Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YNL024C2.289ON24624612031e-169
Smik_14.3072.289ON24624611011e-153
Skud_14.3052.289ON24924610781e-150
Suva_14.3232.289ON25324610271e-142
NDAI0G006802.289ON2552557901e-106
NCAS0G03850singletonON2512507831e-105
NCAS0G037702.289ON2512507831e-105
KNAG0H019802.289ON2492497801e-105
CAGL0M06897g2.289ON2482497382e-98
SAKL0E07612g2.289ON2522437243e-96
KAFR0H032902.289ON2452496713e-88
KLTH0G10428g2.289ON2512426428e-84
ADL212W2.289ON2512466167e-80
Kwal_27.115132.289ON2512426132e-79
Ecym_33282.289ON2542516123e-79
KLLA0E08295g2.289ON2662405622e-71
Suva_12.2204.352ON3371461074e-05
Skud_10.3524.352ON3361331012e-04
NDAI0J028604.352ON347210978e-04
Smik_10.4224.352ON340180890.006
Smik_2.4141.325ON417129890.008
Skud_2.4031.325ON41767870.014
KNAG0C018001.325ON42167860.021
KAFR0E042804.352ON315177830.043
AER240W1.325ON390117820.062
YJR129C4.352ON339180800.089
SAKL0D06798g1.325ON421147790.13
YBR271W (EFM2)1.325ON419133760.35
Kwal_47.166354.352ON322157750.39
KNAG0E019002.259ON37552750.39
KAFR0C042501.325ON391130740.60
Suva_4.5321.325ON41664740.66
KLTH0D17996g4.352ON31782711.4
Ecym_55131.325ON39664682.9
NDAI0E039607.430ON77747693.1
TPHA0L003404.352ON341112673.8
NCAS0B074101.325ON41467674.8
Kwal_14.25501.325ON41868665.8
TDEL0D019401.325ON40565666.4
KLLA0E21539g1.325ON400105656.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL024C
         (246 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   468   e-169
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   428   e-153
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   419   e-150
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   400   e-142
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   308   e-106
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               306   e-105
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   306   e-105
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   305   e-105
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   288   2e-98
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   283   3e-96
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   263   3e-88
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   251   8e-84
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   241   7e-80
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   240   2e-79
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   240   3e-79
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   221   2e-71
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    46   4e-05
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    44   2e-04
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    42   8e-04
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    39   0.006
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    39   0.008
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    38   0.014
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    38   0.021
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    37   0.043
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    36   0.062
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    35   0.089
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    35   0.13 
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    34   0.35 
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    33   0.39 
KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.2...    33   0.39 
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    33   0.60 
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    33   0.66 
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    32   1.4  
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    31   2.9  
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...    31   3.1  
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    30   3.8  
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    30   4.8  
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    30   5.8  
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    30   6.4  
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    30   6.7  

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  468 bits (1203), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 231/246 (93%), Positives = 231/246 (93%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLI 120
           ILEKSVDHLLSKTVNGTKQFKKVLE               EKNTFHDGTKVYVTDIDKLI
Sbjct: 61  ILEKSVDHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLI 120

Query: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180
           PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL
Sbjct: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180

Query: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240
           LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL
Sbjct: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240

Query: 241 FQLIRK 246
           FQLIRK
Sbjct: 241 FQLIRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  428 bits (1101), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 209/246 (84%), Positives = 224/246 (91%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+SIFGGFGDLVVPRPKEHLGQTDLSF GKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLI 120
           ILEKSVDHLLSKTV+G K+FKKVLE               EKN +HDGTKVYVTDIDKL+
Sbjct: 61  ILEKSVDHLLSKTVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLV 120

Query: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180
           PLLKRNIELD+VQYEVLAREL WGEPLSADFSPQEG +Q NNVDLVLAADCVYLE+AFPL
Sbjct: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240
           LEKTLLDLT C++PPVILMAYKKRRKADKHFFNKIKRNFDVLEI++FSKF++YLK+RTHL
Sbjct: 181 LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL 240

Query: 241 FQLIRK 246
           FQLIRK
Sbjct: 241 FQLIRK 246

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  419 bits (1078), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 203/246 (82%), Positives = 221/246 (89%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M++IFGGF DLVVPR  EHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLI 120
           ILEKS+ HLLS+  +G +QFKKVLE               EKNTFHDG+KVYVTDIDKL+
Sbjct: 61  ILEKSLHHLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLV 120

Query: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180
           PLL+RNIELD+VQYEVLARELWWGEPLS DFSPQEG +Q NNVDLVLAADCVYLE+AFPL
Sbjct: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240
           LE+TLLDLT+CI+PPVILMAYKKRRKADKHFF+KIKRNFDVLEITDFSKF+HYLK+RTHL
Sbjct: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240

Query: 241 FQLIRK 246
           FQLIRK
Sbjct: 241 FQLIRK 246

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  400 bits (1027), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/246 (79%), Positives = 214/246 (86%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ IFGGF DLVVPR KEH GQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLI 120
           ILEKS DHLLS+TV+  + F KVLE               EKN FHD TKVYVTDID+L+
Sbjct: 61  ILEKSDDHLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLV 120

Query: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180
           PL++RNIELD+VQYEVLARELWWGEPLS DFSPQEG +Q NNVDLVLAADCVYLE+AFPL
Sbjct: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL 180

Query: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240
           LEKTLLDLT+CI+PPVILMAYKKRRKADK FFNKIKRNFDVLEI DF KF++YLK++THL
Sbjct: 181 LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL 240

Query: 241 FQLIRK 246
           FQL+RK
Sbjct: 241 FQLVRK 246

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  308 bits (790), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 189/255 (74%), Gaps = 9/255 (3%)

Query: 1   MESIFG-GFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59
           M+ IFG GF DLVV RP EHLG +DLSFGG+L   LKI EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 60  YILEKS-VDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDK 118
           +ILEKS  D LL+   + +KQF+K++E               EKN FH     Y+TDID+
Sbjct: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120

Query: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAM-------QANNVDLVLAADC 171
           ++PL+K+NI+L+ ++ EV A ELWWGEPL   F+P E +        +   VDL+LAADC
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADC 180

Query: 172 VYLEEAFPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFE 231
           VYLE+AFPLLEKTLLDLT    PP ILMAY+KRRKADKHFF KIK+NFD++EI DF K+E
Sbjct: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240

Query: 232 HYLKERTHLFQLIRK 246
           +YLK+RTHLFQLIR+
Sbjct: 241 YYLKQRTHLFQLIRQ 255

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  306 bits (783), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ IFG F  LVVPRP EHLG +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKS-VDHLLSK-TVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDK 118
           ILEKS  + LL+K   +G ++F+ VLE               EKN FH    V++TDID+
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQ--EGAMQANNVDLVLAADCVYLEE 176
           L+PL++RNIEL+ V  EV+A  LWWGEPL   F+P   +   + N VDL+LAADCVYLE+
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 177 AFPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKE 236
           AFPLLE+TLLDLT    PPVILM+Y+KRRKADKHFFNKIK+NFDV+E+ DF+K+E YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 237 RTHLFQLIRK 246
           RTHLFQL R+
Sbjct: 241 RTHLFQLARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  306 bits (783), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ IFG F  LVVPRP EHLG +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKS-VDHLLSK-TVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDK 118
           ILEKS  + LL+K   +G ++F+ VLE               EKN FH    V++TDID+
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQ--EGAMQANNVDLVLAADCVYLEE 176
           L+PL++RNIEL+ V  EV+A  LWWGEPL   F+P   +   + N VDL+LAADCVYLE+
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 177 AFPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKE 236
           AFPLLE+TLLDLT    PPVILM+Y+KRRKADKHFFNKIK+NFDV+E+ DF+K+E YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 237 RTHLFQLIRK 246
           RTHLFQL R+
Sbjct: 241 RTHLFQLARR 250

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  305 bits (780), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 185/249 (74%), Gaps = 3/249 (1%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M  IFG FGDLVV RP EH G  D+SFGG+L PAL+I EDGGESGCGGKVW+AGELLC+Y
Sbjct: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60

Query: 61  ILEKSV--DHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDK 118
           I+EKS   D L +   +  ++F+ ++E               EK  FH G KV +TDID+
Sbjct: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120

Query: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQ-EGAMQANNVDLVLAADCVYLEEA 177
           L+PL+++NIEL+ V  E++A ELWWGEPLS  F+P  EG  +  +VDL+LAADCVYLE+A
Sbjct: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180

Query: 178 FPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKER 237
           FPLLEKTLLDLT+C  PPVILMAY+KRR ADK FF KI ++F V EITDFS ++ YLK+R
Sbjct: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240

Query: 238 THLFQLIRK 246
           THLF+LIR 
Sbjct: 241 THLFELIRN 249

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  288 bits (738), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 181/249 (72%), Gaps = 4/249 (1%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           ME I G FGDL+  RP EH+GQ+DL+F G L+P LKI EDGGESGCGGKVWIAGELLCE+
Sbjct: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59

Query: 61  ILEKSVD-HLLSKTVNG-TKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDK 118
           ILEKS D  LL   +N  +  F  VLE                K       K Y+TDID+
Sbjct: 60  ILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQ 119

Query: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSP-QEGAMQANNVDLVLAADCVYLEEA 177
           L+PL+++N+EL+ +  +V A+EL WGE L  +F+P + G    +++DLVLAADCVYLE+A
Sbjct: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKA 179

Query: 178 FPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKER 237
           FPLLEKTLLDLT C NPPVILMAY+KRRKADKHFF KI++NF+V+ I DF  ++ YLK+R
Sbjct: 180 FPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQR 239

Query: 238 THLFQLIRK 246
           THLFQL+RK
Sbjct: 240 THLFQLVRK 248

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  283 bits (724), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 176/243 (72%), Gaps = 7/243 (2%)

Query: 8   FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67
           F DLV  RP EHLG +DLSFGGKL P LKI EDGGESGCGGKVWIAGELLCE++LEKS  
Sbjct: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70

Query: 68  HLLSKTVNGTKQF----KKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLIPLL 123
             L    N   +F    KK++E                K        +YVTDID+L+ L+
Sbjct: 71  QGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLM 130

Query: 124 KRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEK 183
            RNI+L+E+++ V  +ELWWGEPL  +F+P     +   VDL+LAADCVYLE+AFPLLE 
Sbjct: 131 DRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQR--QVDLILAADCVYLEKAFPLLEV 187

Query: 184 TLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQL 243
           TLLDLT C +PP+ILM+YKKRRKADKHFF +IK+NFDVLEI +F++F+HYLK++THLFQL
Sbjct: 188 TLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQL 247

Query: 244 IRK 246
           +RK
Sbjct: 248 VRK 250

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  263 bits (671), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 170/249 (68%), Gaps = 7/249 (2%)

Query: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M  +FG +  L+  RP EHLG  DLSF G+L PA+KI EDGG SGCGGKVWIAGELLCEY
Sbjct: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60

Query: 61  ILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLI 120
           ++EKS     S+ +      K +LE               EK  FH   KV +TDI  L+
Sbjct: 61  LIEKSD----SENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLV 116

Query: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADF---SPQEGAMQANNVDLVLAADCVYLEEA 177
           PL++RNI L+++    +A+EL WG+ L +++   S        +NVDLV+AADCVY E+A
Sbjct: 117 PLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKA 176

Query: 178 FPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKER 237
           FPLLEK LLDLT+C NPP+ILMAY+KRRKADK FF +I++NFDV+EI DFS  E Y+K+R
Sbjct: 177 FPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQR 236

Query: 238 THLFQLIRK 246
           THLF+L RK
Sbjct: 237 THLFELKRK 245

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  251 bits (642), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 132/242 (54%), Positives = 167/242 (69%), Gaps = 8/242 (3%)

Query: 8   FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67
           F DLV  RP EH G +DL+FGG++ PALKI EDGGESGCGGK+WIAGELLCEY+LE S D
Sbjct: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70

Query: 68  H-LLSKTVN---GTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLIPLL 123
           + +LSK +N     K F  +LE                +    +  KV++TDID+L+ L+
Sbjct: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQLVRLM 129

Query: 124 KRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEK 183
           + N+EL+ +   V A +LWWGEPL  +F P      +N  DLVLAADCVYLE AFPLLEK
Sbjct: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGPDA---ISNKTDLVLAADCVYLETAFPLLEK 186

Query: 184 TLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQL 243
           TLLDLT    PPV+LM+Y+KRRKAD+ FF  I++NF V+ IT F + + +LK+RTHLFQL
Sbjct: 187 TLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQL 246

Query: 244 IR 245
           IR
Sbjct: 247 IR 248

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  241 bits (616), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 171/246 (69%), Gaps = 8/246 (3%)

Query: 2   ESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYI 61
           E+    F DLV PRP EHLGQ+DLS+ G+L P LKI EDGGESGCGGKVWIAG LLCE+I
Sbjct: 3   ETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFI 62

Query: 62  LEKSVD-HLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLI 120
           LEKS D  +LS+     +QFK ++E                K      T VY+TDI+ L 
Sbjct: 63  LEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLC 122

Query: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180
           PL+++N+EL+ +   V  R L+WGEPLS +F+ Q        +DLVLAADCVYLE+AFPL
Sbjct: 123 PLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQP-------IDLVLAADCVYLEKAFPL 175

Query: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240
           LEKTLLDLT   + P++LM+YKKRRKADK FF KIK+ FD++EI DF  +E Y ++RT+L
Sbjct: 176 LEKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYL 235

Query: 241 FQLIRK 246
           FQL+RK
Sbjct: 236 FQLVRK 241

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  240 bits (613), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 166/242 (68%), Gaps = 8/242 (3%)

Query: 8   FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-V 66
           F DLV  RP EHLG +DLSFGG++ PALKI EDGGE+GCGGK+W+AGELLC+Y+LE S  
Sbjct: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70

Query: 67  DHLLSKTV---NGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLIPLL 123
             +LSK +   +    F  +LE                +    D TKVY+TDID+L+ L+
Sbjct: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ-LHGDRTKVYITDIDRLVGLM 129

Query: 124 KRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEK 183
           + N+ L+ +   V    L WGEPL   F P     +A+ VDLVLAADCVYLE AFPLLEK
Sbjct: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGPDA---KADKVDLVLAADCVYLETAFPLLEK 186

Query: 184 TLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQL 243
           TLLDLT    PP +LM+Y+KRRKADK+FF  I++NF ++ IT+F ++++YLK++THLFQL
Sbjct: 187 TLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQL 246

Query: 244 IR 245
           +R
Sbjct: 247 VR 248

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  240 bits (612), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 170/251 (67%), Gaps = 12/251 (4%)

Query: 1   MESIFGG-FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59
           M  +F   F +LV   P EHLG +DLSF G+L P LKI EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 60  YILEKSVD-HLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFH--DGTKVYVTDI 116
           ++LEKS D  LLSK V   KQF KVLE                 N  H  +   VY+TDI
Sbjct: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM--HNIMHEVNDMDVYITDI 118

Query: 117 DKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEE 176
           D L PL+ RN+ ++ ++  V  REL+WG+ L A+F  ++       VDL+LAADCVYLE+
Sbjct: 119 DTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSP-----VDLILAADCVYLEK 173

Query: 177 AFPLLEKTLLDLTHCIN-PPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLK 235
           AFPLLE  LL+LT      PV+LM+Y+KRRKADK FF KIK++F + E+TDF +++ Y+K
Sbjct: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIK 233

Query: 236 ERTHLFQLIRK 246
           +RTH+FQL+R+
Sbjct: 234 QRTHIFQLVRR 244

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  221 bits (562), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 162/240 (67%), Gaps = 9/240 (3%)

Query: 8   FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-V 66
           F +LV  RP EHLG+ D+SF GKL   L I EDGGESGCGGKVWIAGELLCEYILEKS  
Sbjct: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93

Query: 67  DHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLIPLLKRN 126
           +HLLS           VLE               ++   +   +VY++DID+L+ L++ N
Sbjct: 94  EHLLSHLFP-DGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESN 152

Query: 127 IELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEKTLL 186
           I+++ +  +V A  LWWG PL   F  +        VDLVLAADCVYLE AFPLLEKTLL
Sbjct: 153 IQVNGLDDKVHAEVLWWGNPLPDVFVKKP-------VDLVLAADCVYLEAAFPLLEKTLL 205

Query: 187 DLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQLIRK 246
           +LT   N P+ILMAYKKRRKADKHFF KIK+NF ++EI DF  F+ YLK+RTHLFQL+R+
Sbjct: 206 ELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 69/146 (47%), Gaps = 25/146 (17%)

Query: 109 TKVYVTDIDKLI--PLLKRNIELDEVQYE----VLARELWWGEPLSADFSPQEGAMQANN 162
           +K+YVTD D  +    L+RN EL++   E    +  + LWWG    +D  P E       
Sbjct: 191 SKMYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWG----SDRVPDE------- 239

Query: 163 VDLVLAADCVYLEEAFPLLEKTL---LDLTHCINPPVILMAYKKRRKADKHFF---NKIK 216
           V+LV+AAD  Y    FP L + L   L ++HC     +L A  +    DK F    +K+ 
Sbjct: 240 VNLVVAADVTYDSTIFPELCQCLAECLAMSHC--KVCLLSATIRSYSTDKEFAQECHKVG 297

Query: 217 RNFDVLEITDFSKFEHYLKERTHLFQ 242
             + V+  T++ +      E + LF+
Sbjct: 298 LKYSVVTSTEYDRNSEARMEESLLFK 323

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 63/133 (47%), Gaps = 25/133 (18%)

Query: 109 TKVYVTDIDKLI--PLLKRNIELDEVQYE----VLARELWWGEPLSADFSPQEGAMQANN 162
            ++YVTD D  +    LKRN EL++   E    V  + LWWG    +D  P       ++
Sbjct: 191 NRMYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWG----SDRIP-------DD 239

Query: 163 VDLVLAADCVYLEEAFPLLEKTL---LDLTHCINPPVILMAYKKRRKADKHFF---NKIK 216
           +DLV+AAD  Y    FP L + L   L ++ C     +L A  +    DK F    NKI 
Sbjct: 240 IDLVVAADVTYDSTIFPELCQCLAECLAISRC--KMCLLSATIRSESTDKLFAQECNKIG 297

Query: 217 RNFDVLEITDFSK 229
            N+ V+  T+  K
Sbjct: 298 LNYTVVSSTEHDK 310

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 76/210 (36%), Gaps = 36/210 (17%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXX 100
            G+S  G + W     L ++++     +L+ KT         V+E               
Sbjct: 136 SGKSTTGFRTWEGAVYLSKFLINNCEKYLIEKT--------DVIELGAGTGLVSLCILEN 187

Query: 101 EKNTFHDGTKVYVTDIDK--LIPLLKRNIELDEVQYE---VLARELWWGEPLSADFSPQE 155
           +        KVYVTD D   +  +L +N EL+ V  E   V+ R+LWW +P         
Sbjct: 188 DLQKGIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIAGEDN 247

Query: 156 GAMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKI 215
           G      + LV+ AD  Y     P       DL  C      L  +  + +  K   +  
Sbjct: 248 GK-----IGLVVGADITYDNSVIP-------DLCAC------LKQFMDKNRDCKAIISAT 289

Query: 216 KRNFDVLEITDFSKFEHYLKERTHLFQLIR 245
            RN D +       FE   +E     Q+I+
Sbjct: 290 VRNIDTINF-----FERKCEELGMKVQIIQ 314

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 74/180 (41%), Gaps = 23/180 (12%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXX 100
              S  G + W A   + ++++ K +  L + T    ++ KK L                
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQEL-ALTQEEQEEDKKKLNVLEIGAGTGIVSLVL 185

Query: 101 EKNTFHDGTKVYVTDIDKLI--PLLKRNIELDEVQYE----VLARELWWGEPLSADFSPQ 154
            +N  +   K+YVTD D  +    LK+N EL++   E    +  + LWWG    +D  P 
Sbjct: 186 SQNYRNFVNKMYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWG----SDKVP- 240

Query: 155 EGAMQANNVDLVLAADCVYLEEAFPLLEKTL---LDLTHCINPPVILMAYKKRRKADKHF 211
                 +++DLV+ AD  Y    FP L K L   L +  C     +L A  +    DK F
Sbjct: 241 ------DDIDLVVGADVTYDSTIFPELCKCLAECLAINRC--KMCLLSATIRSESTDKLF 292

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 61/129 (47%), Gaps = 7/129 (5%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVN-GTKQFKKVLEXXXXXXXXXXXXXXXEKNTF 105
           G K W +  +L + ++++     +    N GTK+ K VLE                K  +
Sbjct: 219 GWKTWGSSLILSQLVVDRLHTADMDFVANRGTKRIK-VLELGSGTGLVGLSWASKWKELY 277

Query: 106 H-DGTKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVD 164
             D T+++VTD+  ++  LK+N+ L+ +Q  V A  L W  P S  F  + G    N  D
Sbjct: 278 GIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNPQS--FIDRFGY--ENEFD 333

Query: 165 LVLAADCVY 173
           ++L AD +Y
Sbjct: 334 IILIADPIY 342

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 107 DGTKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLV 166
           D  +++VTD+ +++  LK+N+ L+ +Q  V A  L W  P   DF  + G    N  D++
Sbjct: 280 DKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNP--QDFIDRFG--HENEFDII 335

Query: 167 LAADCVY 173
           L AD +Y
Sbjct: 336 LVADPIY 342

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 110 KVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAA 169
           ++Y+TD+ +++  LK+N++L+++++ V+A  L W  P   +F  +    Q+   DL+L A
Sbjct: 286 QIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLDWTNPY--NFIERYNGEQS--FDLILVA 341

Query: 170 DCVYLEE 176
           D +Y  E
Sbjct: 342 DPIYSPE 348

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 77/177 (43%), Gaps = 30/177 (16%)

Query: 44  SGCGGKVWIAGELLCEYILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKN 103
           S  G + W A   LC+YI   +VD   ++++NG      VLE                K 
Sbjct: 113 STTGFRTWEAASYLCDYI--SNVD---TESLNGC---STVLELGAGTGLCSLTLL---KG 161

Query: 104 TFHDG-TKVYVTDID-KLIP-LLKRNIELDEVQYE----VLARELWWGEPLSADFSPQEG 156
            F D   KVYVTD D +LI   L  N +L+E+++E    V  + L WGE    D  P   
Sbjct: 162 KFQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGE----DSIP--- 214

Query: 157 AMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHCINPPVILMAYKKRR-KADKHFF 212
               N++D V+ AD  Y +  F  L K L       +  + L+A   R  + D+ F 
Sbjct: 215 ----NDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKFL 267

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 10/117 (8%)

Query: 69  LLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLIPLLKRNIE 128
           LLS+ V G    K+VLE                     D   V+VTD+ +++P L+ N+ 
Sbjct: 218 LLSRRVAGFTGKKRVLELGAGTGLVGIAYALANI----DADDVFVTDLPEIVPNLRHNLA 273

Query: 129 LDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEKTL 185
           L+ +   V A  L W +P S  F  + G +Q    D +  AD +Y      LL +T+
Sbjct: 274 LNNLT-NVRASVLDWSDPTS--FLHEHGELQ---FDAIFVADPIYSPNHPQLLVQTV 324

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 35.4 bits (80), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 71/180 (39%), Gaps = 19/180 (10%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXX 100
              S  G + W A   + ++++ K +  L    V G    KK L                
Sbjct: 127 SAASTTGFRTWEAALYMGDFLIHKPLQEL--APVQGQDDGKKKLNVLEVGAGTGIVSLVI 184

Query: 101 EKNTFHDGTKVYVTDIDKLI--PLLKRNIELD----EVQYEVLARELWWGEPLSADFSPQ 154
            +       K+YVTD D  +    LKRN EL+    E + ++  + LWWG    +D  P+
Sbjct: 185 LQKYHEFVNKMYVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWWG----SDRVPE 240

Query: 155 EGAMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNK 214
                  ++DLV+ AD  Y     P L + L +        + L++   R ++    F++
Sbjct: 241 -------DIDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLSATIRSESTVQLFSQ 293

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 66/147 (44%), Gaps = 17/147 (11%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVNGTKQFKKVLEXXXXX--XXXXXXXXXXEKNT 104
           G K W A  +L + I  +      +    GT    +VLE                 E  T
Sbjct: 220 GLKTWGASLILSQKICNR-----FNSIFAGTGNLLRVLELGSGTGLVGITFSCKYKESKT 274

Query: 105 FHDGTKVYVTDIDKLIPLLKRNIELDEVQYE----VLARELWWGEPLSADFSPQEGAMQA 160
                ++Y+TD+ +++P L++N+E++ +  +    V A  L W  P+S  F+ + G    
Sbjct: 275 ALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPVS--FTEKYG---D 329

Query: 161 NNVDLVLAADCVYLEEAFPLLEKTLLD 187
           +  D++L AD +Y  +  P+   T++D
Sbjct: 330 DKFDVILIADPIYSPQ-HPVWVVTMID 355

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

Query: 47  GGKVWIAGELLCEYILEKSVDHLLSKTVN-----GTKQFKKVLEXXXXXXXXXXXXXXXE 101
           G K W +  +L + +++  +D+L +  VN       KQ K VLE                
Sbjct: 218 GWKTWGSSLILSQLVVDH-LDYLHTTNVNMLANSDIKQIK-VLELGAGTGLVGLSWALKW 275

Query: 102 KNTF-HDGTKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQA 160
           K  +  +  +++VTD+ +++  LK+N+ L+ +   V A  L W  P   DF  + G    
Sbjct: 276 KELYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNP--HDFIDKFG--HE 331

Query: 161 NNVDLVLAADCVY 173
           N  D++L AD +Y
Sbjct: 332 NEFDVILIADPIY 344

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 60/157 (38%), Gaps = 39/157 (24%)

Query: 37  ICEDGGESGCGGKVWIAGELLCEYILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXXXXX 96
           +C  G     G + W A   L EY+++       ++      +F ++LE           
Sbjct: 127 LCASGT---TGFRTWEAALYLAEYLVQ-------NQEYYAQDRFSRILELGAGTGLVSLV 176

Query: 97  XXXXEKNTFHDGTKVYVTDIDKLI--PLLKRNIELDEV----------QYEVLARELWWG 144
                + T  +   +YVTD D  +    ++ N +L+ V          QY+   + LWWG
Sbjct: 177 WSQLFQATMKE---LYVTDGDSTLVEQAIRYNFQLNNVTAAPANTLDCQYKF--QRLWWG 231

Query: 145 EPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLL 181
           E +  D            VD+VLAAD  Y     P L
Sbjct: 232 EDVVPD------------VDIVLAADVTYDASVVPSL 256

>KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.259
           YIL110W
          Length = 375

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 153 PQ-EGAMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHCINPPVILMAYKK 203
           PQ EG   A+   LVL ++ +Y  E  PL+ +TLLDL   I  P  ++   K
Sbjct: 287 PQCEGTTAAS---LVLTSETIYQPENLPLITETLLDLKGYIGGPTTVLVAAK 335

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 58/130 (44%), Gaps = 11/130 (8%)

Query: 45  GCGGKVWIAGELLCEYILEKSVDHLLSKTVNGTKQFKKVLEXXXXXXXX-XXXXXXXEKN 103
             G K W    L+   IL   +D    K+ NG    K++LE                E+ 
Sbjct: 192 NLGWKTW-GSSLILSNILCDRIDENFLKSFNG----KRILELGSGTGLVGISVASKLEEI 246

Query: 104 TFHDGTKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNV 163
              D  ++Y+TD+ +++  L++NI ++++   V++  L W  P S  F    G  +    
Sbjct: 247 GVLDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTNPES--FVSNYGDTR---F 301

Query: 164 DLVLAADCVY 173
           D++L +D +Y
Sbjct: 302 DVLLISDPIY 311

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 110 KVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAA 169
           ++YVTD+ +++  LK+N+ L+ ++  V A  L W  P   +F  Q G     + D++L A
Sbjct: 282 EIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNP--QNFINQFG--HEMDFDIILVA 337

Query: 170 DCVY 173
           D +Y
Sbjct: 338 DPIY 341

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 32/82 (39%), Gaps = 25/82 (30%)

Query: 139 RELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHCINPPV-- 196
           + LWWGE    D  P+        VD+VLAAD  Y     P        LTHC+   +  
Sbjct: 215 QRLWWGE----DAVPE--------VDIVLAADVTYDSSVIP-------SLTHCLKTALSQ 255

Query: 197 ----ILMAYKKRRKADKHFFNK 214
                L+A   R K     F +
Sbjct: 256 GTQFALVAATVRNKCTTMAFER 277

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 37/64 (57%), Gaps = 6/64 (9%)

Query: 110 KVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAA 169
           ++ +TD+  ++P L+ NI+L+ ++  V A EL W +   + F  Q G    +  D++L +
Sbjct: 264 QIILTDLPDIVPNLRSNIKLNNLK-NVHAAELDWTD--HSTFIAQHG---GDKFDMILVS 317

Query: 170 DCVY 173
           D +Y
Sbjct: 318 DPIY 321

>NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {ON}
           Anc_7.430
          Length = 777

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 17  KEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILE 63
           KE L + D+  GGK+   L   ED   SGCG  +  A  +    I E
Sbjct: 608 KECLARLDVCMGGKIAEELIFGEDNVTSGCGSDLRTATNMARAMITE 654

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 48/112 (42%), Gaps = 17/112 (15%)

Query: 109 TKVYVTDIDK--LIPLLKRNIELDEVQYE--VLARELWWGEPLSADFSPQEGAMQANNVD 164
           T +Y+TD D   L   L RN+ L+ +     V  ++L W E    D  P       +N+D
Sbjct: 193 TTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNE----DHIP-------DNLD 241

Query: 165 LVLAADCVYLEEAFPLLEKTLLDLTHCIN--PPVILMAYKKRRKADKHFFNK 214
           L++AAD  Y     P L   +LD     N    V  +A  +R +     F +
Sbjct: 242 LIVAADVTYDSSVIPSLCHCILDCFKSSNKCSTVCYLAATRRNQETIAVFEQ 293

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 107 DGTKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLV 166
           +  +++VTD+  ++  LK+N++ +++   V A  L W  P   DF  + G  +    D++
Sbjct: 278 ENIEMFVTDLPDIVANLKKNVQTNDLTTFVEADILDWTNP--DDFIEKHGDEK---FDVI 332

Query: 167 LAADCVY 173
           L AD +Y
Sbjct: 333 LVADPIY 339

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 9/68 (13%)

Query: 110 KVYVTDIDKLIPLLKRNIELD----EVQYEVLARELWWGEPLSADFSPQEGAMQANNVDL 165
           +V++TD+  ++P L++N++L+    E   EV    L W +P S  F  + G  +    D+
Sbjct: 278 RVHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVDVLDWTDPSS--FQEKYGYKK---FDV 332

Query: 166 VLAADCVY 173
           +L AD +Y
Sbjct: 333 LLIADPIY 340

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 109 TKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLA 168
           T++++TD+  ++  L++N+E+++V+       L W +P   DF     +   +  D+++ 
Sbjct: 270 TEIFLTDLPVIVANLQKNVEVNKVESFATVSALDWTDP--TDFI---NSYTDDEFDILIV 324

Query: 169 ADCVY 173
           +D +Y
Sbjct: 325 SDPIY 329

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 69  LLSKTVNGTKQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGTKVYVTDIDKLIPLLKRNIE 128
           +LS+ + G    K+VLE                 ++ +  + +++TD+ +++P L+ N+ 
Sbjct: 226 MLSQKIIGIPAGKRVLELGSGTGLVGISYAL--THSINGDSVIFLTDLPEILPNLQYNVR 283

Query: 129 LDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVY 173
           L+ +  +V A  L W +PLS  F+ + G       D ++ AD +Y
Sbjct: 284 LNNLN-DVTADVLDWTDPLS--FTEKYG---NEPFDTIVIADPIY 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.141    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,262,701
Number of extensions: 1105206
Number of successful extensions: 2807
Number of sequences better than 10.0: 53
Number of HSP's gapped: 2810
Number of HSP's successfully gapped: 53
Length of query: 246
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 139
Effective length of database: 41,212,137
Effective search space: 5728487043
Effective search space used: 5728487043
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)