYH 115
           +L+GR +A   +   LKRLLPYH
Sbjct: 73  SLSGRSLADSTHMHRLKRLLPYH 95

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
           similar to Ashbya gossypii ABR133W
          Length = 98

 Score = 92.0 bits (227), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 62/98 (63%)

Query: 18  MSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 77
           M +  + +PL K ++ F   +          I  R+LMKTHKG AKRWR+T N+FKRG A
Sbjct: 1   MLIQGLFRPLEKLTSRFGGGVGCGSVGVSYLIFSRSLMKTHKGAAKRWRKTANSFKRGKA 60

Query: 78  GRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115
           GR HGN GWS  SLK L+GR +A+ +    LKRLLPYH
Sbjct: 61  GRSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
           similarities with uniprot|P53921 Saccharomyces
           cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 91.7 bits (226), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 42/66 (63%), Positives = 51/66 (77%)

Query: 49  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHL 108
           +  R LMKTHKGTAKRWR+T  ++KRG AGR HGN GW   +LK+L G+ +AHP + KHL
Sbjct: 25  MQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKHL 84

Query: 109 KRLLPY 114
           KRLLPY
Sbjct: 85  KRLLPY 90

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
           YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 91.7 bits (226), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%)

Query: 52  RTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRL 111
           R LMKTHKGTAKRWR+T  ++KRG AGR HGN GW   +LKAL G+ +AH  + KHLKRL
Sbjct: 28  RNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKALDGKTLAHSTHIKHLKRL 87

Query: 112 LPYH 115
           LPYH
Sbjct: 88  LPYH 91

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..57013)
           [258 nt, 86 aa]
          Length = 85

 Score = 85.9 bits (211), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 46/81 (56%), Positives = 62/81 (76%), Gaps = 4/81 (4%)

Query: 38  LNGFLFNN-VSTITI-RTLMKTHKGTAKRWR--RTGNTFKRGIAGRKHGNIGWSHRSLKA 93
           +N  LFN+ +S + I R+LMKTHKGTAKRW+  ++ +TFKRG +GR+HGN+GWS RSLK 
Sbjct: 4   INTGLFNSKISILQITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRSLKH 63

Query: 94  LTGRKIAHPAYSKHLKRLLPY 114
           L+GR  AH  +   L++LLPY
Sbjct: 64  LSGRTYAHTTHVSRLRKLLPY 84

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
           YNL122C
          Length = 99

 Score = 82.8 bits (203), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)

Query: 52  RTLMKTHKGTAKRWRRTG--NTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLK 109
           RTLMKTHKGTAKRW+     +TFKRG +GR+HGNIGWS RSLK L+GR  A   +   L+
Sbjct: 34  RTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTHVSKLR 93

Query: 110 RLLPY 114
           +LLPY
Sbjct: 94  KLLPY 98

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
           Anc_2.151 YNL122C
          Length = 97

 Score = 69.3 bits (168), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 43/67 (64%), Gaps = 7/67 (10%)

Query: 55  MKTHKGTAKRWRR-------TGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKH 107
           +KTHKGT KRWRR           F R  AGR HGNIGWSHR+L AL+ R  AH  + K 
Sbjct: 31  LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 108 LKRLLPY 114
           L++LLPY
Sbjct: 91  LRKLLPY 97

>TPHA0K00690 Chr11 complement(135928..144285) [8358 bp, 2785 aa] {ON}
            Anc_7.418 YBL088C
          Length = 2785

 Score = 31.6 bits (70), Expect = 0.38,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 2    KISLHNKRQRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTIT--IRTLMKTHK 59
            KIS    R+     QN S    L   LK +NS K +L  F FNN +     ++   K  K
Sbjct: 2534 KISFEKARKMMKTAQNKSKSEKLDVYLKLTNSIKPQLRHFFFNNFTNPQDWLQAKTKYTK 2593

Query: 60   GTA 62
            GTA
Sbjct: 2594 GTA 2596

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa]
           {ON} some similarities with uniprot|P41809 Saccharomyces
           cerevisiae YDR420W HKR1 Serine/threonine rich cell
           surface protein that contains an EF hand motif involved
           in the regulation of cell wall beta-1 3 glucan synthesis
           and bud site selection overexpression confers resistance
           to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score = 30.8 bits (68), Expect = 0.62,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 42  LFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGI 76
           +FN +  + +R    T  G A  +RR+ N FK+GI
Sbjct: 793 IFNFLPKVLVRPFQLTTTGAAPVYRRSWNIFKKGI 827

>TBLA0G00680 Chr7 (143994..153467) [9474 bp, 3157 aa] {ON} Anc_4.14
            YLL040C
          Length = 3157

 Score = 29.3 bits (64), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 7    NKRQRGDQNQNMSVFNVLKPLLKGSNSFKVKLNGFLFNNVST--ITIRTLMKTHKG 60
            NK     QN  + + N+L   +   N   +KLN     NV T  +++ T +KTH G
Sbjct: 2782 NKLAVTSQNNLLYLANILTMTIGNVNDAPIKLNSLYIGNVRTPALSLLTSIKTHYG 2837

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score = 28.9 bits (63), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%)

Query: 40  GFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKI 99
            F F NVS      ++K H+   K +     TFK+ +  R H  I   H +  A      
Sbjct: 327 SFTFKNVSKKKSENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHSTAAATATGPT 386

Query: 100 AHPAYSKHLKRLLP 113
             PA+    + ++P
Sbjct: 387 LVPAHKSQYEIMVP 400

>KLLA0F03212g Chr6 (302915..303832) [918 bp, 305 aa] {ON} similar to
           uniprot|P33303 Saccharomyces cerevisiae YJR095W SFC1
           Mitochondrial succinate-fumarate transporter transports
           succinate into and fumarate out of the mitochondrion
           required for ethanol and acetate utilization
          Length = 305

 Score = 28.5 bits (62), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 12/71 (16%)

Query: 3   ISLHNKRQRGDQNQNMSVFNVLKPLLKGSN------SFKVKLNGFL------FNNVSTIT 50
           +SL   RQ  +Q  N +V++ LK  L+G +      S++  L G +      F+N    T
Sbjct: 175 VSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDT 234

Query: 51  IRTLMKTHKGT 61
           I+T ++  K T
Sbjct: 235 IKTRLQKDKST 245

>NCAS0A05420 Chr1 complement(1071960..1073744) [1785 bp, 594 aa]
           {ON} Anc_6.347
          Length = 594

 Score = 28.5 bits (62), Expect = 4.2,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 19  SVFNVLKPLLKGSNSFKVKLNGFLFNNV-STITIRTLMKTHKGTAKRWRR 67
           S  N L  L K  N F V    F++N   S   I TL ++HK +++ ++R
Sbjct: 298 SPINTLSKLNKNYNKFIVHYYNFIYNKTHSDEIIHTLAQSHKPSSELFKR 347

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.134    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,134,022
Number of extensions: 452879
Number of successful extensions: 1120
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1117
Number of HSP's successfully gapped: 37
Length of query: 115
Length of database: 53,481,399
Length adjustment: 85
Effective length of query: 30
Effective length of database: 43,734,789
Effective search space: 1312043670
Effective search space used: 1312043670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)