Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YNL023C (FAP1)2.288ON96596550670.0
Smik_14.3082.288ON96596444250.0
Skud_14.3062.288ON97096042350.0
Suva_14.3242.288ON96896541530.0
NDAI0G006702.288ON96893832490.0
NCAS0G037802.288ON95793032250.0
KNAG0H019902.288ON97397030140.0
KAFR0H033002.288ON96693630070.0
TDEL0G021902.288ON93692429550.0
CAGL0M06919g2.288ON95691329330.0
TBLA0B059502.288ON99594228900.0
ZYRO0A01936g2.288ON95389927760.0
Kpol_1039.452.288ON96890926840.0
SAKL0E07634g2.288ON97491026660.0
KLTH0G10406g2.288ON96389726370.0
Kwal_27.115182.288ON95392526030.0
TPHA0D015302.288ON96292825290.0
KLLA0E08317g2.288ON92189924130.0
Ecym_33272.288ON92693522530.0
ADL213W2.288ON90890322510.0
TBLA0D040208.288ON117848735.1
CAGL0B02013g8.288ON112040735.5
KLLA0F19734g8.288ON113340727.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL023C
         (965 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1956   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1709   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1635   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1604   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1256   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1246   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1165   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1162   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1142   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1134   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1117   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1073   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1038   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1031   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1020   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...  1007   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   978   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   934   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   872   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   871   0.0  
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    33   5.1  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   5.5  
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    32   7.6  

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1956 bits (5067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 955/965 (98%), Positives = 955/965 (98%)

Query: 1   MTEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSYEEESDDDMQYYERAIQEI 60
           MTEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSYEEESDDDMQYYERAIQEI
Sbjct: 1   MTEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSYEEESDDDMQYYERAIQEI 60

Query: 61  SSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYV 120
           SSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYV
Sbjct: 61  SSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYV 120

Query: 121 SKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICHLGPHPECTRMVE 180
           SKRVPVKNRPTCWCGKVV          SCGQTCNASTCMHGCSKICHLGPHPECTRMVE
Sbjct: 121 SKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHLGPHPECTRMVE 180

Query: 181 IMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISK 240
           IMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISK
Sbjct: 181 IMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISK 240

Query: 241 DSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKH 300
           DSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKH
Sbjct: 241 DSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKH 300

Query: 301 SFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPL 360
           SFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPL
Sbjct: 301 SFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPL 360

Query: 361 KCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH 420
           KCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH
Sbjct: 361 KCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH 420

Query: 421 RCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG 480
           RCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG
Sbjct: 421 RCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG 480

Query: 481 KCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHS 540
           KCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHS
Sbjct: 481 KCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHS 540

Query: 541 LDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNC 600
           LDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNC
Sbjct: 541 LDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNC 600

Query: 601 QKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRV 660
           QKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRV
Sbjct: 601 QKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRV 660

Query: 661 SVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLP 720
           SVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLP
Sbjct: 661 SVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLP 720

Query: 721 FTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE 780
           FTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE
Sbjct: 721 FTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE 780

Query: 781 SQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINF 840
           SQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINF
Sbjct: 781 SQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINF 840

Query: 841 EVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALV 900
           EVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALV
Sbjct: 841 EVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALV 900

Query: 901 YPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDSPV 960
           YPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDSPV
Sbjct: 901 YPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDSPV 960

Query: 961 MDNNT 965
           MDNNT
Sbjct: 961 MDNNT 965

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1709 bits (4425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 820/964 (85%), Positives = 873/964 (90%)

Query: 1   MTEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSYEEESDDDMQYYERAIQEI 60
           MT+HESL L+QNQ+GG   R H+LS    SSVED NEQPSSYEEE+DDDMQYYER+IQEI
Sbjct: 1   MTDHESLDLKQNQEGGGVCRRHSLSSEQDSSVEDNNEQPSSYEEETDDDMQYYERSIQEI 60

Query: 61  SSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYV 120
           S GDSY+CMICTVEMDYTCQMFACKRCYRVFDYGCIREWA+KSTEKTVDRIWKCPNCY+V
Sbjct: 61  SKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHV 120

Query: 121 SKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICHLGPHPECTRMVE 180
            K+VP  NRPTCWCGKVV          SCGQTC+A  C+HGCSK CHLGPHPECTRMVE
Sbjct: 121 GKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCHLGPHPECTRMVE 180

Query: 181 IMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISK 240
           IMCHCGKHS+SIFCYQSK MKKNF CQE CGLPLSCS+H CK+KCH GLCGPCPE+I SK
Sbjct: 181 IMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSK 240

Query: 241 DSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKH 300
           DS ++QIKCYCGNH+RA+IKCSE +FPKSG+SSKD NGN WIGVFAC D R VD+SCRKH
Sbjct: 241 DSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKH 300

Query: 301 SFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPL 360
           SFIE C+SPP++NG K CPFLPS LKTCPCGRTAL+ELTKPRKHCDDPIPTC+SRC KPL
Sbjct: 301 SFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPL 360

Query: 361 KCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH 420
           KCGKHSCPF CHD ACM+PCLQIDS KCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH
Sbjct: 361 KCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH 420

Query: 421 RCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG 480
           RCTDRCCSGRPSA++R+KN FR+QDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG
Sbjct: 421 RCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG 480

Query: 481 KCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHS 540
           KCPPCLESDSNDL+CPCG TVVPAPVRCGT+LP CNHPCIKVVRGES+CGHKPMPHTCH 
Sbjct: 481 KCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHP 540

Query: 541 LDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNC 600
           L V CPPCTETVFKPCKCGKK KVRTVCFQ DVSCG KCG+ L +C HTCQKTCHLPGNC
Sbjct: 541 LGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNC 600

Query: 601 QKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRV 660
           QKVCKQ CG +RL+C H CPKPCHGKTECPDLPC TLVKI CKCGR +KSVTC AKS  V
Sbjct: 601 QKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVV 660

Query: 661 SVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLP 720
              ESSVLDC+EECEALKRLKEL+EAFGIKEE+NN TSNELDALKKLVSVATTFEEL LP
Sbjct: 661 PANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLP 720

Query: 721 FTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE 780
           FTE  LSVYSKQERWCSQIE ILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE
Sbjct: 721 FTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE 780

Query: 781 SQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINF 840
           SQDREPMRSVFIKKEDNG SNKPVLSL EA PLYESFKQLQKERK QEFQ+RTTAKLINF
Sbjct: 781 SQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINF 840

Query: 841 EVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALV 900
           EVQD +PKVEVAK NGFLV+NLV GNT EDL+RFFEPHLKHTLVVNPQYLILDDGKTALV
Sbjct: 841 EVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALV 900

Query: 901 YPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDSPV 960
           YPENYETASVNTERDMELLVGHFDFMAKEAFLADSI LCST+EE+ +RLDTPVIQED+ +
Sbjct: 901 YPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRLDTPVIQEDTSI 960

Query: 961 MDNN 964
            D N
Sbjct: 961 EDKN 964

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1635 bits (4235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 781/960 (81%), Positives = 847/960 (88%), Gaps = 2/960 (0%)

Query: 1   MTEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSYE--EESDDDMQYYERAIQ 58
           +TEHESL LEQ+Q+GG  ++HH+LS+G + SVED++EQ SSYE  EESDDD+QYYERAIQ
Sbjct: 4   ITEHESLDLEQDQNGGGIHKHHSLSNGHVLSVEDSSEQLSSYEFEEESDDDLQYYERAIQ 63

Query: 59  EISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCY 118
           EI+ GDSY+CMICTVEMDYTCQMFACK+CYRVFDY CIREWALKSTEKTVD+IWKCPNCY
Sbjct: 64  EIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCY 123

Query: 119 YVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICHLGPHPECTRM 178
           +V K+VP +NRPTCWCG VV          SCGQTCNA TC+HGC KICHLGPHPECTRM
Sbjct: 124 HVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRM 183

Query: 179 VEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMII 238
           VEI CHCG+HSK+IFCYQSK M++ FNCQE CGL LSC +H CKKKCH GLCG CPE II
Sbjct: 184 VEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFII 243

Query: 239 SKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCR 298
           + DS KKQIKCYCGNH + +IKCSE +FPKSG++SKDE+GN W GVFACAD R VDY+C 
Sbjct: 244 NDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACH 303

Query: 299 KHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGK 358
           KHSFIE C+SPPTI+G+K CPFLPS LKTCPCGRTALEELTKPRKHC DPIPTC+SRC K
Sbjct: 304 KHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSK 363

Query: 359 PLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCR 418
           PLKCGKH CPFTCHD ACM+PCLQIDS  C+CEQSTFS+PCGFQ  PRCNIKCESLMSCR
Sbjct: 364 PLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCR 423

Query: 419 RHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCH 478
           RHRC DRCCSGRPSAIRRKK+ FR+QDLLDESLVEAKHICLKPCNLTLSCG+HKCQRKCH
Sbjct: 424 RHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCH 483

Query: 479 PGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTC 538
           PGKCPPCLESDSNDL+C CG TVVPAPVRCGTKLPTCNHPCIKVVRGES CGHKPMPHTC
Sbjct: 484 PGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTC 543

Query: 539 HSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPG 598
           H  ++SCPPCTETVFKPC+CGKK KVRTVCFQ DVSCG  CGIPLS CYHTCQKTCHL G
Sbjct: 544 HPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCHLLG 603

Query: 599 NCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSD 658
            CQKVCKQ CGQKRL+C H CPKPCHGKTECPDLPCA LVKI C+CGRIKKS+TC AK D
Sbjct: 604 KCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRD 663

Query: 659 RVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQ 718
            VSV  SS+LDCNEECE LKRLKEL+EAFG+ E  NN   NELDAL +LVSVA TFEELQ
Sbjct: 664 TVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFEELQ 723

Query: 719 LPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLY 778
           LPFTEA LSVYSKQERWC QIE ILNKLMD + RSSLHFKPMRPPQRHFI E+AKAY LY
Sbjct: 724 LPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLY 783

Query: 779 SESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLI 838
           +ESQDREPMRSVFIKKEDN  S KPVLSLAEAYPLYESFKQ QKERK QEFQARTTAKLI
Sbjct: 784 AESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLI 843

Query: 839 NFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTA 898
           NFEVQD E K+E AK NGFLVQNLV+GNT EDL+RFFEPHLKHTLV NPQYLILDD ++A
Sbjct: 844 NFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSA 903

Query: 899 LVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDS 958
           L+YPENYETASVNTERDMELLVGHFDFMAKEAFLADSI LCS +EE+ +RLD+P IQE S
Sbjct: 904 LIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRLDSPAIQEVS 963

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1604 bits (4153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 776/965 (80%), Positives = 844/965 (87%), Gaps = 3/965 (0%)

Query: 2   TEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSY--EEESDDDMQYYERAIQE 59
            E ESL LEQ+Q+G D + H  L+D  +S VE ++EQ S+Y  EEESDDDMQYYERAIQE
Sbjct: 5   NERESLDLEQSQNGSDVHEH-CLNDEHVSGVEVSHEQSSTYDSEEESDDDMQYYERAIQE 63

Query: 60  ISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYY 119
           I+ GDSY+CMICTVEMDYTCQMFACK+CYRVFDY CIREWALKSTEKTVD+IWKCPNCY+
Sbjct: 64  IAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYH 123

Query: 120 VSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICHLGPHPECTRMV 179
           + K+VP +NRPTCWCGKVV          SCGQTCNA TC+HGCSKICHLGPHPECTR V
Sbjct: 124 IGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICHLGPHPECTRTV 183

Query: 180 EIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIIS 239
           EI C CGKHSKSIFCYQSK MKK+F+CQE CGLPLSC IH CKKKCH GLCGPCPE+I+S
Sbjct: 184 EIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHSGLCGPCPELIMS 243

Query: 240 KDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRK 299
           +D     IKCYCG H++ +IKC E  FPKSG+SSKDE+GN WIGVFAC D R VDY+C K
Sbjct: 244 EDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFACKDIRTVDYACHK 303

Query: 300 HSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKP 359
           HSFIE CISPPT+NG+K CPFLPS LKTCPCGRTALEELTKPRKHC DPIPTC SRC KP
Sbjct: 304 HSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTDPIPTCSSRCSKP 363

Query: 360 LKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRR 419
           LKCGKHSCPF CHD ACM+PCLQ DSVKCACEQSTF VPCGFQ +P CNIKCESLMSCRR
Sbjct: 364 LKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCNIKCESLMSCRR 423

Query: 420 HRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHP 479
           HRC DRCCSGRPSA+ RKK +FR+QDL+DESLVEA+HICLKPCNLTLSCGIHKCQRKCHP
Sbjct: 424 HRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLSCGIHKCQRKCHP 483

Query: 480 GKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCH 539
           GKCPPCLESDSNDLVCPCG TV+PAPVRCGTKLP CN+ CIKVVRGES CGHKPMPHTCH
Sbjct: 484 GKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGESECGHKPMPHTCH 543

Query: 540 SLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGN 599
            LD++CPPCTETVFKPCKCGKK KVRTVCFQTDVSCG  CG PLS C+HTCQKTCHLP N
Sbjct: 544 PLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCHHTCQKTCHLPEN 603

Query: 600 CQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDR 659
           CQKVCKQ C QKR NC+H CPKPCHG++ECPDLPCA+LVKI CKCGRI+K V CGAKS+ 
Sbjct: 604 CQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRIEKKVACGAKSNV 663

Query: 660 VSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQL 719
           VSVTE+  LDCNEECEALKRLKEL+EAFGI EE+N  T+NELD LKKLVSVATTFEELQL
Sbjct: 664 VSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKKLVSVATTFEELQL 723

Query: 720 PFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYS 779
           PFTE  LSVY+KQE WC QIE I+NKLM DKTRSSLHFKPMRPPQRHFIRELAKAY LYS
Sbjct: 724 PFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHFIRELAKAYNLYS 783

Query: 780 ESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLIN 839
           ESQDREPMRSVFIKKEDN  S++P+LSLAEA+PLYESFK+LQKERK QEFQARTTAKLIN
Sbjct: 784 ESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQEFQARTTAKLIN 843

Query: 840 FEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTAL 899
           FEV+D EPKVE+AK NGFLVQ LV GN  +DLRRFFEPHLKHTLVV PQYLI+DDGKTAL
Sbjct: 844 FEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKPQYLIIDDGKTAL 903

Query: 900 VYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDSP 959
           VYPENY+  SVNTERDM++LVGHFDFMAKEAFLADSISLCS +EEL RRLD PV Q DS 
Sbjct: 904 VYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELGRRLDPPVTQGDSL 963

Query: 960 VMDNN 964
             + N
Sbjct: 964 AKEEN 968

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1256 bits (3249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/938 (63%), Positives = 716/938 (76%), Gaps = 9/938 (0%)

Query: 29  ISSVEDANE--QPSSYEEE--SDDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFAC 84
           +SS  D +E  Q   Y     +D+DM+YYER IQEI+ GDSYVCMICTVEMDYTCQM+AC
Sbjct: 33  VSSTSDNDEYDQEDEYAAATAADEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYAC 92

Query: 85  KRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXX 144
           K CYRVFDY CIREWA+KSTEKTVDRIWKCPNCY+V+K+VP KNR TCWCGKVV      
Sbjct: 93  KECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANP 152

Query: 145 XXXXSCGQTCNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKN- 203
               SCGQTCNA  C+HGC+ ICHLGPHPECTRM+ I C CGKH+K IFCYQSK  K N 
Sbjct: 153 LNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNS 212

Query: 204 -FNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCS 262
            F C++ CGLPLSC IH CK+KCH GLCG CPE +   +     +KCYCG+ T+ ++KC 
Sbjct: 213 KFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCK 272

Query: 263 ETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLP 322
           + K P+S K S D  GN+WIGVFAC + R V Y C KHSFIE CI+PPT++ EK CP+ P
Sbjct: 273 DIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSP 332

Query: 323 SSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQ 382
             LKTCPCG+T L++L KPR  C DPIPTC+S C KPLKCGKH CPF CH  ACM+PCLQ
Sbjct: 333 KLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQ 392

Query: 383 IDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFR 442
           I++ KC+CEQ +F VPC F G P CNIKCESLMSCRRHRC +RCCSGRP+A +RKK LFR
Sbjct: 393 IETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFR 452

Query: 443 TQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVV 502
           +QDL+DE+LVEA+HICLK CNL LSCGIH+CQRKCHPGKCPPCLESDSNDLVCPCG T+V
Sbjct: 453 SQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIV 512

Query: 503 PAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKT 562
            APVRCGTKLP C   CIKVVR E  CGH PMPHTCH LD  CPPCT  VFKPCKCGK  
Sbjct: 513 EAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVK 572

Query: 563 KVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKP 622
           +VRT+CFQ DVSCG  CG+PL  C H C K CH+PG+CQ  CKQ CG++R+NC+H C +P
Sbjct: 573 EVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRP 632

Query: 623 CHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKE 682
           CHG TECPD+PC    K+ C+CGR +  VTCGA S+  S   +++L+C+EECE L+R ++
Sbjct: 633 CHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQ 692

Query: 683 LKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAI 742
           LKEAFGIKE  ++ T  E + LK +V  A  FEELQLPFTEA LS++S+QERWC QIE I
Sbjct: 693 LKEAFGIKEIISSSTDLEFERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEI 752

Query: 743 LNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNK 802
           +NK MDDK+R SLHFKPMRPPQRHFI EL+KAY LY ESQD EP RSVFIKK  N  S+K
Sbjct: 753 INKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSK 810

Query: 803 PVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNL 862
           P  SL++  PLY++FK+L+KERK QEF+ART+ +L+N EV +      +A+ NGFL+++L
Sbjct: 811 PSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDL 870

Query: 863 VAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGH 922
             G T EDL R F  +LK TL+ NPQYL+L DGK+ ++YPE+Y T + N ERD + LVGH
Sbjct: 871 SPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGH 930

Query: 923 FDFMAKEAFLADSISLCSTEEELE-RRLDTPVIQEDSP 959
           FD +AK+ F+++ + LC  ++ L   RL TP I E +P
Sbjct: 931 FDVLAKDTFISEGVELCKIDDVLSTERLATPAIDESTP 968

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1246 bits (3225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/930 (64%), Positives = 719/930 (77%), Gaps = 5/930 (0%)

Query: 30  SSVEDANEQPSSYEEESDDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYR 89
           S   D++E  S +    DD M YYERAIQEI+ GDSYVCMICTVEMDYTCQM+ACK+CYR
Sbjct: 30  SGNSDSSEYESDFAGMDDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYR 89

Query: 90  VFDYGCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXS 149
           VFDY CIREWALKSTEKTVDRIWKCPNCY+V+K+VP KNRPTCWCGKVV          S
Sbjct: 90  VFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNS 149

Query: 150 CGQTCNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVM--KKNFNCQ 207
           CGQTCNA TC+HGCSKICHLGPHPECTR++ I C CGKH+K I CYQS ++  K  F C 
Sbjct: 150 CGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCD 209

Query: 208 EVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFP 267
           E CGLPL+C +H C+KKCH GLCG CPE++ +K+     I+CYCG+  R  IKC +   P
Sbjct: 210 EPCGLPLACGLHRCQKKCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVP 269

Query: 268 KSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKT 327
            S   S++  G +W+GVF C + R VDY C +HSF+E CI+PPTI+G K CPF P  LKT
Sbjct: 270 LSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKT 329

Query: 328 CPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVK 387
           CPCG+T L+EL + RK C DPIPTCDSRCGKPLKCG+H+CPF CH   CM+PCLQID  K
Sbjct: 330 CPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKK 389

Query: 388 CACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLL 447
           C+C Q +F VPC F   P+C  KCESLMSCRRHRCT+RCC+GRP A  RKK LFR+QDL+
Sbjct: 390 CSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLM 449

Query: 448 DESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVR 507
           DESLVE +HICLK CNL LSCG HKCQRKCHPGKCPPCLESDSNDLVCPCG T++ APVR
Sbjct: 450 DESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVR 509

Query: 508 CGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTV 567
           CGTKLP C +PCIKVVRGE  CGH PMPHTCH L+  CPPCT +VFKPCKCGK  KVRT+
Sbjct: 510 CGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTL 569

Query: 568 CFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKT 627
           CFQ DVSCG  CG+PL  C HTCQK CHL G CQK CKQ C +KR+NC H C KPCHGKT
Sbjct: 570 CFQNDVSCGKICGLPLENCNHTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKT 629

Query: 628 ECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAF 687
           +CPD+PC+  +KI C+CGR +  VTCGA S   S    + ++C+EECE L+R ++LKEAF
Sbjct: 630 DCPDIPCSVSIKITCECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAF 689

Query: 688 GIKEETNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLM 747
           GI  ++N  TS E++ LK L  VATTFEELQLP+ E  LS+Y+KQE+WC QIE ILNKLM
Sbjct: 690 GIV-DSNRSTSLEVEKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLM 748

Query: 748 DDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSL 807
           DDK R SLHFKPMRPPQRHFI+E AK++ LY+E+QDREP RSVF+KKE++G+S+KP++SL
Sbjct: 749 DDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISL 808

Query: 808 AEAYPLYESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNT 867
            +A PLY++FK+L+KERK +EF+ARTT +LIN E    E  V  AK +GFL++ +  G T
Sbjct: 809 HDALPLYQTFKELEKERKLKEFEARTTTRLINVEAPQ-EDNVYHAKYSGFLIKKISPGTT 867

Query: 868 AEDLRRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMA 927
            EDL+R F   L  TL+VNPQYLI+ DGK AL+YPENY+  S   ERD+E LVGHFDF++
Sbjct: 868 VEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFIS 927

Query: 928 KEAFLADSISLCSTE-EELERRLDTPVIQE 956
           KE F+AD + LC  E   L  RL+TP+++E
Sbjct: 928 KENFIADGVELCDVEVAMLGERLETPILEE 957

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1165 bits (3014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/970 (58%), Positives = 698/970 (71%), Gaps = 23/970 (2%)

Query: 5   ESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSYEEESDDDMQYYERAIQEISSGD 64
           +SL L  + D  D+    N     I+  E+  E+ ++ + E D D+ YYERA++EI+ GD
Sbjct: 11  KSLVLNFSSDDEDSATEAN-----ITYSEEEEEEIATSDTEEDQDLPYYERAVREIAKGD 65

Query: 65  SYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYVSKRV 124
            Y CMICTVEMDYTC+MFAC++CYRVFDY C+REWA+KST+KTVDRIWKCPNCY V+K+V
Sbjct: 66  LYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKV 125

Query: 125 PVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICHLGPHPECTRMVEIMCH 184
           P KNRPTCWCGKVV          SCGQTC+A  C+HGCSKICHLGPHPEC R   + C 
Sbjct: 126 PTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCR 185

Query: 185 CGKHSKSIFCYQSKVMKKN--FNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKDS 242
           CGK +K I C+++K  +    F C E C   L C IH C+K CH GLCG CPE +  K+ 
Sbjct: 186 CGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKEG 245

Query: 243 PKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSF 302
               I CYCG HTR +IKC +     +G+ SK+ NG+ WIGV+AC D R V+YSCR+HSF
Sbjct: 246 DDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYACKDIRSVEYSCRQHSF 303

Query: 303 IESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKC 362
            E CI+PPT+ G K CPF P  LKTC CG+T L+ L K R+ C DPIP C+SRC K LKC
Sbjct: 304 FEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKC 363

Query: 363 GKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRC 422
           GKH+CPF CHD  CM+PC+QID VKCACE++TF VPCGFQG P C +KCESL+SCRRH+C
Sbjct: 364 GKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKC 423

Query: 423 TDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKC 482
            +RCCSGRP+A  R+KN  R QD+ DE+L+EA+H+CLK CNLTLSCG H+CQRKCHPGKC
Sbjct: 424 AERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKC 483

Query: 483 PPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLD 542
           PPCLESDSNDLVCPCG T+VPAPVRCGTKLP+C HPCIKVV G S CGHKP+PH CH LD
Sbjct: 484 PPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLD 543

Query: 543 VSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNCQK 602
             CPPCT TVFKPCKCGK ++VRT+CFQ DVSCG  CG PL  C+H CQKTCHLPG CQ 
Sbjct: 544 QPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQCQA 603

Query: 603 VCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVSV 662
            CKQ C +  +NC H+C K CHG+  CPD+ C  LVKI C CGR +  VTCGA S   S 
Sbjct: 604 TCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSSS 663

Query: 663 TESSVLDCNEECEALKRLKELKEAFGIKEETNNFTS---NELDALKKLVSVATTFEELQL 719
             +  L+C+EECEA  R ++LKEAFGI ++  N ++    E   L+ L S ATTFEELQ 
Sbjct: 664 LFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEELQF 723

Query: 720 PFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYS 779
           PFTE+ +S Y +Q +WC +IE  LN  MD++ +SSLHFKPM+PPQR FIRELAKAY LYS
Sbjct: 724 PFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYS 783

Query: 780 ESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLIN 839
           E+QD EP RSVF+KK D+G+S KP+ SL+E  PLY+SFK L+KERK Q+F A+TT  LIN
Sbjct: 784 EAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLIN 843

Query: 840 FEVQD--TEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKT 897
            ++ D          + N FL++N+ AG T +DL+  F  +++ TL+ NPQY  L +  +
Sbjct: 844 VKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENS 903

Query: 898 ALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCS---------TEEELERR 948
           A+VYPE+Y T S N   DME LVGH +F+  +AFLADS  LC          +E ++  R
Sbjct: 904 AIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISENDISER 963

Query: 949 LDTPVIQEDS 958
           L+TP +QE +
Sbjct: 964 LETPEVQEQN 973

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1162 bits (3007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/936 (60%), Positives = 690/936 (73%), Gaps = 18/936 (1%)

Query: 31  SVEDANEQPSSYEEESD-----DDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACK 85
           S +D +   SS +EE D     DDM YYERAIQEI++GDSY+CMICTVEMDYTC+M+ACK
Sbjct: 29  SEDDTSSAASSDDEEMDVLSDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACK 88

Query: 86  RCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXX 145
           +C R+FDY CIREWALKSTEKT +RIWKCPNCY+V+K+VP KNR TCWCGKVV       
Sbjct: 89  KCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPL 148

Query: 146 XXXSCGQTCNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVM---KK 202
              SCGQTCNA  C+HGCSKICHLGPHPEC R + + C CGKH + I C+QSK     + 
Sbjct: 149 NPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRN 208

Query: 203 NFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCS 262
            F+C+E CGLPLSC IHTCKKKCH GLCG CPE++   +     IKCYCG  T+ +  C 
Sbjct: 209 RFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCK 268

Query: 263 ETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLP 322
           + K P +   S+D  GN+W+GVF+C   R V+YSC+KHSF+ESC++PPT++G K CPF P
Sbjct: 269 DVKAPTT--LSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSP 326

Query: 323 SSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQ 382
           + LKTCPCGRT L  L+KPR  C DP+PTC++ C KPLKCGKH CPFTCH+  CM+PC+Q
Sbjct: 327 NLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQ 386

Query: 383 IDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFR 442
           ID   C+C QS F  PC F+G P CNIKCESLMSCRRHRCT+RCCSGRP A +RKK LFR
Sbjct: 387 IDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFR 446

Query: 443 TQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVV 502
           + D+ DE+LVEA+H+CLK CNL LSCG H+CQRKCHPGKCPPCLESDSNDLVCPCG TVV
Sbjct: 447 SSDINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVV 506

Query: 503 PAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKT 562
            APVRCGTKL  C  PCIKV+R ES CGH P+PH+CH LD  CPPCT TVFKPCKCGK+ 
Sbjct: 507 EAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRD 566

Query: 563 KVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKP 622
           KVRTVCFQ DVSCG  CG+PL  C+H CQK CH  G CQ  CKQ C +KR+NC HEC K 
Sbjct: 567 KVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKS 626

Query: 623 CHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKE 682
           CHG TEC D PC    KI C CGR +  VTC A S   S    + LDCNEECE +KR +E
Sbjct: 627 CHGSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRE 686

Query: 683 LKEAFGI--KEETNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIE 740
           L+EAFGI  KEE  N  +   + L+     AT +++LQLP+TE AL  Y+KQ  WC QIE
Sbjct: 687 LREAFGIVEKEEPENLGT---ERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIE 743

Query: 741 AILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGAS 800
            +L K MDD +R SLHFKPMRPPQR+FI E+AKA+ LY+ESQDREP RSVF+KK D+G S
Sbjct: 744 ELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTS 803

Query: 801 NKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQ 860
            KP L L++  P+Y++FK+L+KERKA++F+ARTTA+L+N  + DT  + +  + NG +++
Sbjct: 804 LKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIK 863

Query: 861 NLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLV 920
           NL  G T E L  FF    K TL+ NPQYLI+++    L+YPE++   +     D+++LV
Sbjct: 864 NLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIENN--GLIYPESHNEITQGVYNDLDMLV 921

Query: 921 GHFDFMAKEAFLADSISLCSTEEEL-ERRLDTPVIQ 955
           GHF+ + KE  + DS+ +C+ E EL E RL+TP ++
Sbjct: 922 GHFNVIVKEELIGDSVEMCNIENELPEERLETPRLE 957

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/924 (58%), Positives = 686/924 (74%), Gaps = 14/924 (1%)

Query: 35  ANEQPSSYEEESDDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYG 94
           ++E  S +E   + DM YYERA+QEI+ GD YVCMICTVEMDYTC+M+AC+ CYRVFDY 
Sbjct: 23  SSESCSVHEVRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYE 82

Query: 95  CIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTC 154
           CIREWALKSTEKT+DR+WKCPNCY V+KRVP KNRPTCWCGK V          SCGQTC
Sbjct: 83  CIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTC 142

Query: 155 NASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMK--KNFNCQEVCGL 212
           +A  C HGCSK CHLGPHP+C R +   C CGKH++  FCYQ+  MK    F C EVCGL
Sbjct: 143 DAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGL 202

Query: 213 PLSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKS 272
           PL+C IH C++ CH G+CGPCP ++ +K S K +I+CYCG   R + KC + +   +   
Sbjct: 203 PLACGIHKCERLCHSGICGPCPAVLNAK-SNKLKIRCYCGLEHRDSFKCKDVRV--ASDL 259

Query: 273 SKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGR 332
           SKD  G+ WIG F C+  R ++Y+CR+HSF+E C   P+I+G+ ACPF P  LKTCPCGR
Sbjct: 260 SKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGR 319

Query: 333 TALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQ 392
           T+L+ L +PRK C  PIP CDS CGK L CG+H+CPFTCHD  CM+PC+QI++V+C+C +
Sbjct: 320 TSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHK 379

Query: 393 STFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLV 452
           + +SVPC F+ +PRC+ KCESLMSCRRHRCT+RCC GRP A RR+K    +++L+DES V
Sbjct: 380 NLYSVPCQFKEQPRCDTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSV 439

Query: 453 EAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKL 512
           E++HICLK CNLTLSCG HKCQRKCHPGKCPPCLESDSNDLVCPCG TVV APVRCGT+L
Sbjct: 440 ESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRL 499

Query: 513 PTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTD 572
           P C++PCI+V++    CGHKPMPHTCH L+  CP CT  VFKPCKCGKK KVRT+CFQ D
Sbjct: 500 PPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQND 559

Query: 573 VSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDL 632
           VSCG  CG PL  C H CQK+CH+PG CQK CKQ C +KR+ C+H+C   CHG  +CPD+
Sbjct: 560 VSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDI 619

Query: 633 PCATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEE 692
           PC   VKI C+C   +  +TCGA S+  S   +++L C+EECE  KR  +L+EAFGI   
Sbjct: 620 PCPLSVKIKCECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNF 679

Query: 693 TNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTR 752
           ++N + ++  +L+ L +VA +FEEL+LPF+E AL  ++KQE WC+QIE +LN  MD++ +
Sbjct: 680 SDNPSRSKTASLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEK 739

Query: 753 SSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYP 812
           +SLHFKPMRP QRHFI ELAK+Y LY ESQDREP RSVF+KK+DNG S KPV+ L ++ P
Sbjct: 740 TSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLP 799

Query: 813 LYESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLR 872
           +Y+ FK+ +KE+KAQ F+A+TT + +NF +   EP++E AK N F ++N+  G T EDL 
Sbjct: 800 IYQFFKENEKEKKAQRFEAQTTTEFVNF-IPKEEPQLERAKNNAFKLKNVSTGTTKEDLE 858

Query: 873 RFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFL 932
           R F  HLK TLV NPQ+ I D  K  L+YPE+Y   SVN ERD+E LVGHFD++ KE+F+
Sbjct: 859 RIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFI 918

Query: 933 ADSISLCSTEEELERRLDTPVIQE 956
            D I LC         +D  V+QE
Sbjct: 919 GDGIELC--------HIDLKVLQE 934

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1134 bits (2933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/913 (58%), Positives = 658/913 (72%), Gaps = 2/913 (0%)

Query: 34  DANEQPSSYEEESDDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDY 93
           + +E+ S  +E  + DM YYE+A+QEI  GDSY C+ICTVE+DYTC+++AC++CYRV+DY
Sbjct: 43  ELSEELSDLDEGDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDY 102

Query: 94  GCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQT 153
            CIREWA KST K  D++W CPNC+Y  K +P KNRPTCWCG+ V          SCGQT
Sbjct: 103 ECIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQT 162

Query: 154 CNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLP 213
           CNA  C HGCS+ICHLGPH ECTRM+ I C CGK +K I C+Q ++  K FNC+ VC   
Sbjct: 163 CNAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKL 222

Query: 214 LSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSS 273
           L C IH C +KCH GLCG CPE IISK++  K I+CYCG  ++  IKC + +FP +   S
Sbjct: 223 LPCGIHKCNRKCHTGLCGSCPETIISKNTNMK-IRCYCGQTSKDKIKCKDVRFPANAAYS 281

Query: 274 KDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRT 333
           KD+ G RWIGVF C   R V Y C +HSF E C +PP+I+G   C F P  LKTCPCG+ 
Sbjct: 282 KDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKN 341

Query: 334 ALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQS 393
            L +L+KPR  C D IPTC   CGK LKCGKH CPF CH   CM+PC QI+ V+CACEQ 
Sbjct: 342 ELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQK 401

Query: 394 TFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNL-FRTQDLLDESLV 452
            F++PCGF    RCN+KCESLMSCRRHRCT+RCC+GRP A RR+K +    +DL DES +
Sbjct: 402 QFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTI 461

Query: 453 EAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKL 512
           E  HICLK CNLTLSCGIHKC RKCH GKCPPCLESDSNDLVCPCG T+V APVRCGTKL
Sbjct: 462 EPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKL 521

Query: 513 PTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTD 572
           P C +PCI+VVRGE+ CGH PMPH CH  D+ CP CT TVFKPCKCGK+ +VRTVCF  D
Sbjct: 522 PNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKD 581

Query: 573 VSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDL 632
           VSCG  CG  L  CYH CQK CH PG CQ VCKQTC   RL CNH CPKPCH   ECPD+
Sbjct: 582 VSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDI 641

Query: 633 PCATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEE 692
           PC  LVKI C CGRI+K VTCG  S      +S+ + C+EEC  L+R  +LKEAFGI ++
Sbjct: 642 PCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDK 701

Query: 693 TNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTR 752
             N  + E+  L++++S A+TF +L LPFTE  ++ Y + E WC+ IE  LNKL+DD  R
Sbjct: 702 PQNTHNEEMARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNR 761

Query: 753 SSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYP 812
           +SLHFKPMRPPQR+FIRELAKAY LYSESQD EP RSVF+KK  +G+S KP+LS++EA P
Sbjct: 762 TSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAP 821

Query: 813 LYESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLR 872
           LY+S+K+L+KE+K   F++ TT +LINF  + +      A+ NGFLV N+    + +DL+
Sbjct: 822 LYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQ 881

Query: 873 RFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFL 932
             F P+LK TLVV PQ+ IL + K A++YP  Y+  S+N ERDME LV HFDF+ KE+ L
Sbjct: 882 NLFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLL 941

Query: 933 ADSISLCSTEEEL 945
           A  + LC+ E  L
Sbjct: 942 AGGVELCNIENVL 954

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1117 bits (2890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/942 (57%), Positives = 678/942 (71%), Gaps = 14/942 (1%)

Query: 34  DANEQPSSYEEESDDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDY 93
           D +E     + E ++D+ YYERA++EI+ GDSY CMICTVEMD+TC+M+AC+ CYRVFDY
Sbjct: 53  DEDESDVDTDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDY 112

Query: 94  GCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQT 153
            CIREWALKST+KTVD+ WKCPNCY+ SK+VP+K+RPTCWCGKVV          SCGQT
Sbjct: 113 DCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQT 172

Query: 154 CNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLP 213
           CNA+ C H C K CHLG HPECT++++I C CG+ +K I+C++S+  K  F+C + CGL 
Sbjct: 173 CNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLT 232

Query: 214 LSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSS 273
           L C IH C++KCH GLCG CPE++I ++   K IKCYCG H+   + C +  FP SGK S
Sbjct: 233 LPCGIHKCRRKCHSGLCGSCPELLIDENVSGK-IKCYCGLHSLKEMNCKDVAFPSSGKIS 291

Query: 274 KDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRT 333
           +++    W+G+F C + R V Y+C +H F+E CI+PPT+     CPF P+ LKTCPCG+T
Sbjct: 292 RNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKT 351

Query: 334 ALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQS 393
           AL+++   R  C DPIPTCD+ C K LKCGKH CPFTCH   CM+PC+QID + CACE+ 
Sbjct: 352 ALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERR 411

Query: 394 TFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVE 453
           TF VPC F+G+P C  KCESLMSCRRHRC + CCSGRP A RRKK + R+ D  DE+LVE
Sbjct: 412 TFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVE 471

Query: 454 AKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLP 513
           A+H+CLK CNL LSCGIH CQRKCHPG CPPCLESDSNDLVCPCG TV+PAPVRCGT LP
Sbjct: 472 AEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLP 531

Query: 514 TCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDV 573
            C +PCIKV+RGES CGHKPMPH+CHSLD  CP CT  VFKPCKCGKK KVRT+CFQ DV
Sbjct: 532 PCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDV 591

Query: 574 SCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLP 633
           SCG+ CG+PL  CYH CQK CHLPG CQ  C Q C  KR NC+H C + CH    CPD+P
Sbjct: 592 SCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIP 651

Query: 634 CATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEET 693
           C   V + C CGR K    C + S   SVT +S L+C+EEC  L R  ELK AFGI    
Sbjct: 652 CTVPVTVVCDCGRRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGL 711

Query: 694 -NNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTR 752
            ++ TS  ++ ++  +SVA  +EEL+LPF EA L+VY+KQ +WCSQIE ILNK MD+K +
Sbjct: 712 GDDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLK 771

Query: 753 SSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYP 812
           SSLHFK M+ PQR F+  LA AY +YSESQD EP+RSVF+KK  NG S+KP+L+L EA P
Sbjct: 772 SSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALP 831

Query: 813 LYESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLR 872
           LYESFK++QKE+K QE++ART   LIN E + T+ +    K NGFL++NLV G T EDL 
Sbjct: 832 LYESFKEVQKEKKKQEYEARTHKTLINVEAE-TQTQQSATKYNGFLIKNLVKGTTEEDLE 890

Query: 873 RFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFL 932
           R F   LK TLV +PQYL++D+     + P +Y   S+N ERDME L+G FD + KE F+
Sbjct: 891 RIFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFI 950

Query: 933 ADSISLCSTEEEL-----------ERRLDTPVIQEDSPVMDN 963
            D + LC+ +E L           E +L +P ++ DS + D+
Sbjct: 951 GDIVELCNIDEALLQENVDLEDSEEEKLTSPEVENDSDIHDS 992

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1073 bits (2776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/899 (57%), Positives = 645/899 (71%), Gaps = 11/899 (1%)

Query: 50  MQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVD 109
           M YYERA++EI+ GD+YVCMICTVEMDYTC+MFAC +CYRVFDY CIREWALKST +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 110 RIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICHL 169
           + WKCPNC   S +VP K+RPTCWCGKVV          SCGQTC+A  C HGCSK+CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 170 GPHPECTRMVEIMCHCGKHSKSIFCYQSKVMK-KNFNCQEVCGLPLSCSIHTCKKKCHPG 228
           GPHPECTR++ I C CG+H++ + C +    + + F C+E CGL L C +H C KKCH G
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235

Query: 229 LCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACA 288
           LCG C E + SK      IKCYCG H   +I+C + +   + + S D+ GN WIGVF C 
Sbjct: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRV--ADRDSVDDQGNGWIGVFRCK 293

Query: 289 DNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDP 348
           D RVV+Y+C +HSF+ESC   P++  +  CPF P+ L++CPCGRT L +L + R  C D 
Sbjct: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353

Query: 349 IPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCN 408
           IPTC+S+CGK L CGKH+CP+ CH+  CM+PC+Q +   C CE  +F VPC F+  PRCN
Sbjct: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413

Query: 409 IKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSC 468
            KCESLMSCRRHRCT++CCSG+P A RRKK  F +++LLDESLVEA+H+CLK CNLTL+C
Sbjct: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473

Query: 469 GIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGEST 528
           G HKCQRKCHPG+CPPCLESD NDLVCPCG TVV APVRCGTKLP C + CI VVR    
Sbjct: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533

Query: 529 CGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYH 588
           CGH PMPH CH  +  CPPCT  V KPCKCGKK+ VRT+CFQ DVSCG  C  PL  C H
Sbjct: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593

Query: 589 TCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIK 648
           TCQK CH  G CQ  C+Q CG+KR+NC+H+CPKPCHG   CPD PC   V I C CGR +
Sbjct: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652

Query: 649 KSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNEL-DALKKL 707
            +  CG  S  +S + +  L C+EECE +KR  +LK+A G+KE  ++   N + +AL   
Sbjct: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNAL--- 709

Query: 708 VSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHF 767
             VA+ FEEL LPF E  L++YS+Q+R+C  IE++LN  +DD+ +SSLHFKPM+P QRHF
Sbjct: 710 --VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767

Query: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQ 827
           + ELAKAY LYSESQD EP RSV++KKE NG SNKP ++L EA P+Y++FKQ +KE K +
Sbjct: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827

Query: 828 EFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNP 887
            ++ +    L+NF V   EP VE+AK NGFL++NL  G   EDL+R +  HLK TLV NP
Sbjct: 828 RYEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886

Query: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELE 946
            Y  L D   AL++PE+Y   +VNTE DME LVGHFDF+ KE F+ D + LC   E L+
Sbjct: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQ 945

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/909 (55%), Positives = 642/909 (70%), Gaps = 13/909 (1%)

Query: 47  DDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEK 106
           ++D+ +YERAI++I+ GD Y CMICT+E+D T +M+AC  CYRVFDY CIREWA+KS++K
Sbjct: 63  NEDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQK 122

Query: 107 TVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKI 166
           ++D++WKCPNC + S ++P++NRPTCWCGK V          SCGQTCNA +C+H CS  
Sbjct: 123 SLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHF 182

Query: 167 CHLGPHPECTRMVEIMCHCGKHSKSIFCY---QSKVMKKNFNCQEVCGLPLSCSIHTCKK 223
           CHLGPHP+C R   I C CGKH+K +FCY     K   K FNC E C + LSC IH C +
Sbjct: 183 CHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSR 242

Query: 224 KCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIG 283
            CH G CGPCPE+I       K++ CYCG+ T   I+CS  K   SGK SKD+ GN WIG
Sbjct: 243 VCHSGSCGPCPELIT------KKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIG 296

Query: 284 VFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRK 343
           VF C   R V+Y+C+ HSF E+C SPPTI+G K CP+ P  LKTCPCG+T L++    R+
Sbjct: 297 VFKCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQ 356

Query: 344 HCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQG 403
            C DPI TC++RC KPLKCGKH CPFTCH+  CM+PC QI+  KC+C    FSVPC F  
Sbjct: 357 KCTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHE 416

Query: 404 RPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCN 463
           +PRCN+KCESLMSCRRHRCT RCCSG+P A +RKK LF   DLLDESLVEA+HICLK CN
Sbjct: 417 KPRCNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCN 476

Query: 464 LTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVV 523
           L LSCGIH C RKCH GKCPPCLESDS+DLVCPCG TVV APVRCGTKLP C  PCIK +
Sbjct: 477 LKLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYI 536

Query: 524 RGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPL 583
            G   CGHKP  H CH  D+ CPPCTE VFKPCKCGK+ K + +CFQ   SCG  C   L
Sbjct: 537 EGSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKL 596

Query: 584 SYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCK 643
             C+H CQ  CHLPG CQK C Q C ++R+NC+H C + CHG + CPD+PC    ++YC 
Sbjct: 597 DGCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCG 656

Query: 644 CGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDA 703
           CGR K+ + CGA S   SV  + VL C++ C   +RL+EL+ AFG+K  + +  S EL+ 
Sbjct: 657 CGRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPES-ELER 715

Query: 704 LKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPP 763
           LKK+V   T++EEL+LPF+E  LSVYSKQ  WC+QIE ++NK ++DK + SLHFKPM  P
Sbjct: 716 LKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAP 775

Query: 764 QRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKE 823
           QR+FI  L +AY +YSESQDREP RSV++KK  N  +  P +SL EA PLY+S+K+++KE
Sbjct: 776 QRNFIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKE 833

Query: 824 RKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTL 883
           RK Q F+++     +N++  +     +V K NGFL++ +  G T +DL   F  HLK TL
Sbjct: 834 RKVQSFESKKNVTYLNYQPPERSLTPDV-KYNGFLIKGITFGTTTDDLNTLFGVHLKPTL 892

Query: 884 VVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEE 943
           + + QY IL DGK+A+VYP++Y T S N ERD+E L GHFD+M KEA L +S+ +C+  +
Sbjct: 893 IKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITD 952

Query: 944 ELERRLDTP 952
            L+     P
Sbjct: 953 ILQTESAEP 961

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/910 (56%), Positives = 628/910 (69%), Gaps = 15/910 (1%)

Query: 50  MQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVD 109
           + YYE+ I EI  GDSY CMICT+EMDYTC M+AC  CYRV+D+ CIREWALKS++K++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 110 RIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICHL 169
           + WKCPNCYYV+  +PVKNR TCWCGKVV          SCGQTCNA  C HGCSK CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 170 GPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGL 229
           GPHPEC R  ++ C CGKH+K +FCYQS+  K ++ C E C L L C +H C++KCH G 
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 230 CGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACAD 289
           CG C E I  K      I CYCG  TR  I C + K   S   SK+++G  WIGVF+CA 
Sbjct: 228 CGNCEETISGK------IMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAH 278

Query: 290 NRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPI 349
            R V+YSC  HSF ESC +PPT +GE ACPF P  LKTCPCG T L+ L  PRK C DPI
Sbjct: 279 LRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPI 338

Query: 350 PTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNI 409
           PTC++RC KPLKCGKHSCPF CHD  CM+PC+ +D V C+C   +F VPC F     CN 
Sbjct: 339 PTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNT 398

Query: 410 KCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCG 469
           KCESLMSCRRHRCT+RCCSGR  AI+R+K +F  +D LDESLVEA+HICLKPCNL LSCG
Sbjct: 399 KCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCG 458

Query: 470 IHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTC 529
           IH C+RKCHPGKC PCLESDSNDL CPCG TVVPAPVRCGTKLP C HPCIK ++ ++ C
Sbjct: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518

Query: 530 GHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHT 589
           GH PMPH CHSL+  CP CT  ++K CKC K  KVRT+CFQ DVSCG  CG+PL  C HT
Sbjct: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578

Query: 590 CQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKK 649
           C++TCH PG CQ +CKQ CG  R  C H+C   CH   +CPD  C   VK+ C CGR + 
Sbjct: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638

Query: 650 SVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVS 709
            + C A +D+ S      L C+++CE  KR + L EAFGIKE+     +  ++ L+ LV 
Sbjct: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEK----LTAPVEELRDLVE 694

Query: 710 VATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIR 769
            A +F+EL LPFTE+ LSVYSKQ  WC+QIE+ L+KLM D TR+SLHFKPM+ PQR FI 
Sbjct: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754

Query: 770 ELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEF 829
           ELA AY LYSESQDREP RSVF+KK +N  S+ P+L L EA PLY SFKQLQKERK +E 
Sbjct: 755 ELANAYALYSESQDREPKRSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKEL 813

Query: 830 QARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQY 889
           +  TT +L N+ V D       A+ N FLV+ +  G T ++L      +L+ TL+ NP Y
Sbjct: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873

Query: 890 LILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRL 949
             L++G   L+YPE++ + S N E D++ L  +   + KE  +++ + L   +E L+   
Sbjct: 874 QTLENGD-FLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT 932

Query: 950 DTPVIQEDSP 959
               +QE+ P
Sbjct: 933 SEEYLQEEQP 942

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1020 bits (2637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/897 (55%), Positives = 613/897 (68%), Gaps = 15/897 (1%)

Query: 49  DMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTV 108
           D  YYE+ I+EI+ GD Y CMICTVEMD+TC M+AC  CYRVFDY CIREWA+KST+K+V
Sbjct: 60  DQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSV 119

Query: 109 DRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICH 168
            + WKCPNCY+  K VP+KNRPTCWCGK +          SCGQTC+A  C+HGCS  CH
Sbjct: 120 TKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCH 179

Query: 169 LGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPG 228
           LGPHP C RMV+  C CGK SK +FC +++  ++ F C   CGL L C +H C+++CH G
Sbjct: 180 LGPHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRECHNG 239

Query: 229 LCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACA 288
           +CG CPE I       K+I CYCG  +  +IKC + K       S+D +G +WIG FAC+
Sbjct: 240 VCGECPETIA------KEINCYCGLESLPSIKCQDVKI---QSKSQDGSGKKWIGAFACS 290

Query: 289 DNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDP 348
             R V+YSCR+HSF E C +PP+I G   CP+ P +LKTCPCG T LE +  PR  C DP
Sbjct: 291 RIRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDP 350

Query: 349 IPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCN 408
           IPTCD+ CGK L CG+H CPF CH   CME C   D +KC+C    F VPC FQG PRCN
Sbjct: 351 IPTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCN 410

Query: 409 IKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSC 468
            KCESLMSCRRHRC +RCC GR  A  R+K +F T+D LDESLVEA+HICLK CNL LSC
Sbjct: 411 TKCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSC 470

Query: 469 GIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGEST 528
           G H CQRKCHPG CPPCLESDSNDLVCPCG TV PAPVRCGT LP C +PCIK ++G   
Sbjct: 471 GRHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLD 530

Query: 529 CGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYH 588
           CGH PMPH CHSLD  CP CT  VFK CKCGK  KVRT+CFQ +VSCG  CG  L  C+H
Sbjct: 531 CGHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHH 590

Query: 589 TCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIK 648
           +C KTCH  G CQ +CKQ CG  R NC+H C   CH  + CPD+PC   V++ C CG   
Sbjct: 591 SCTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRS 650

Query: 649 KSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLV 708
              TC A   +    +   L+C E+C A +R  EL EAFG+  ET   T   +D L  L 
Sbjct: 651 SFATCAAHEGQ-DPADQRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVD-LAALA 708

Query: 709 SVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFI 768
              TTF+EL LPFTEA+LS+++KQ  WCSQIE  LN+LM D ++ SLHFKPM+PPQRHFI
Sbjct: 709 EKVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFI 768

Query: 769 RELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQE 828
            ELA+AY LY ESQD+EP RSV++KK  +  S KP LSL EA PLY+SFK  QKERK +E
Sbjct: 769 HELAQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERKLKE 826

Query: 829 FQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQ 888
            +  TT +++N+     E    VA+ NG L+Q +  G   + +   F  +LKHTL+ +P 
Sbjct: 827 LERSTTTRILNY-TSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPN 885

Query: 889 YLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEEL 945
           YL LD G   +V+ ENY TAS+N ERD+  +VGH D +AK++FLA+ +++C  E+ +
Sbjct: 886 YLKLDSGD-VMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVM 941

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/925 (54%), Positives = 632/925 (68%), Gaps = 20/925 (2%)

Query: 17  DTYRHHNLSDGCISSVEDANEQPSSYEEESDD-----DMQYYERAIQEISSGDSYVCMIC 71
           D+   ++LS+G +  V+ ++E+   +E   D+     D  YYE+ ++EI  GD Y CMIC
Sbjct: 6   DSTPDNDLSNGYVL-VDASSEESEDFEHVEDEIDELEDQPYYEKTVKEIEKGDRYPCMIC 64

Query: 72  TVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPT 131
           TVEMD+TC M+AC  CYRVFD+ CIREWALKST+K+V + WKCPNCY+  K VP+KNRPT
Sbjct: 65  TVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMKNRPT 124

Query: 132 CWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKS 191
           CWCGK V          SCGQTC+A  C HGCS ICHLGPHP C RMV++ C+CGK +KS
Sbjct: 125 CWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGKKNKS 184

Query: 192 IFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYC 251
           +FC+++     +F C   CGL L C IH C++KCH G+CG CPE I         I CYC
Sbjct: 185 VFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYGT------INCYC 238

Query: 252 GNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPT 311
              ++ ++KC+E +    G+S +D +GN+W+G F+C + R V++SC+KHSF E C +PP+
Sbjct: 239 KLESKPSLKCTEVRI--EGRS-RDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPS 295

Query: 312 INGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTC 371
           I+G+  CPF P +LKTCPCGR+ L E+   R  C DPIPTCDS CGK L+CGKH CPF C
Sbjct: 296 ISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKC 355

Query: 372 HDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRP 431
           H  +CME CL  D VKC+C    F VPC FQ + RCN KCE+LMSCRRHRC +RCC GR 
Sbjct: 356 HTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRS 415

Query: 432 SAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSN 491
            A  R+K +F T+D LDESLVEA+HICLK CNL LSCG H C+RKCHPG C PCLESDSN
Sbjct: 416 LAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSN 475

Query: 492 DLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTET 551
           DLVCPCG TVVPAPVRCGT LP C HPCIK ++G + CGH PMPH CH L+  CP CT  
Sbjct: 476 DLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCHPLEEPCPSCTAP 535

Query: 552 VFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQK 611
           VFK CKC K  KVRT+CFQ DVSCG  CG  L+ C H CQK CH  G CQ  CKQ CG+ 
Sbjct: 536 VFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKT 595

Query: 612 RLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCN 671
           R NC H C   CH  T CPD PC  LV I C CG    +VTCGA  +R    E++ L+CN
Sbjct: 596 RENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAPAEETA-LECN 654

Query: 672 EECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSK 731
            +C+  +R  EL EAFGIK + N   S  L+ L+ L    +TF+EL LPF+EA LS++SK
Sbjct: 655 NDCDVARRHHELMEAFGIKNDANQ-GSKSLEDLEALAEKVSTFQELLLPFSEATLSIFSK 713

Query: 732 QERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVF 791
           Q  WC+QIE  L +LM+DK + SLHFKPMRPPQRHFI EL +AY LY ESQD+EP RSVF
Sbjct: 714 QTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVF 773

Query: 792 IKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEV 851
           +KK     S +P +SL  A PLY SFK  Q+E+K +E +  TT ++IN+ V D       
Sbjct: 774 VKK--TADSQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPA 831

Query: 852 AKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVN 911
           A+ NG LVQN++ G   + ++  F  +LKHTL+ +P YL+L  G   LVY ++Y TASVN
Sbjct: 832 ARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGD-VLVYCDDYSTASVN 890

Query: 912 TERDMELLVGHFDFMAKEAFLADSI 936
            E D+E +VGH D + KE  LA+ +
Sbjct: 891 VENDIERIVGHLDHIVKEQLLAEGV 915

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  978 bits (2529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/928 (51%), Positives = 626/928 (67%), Gaps = 23/928 (2%)

Query: 35  ANEQPSSYEEESDDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYG 94
           +NE      E+ DD + YYE+ I++IS GD Y CMICT+EMDYTC+M+AC+ CYRVFDY 
Sbjct: 30  SNESNFDSSEDEDDGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYE 89

Query: 95  CIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTC 154
           CI+EWA KS  KT+D++WKCPNC + SK++P++NRPTCWCGKV+          SCGQTC
Sbjct: 90  CIQEWAEKSASKTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTC 149

Query: 155 NASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKN--FNCQEVCGL 212
           N  TC+HGC   CHLGPH EC+ +  + C CG++ K IFC+Q K   KN  + C EVC L
Sbjct: 150 NKKTCVHGCKNFCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQL 209

Query: 213 PLSCSIHTCKKKCHPGLCGPCPEMIISKD------SPKKQIKCYCGNHTRANIKCSETKF 266
           PL+C +H CK+ CH GLCG CPE++ S+       +  ++ KCYCG +++  I C   K 
Sbjct: 210 PLACGVHKCKRVCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCK--KL 267

Query: 267 PKSGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLK 326
             +G  SK+  G++WIG FAC   R+V Y+C +HSFIE C +  +I+G+K CP+ P  L 
Sbjct: 268 AITGTFSKNSEGDKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLN 327

Query: 327 TCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSV 386
           +CPCG+T+L++L + RK C DPIPTC++RCGK LKCGKH+CP+ CH+ +CM+PC+Q++  
Sbjct: 328 SCPCGKTSLKQLAQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVT 387

Query: 387 KCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDL 446
            C+C Q  F VPC F+  P+C  KCESLMSCRRHRC  +CC+G+P A +RKK L   ++L
Sbjct: 388 NCSCLQKHFLVPCNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREEL 447

Query: 447 LDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPV 506
            DESLVEA HICLK CNL LSCGIH C RKCHPG+CP CL SDSNDLVCPCG TV+ APV
Sbjct: 448 NDESLVEAVHICLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPV 507

Query: 507 RCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRT 566
           RCG+KLP C   CIKV+     CGHKP PH CH     CPPCT  V +PCKCGK   V+ 
Sbjct: 508 RCGSKLPPCPFECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKA 567

Query: 567 VCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGK 626
           VCFQ   SCG  C   L  C+H CQ  CH  G CQK CKQ C + R NCNH+C   CHG 
Sbjct: 568 VCFQEFGSCGEICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGS 627

Query: 627 TECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEA 686
           + CPD+PC  + K+ CKCGR ++   C A  D  S +   +L C+E+CEA  R  +L++A
Sbjct: 628 SPCPDVPCNEVTKVSCKCGRKQEYRKCYATLDNSSAS-IELLPCDEDCEAHARHLQLRDA 686

Query: 687 FGIKEETNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKL 746
           FG     +    N  D ++ L+   +T+EEL+LP+ ++ +S YSKQ +WCSQIE IL K 
Sbjct: 687 FGYDSSLDTSNKNIQD-IQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKF 745

Query: 747 MDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLS 806
           + DK +++LHFKPM+P QRHF+REL+ ++ LYSESQD EP RSVF+K++ +  +  P +S
Sbjct: 746 VLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNIS 803

Query: 807 LAEAYPLYESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKK----NGFLVQNL 862
           L E  PL+  FK+L+KERK Q F++ +  K IN+     EPK  + K     NGF ++ +
Sbjct: 804 LEEVLPLWTGFKKLEKERKIQHFESTSQRKYINY-----EPKEVIVKSSNDTNGFFIKKI 858

Query: 863 VAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGH 922
             G T EDL   F   LK TL+ N  Y IL +   A++YPE Y + + +  +D+E+LVGH
Sbjct: 859 SPGITEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGH 918

Query: 923 FDFMAKEAFLADSISLCSTEEELERRLD 950
           FDF+ KEA + DSI LC+ E  + +  D
Sbjct: 919 FDFIGKEALIFDSIMLCNVEGYINQISD 946

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/899 (50%), Positives = 589/899 (65%), Gaps = 16/899 (1%)

Query: 49  DMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTV 108
           ++ YYE+ ++EI  GD YVCMICTVE+D TC+M+AC  CYRVFDY C+REWALKST KT+
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 109 DRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKICH 168
           D+ WKCPNCY ++ ++P + R TCWCGKVV          SCGQTCNA +C+HGCSK+CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 169 LGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPG 228
           LGPHPEC   V+I C CGKH K I C +SKV+  ++NC +VCGL L C  HTC+K CH G
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210

Query: 229 LCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACA 288
            CGPC  +I      K ++ CYCG+  ++ I+CS+ +       SKD +G +WIGV++C 
Sbjct: 211 FCGPCESII------KTELPCYCGSDVKSGIQCSDLRV---LDYSKDVSGKKWIGVYSCG 261

Query: 289 DNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDP 348
           + R + YSC  H+++E C++P  I+  + CPF P +LKTCPCG+T L+EL KPR+ C D 
Sbjct: 262 EVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDT 321

Query: 349 IPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCN 408
           IPTC + CGK L CGKH+CPF+CH   CM+PCL I    C C   TF  PC     PRCN
Sbjct: 322 IPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCN 381

Query: 409 IKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSC 468
           IKCES MSCRRH+C + CCSG+P+A +R+K LF  +DL +E+LVE +H+CLK CNL LSC
Sbjct: 382 IKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSC 441

Query: 469 GIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGEST 528
           GIH C  KCHPGKCPPCLESD NDLVCPCG TVVPAPVRCGTKLP C +PCIK+  G + 
Sbjct: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501

Query: 529 CGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTD--VSCGIKCGIPLSYC 586
           CGH+  PH CH     CPPCT  V K C+C KK  +RT+C   D  V+CG +CG+PL+ C
Sbjct: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561

Query: 587 YHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGR 646
           +H CQK CH+ G C+  C + CG KR  C H C + CHG + CP+  C   V I C C R
Sbjct: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621

Query: 647 IKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKK 706
             K V CGA  D  S +E+  L C+EEC  L+R  EL EAFG+ E+  N      + L+ 
Sbjct: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTK----EQLES 677

Query: 707 LVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRH 766
           +V VA  F++L +P++E  L+VY KQ  WC QI A+ +K ++D  + SLH KPMR PQR 
Sbjct: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737

Query: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKA 826
           FI+ELA AY LYSESQDREP RSV++KK     S KP L+L +A  LY+ FK L+KER  
Sbjct: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796

Query: 827 QEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVN 886
           + +  + T  LIN    +T         N  ++  +   +  +++       LK+TLV  
Sbjct: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856

Query: 887 PQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEEL 945
           PQY  L D  + L++PENY   + NT  DME ++       ++  LA  + +C  +E L
Sbjct: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/935 (47%), Positives = 584/935 (62%), Gaps = 24/935 (2%)

Query: 30  SSVEDANEQPSSYEEESDDD-MQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCY 88
           S VE+ +   S Y  E+DDD + YYE+AI++I +G  Y C+ICTVE+D TC+M+AC  CY
Sbjct: 9   SEVEEVSY--SDYLSEADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCY 66

Query: 89  RVFDYGCIREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXX 148
           RV+DY CI EWA KS++++ D  WKCPNCY+   +V  K R TCWCGK +          
Sbjct: 67  RVYDYECIMEWAKKSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPN 126

Query: 149 SCGQTCNASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQE 208
           SCGQTC AS C HGC+  CHLGPHP+C   V + C CGK ++ I CYQ+K +K   +C+ 
Sbjct: 127 SCGQTCGASICKHGCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKL 186

Query: 209 VCGLPLSCSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPK 268
            CGLPL C +HTC+K CH G CG C  ++  K       KCYCG++   +I C +    K
Sbjct: 187 PCGLPLPCGVHTCQKICHSGPCGRCNTVMSGK------FKCYCGSNHLDSIICKDVAVTK 240

Query: 269 SGKSSKDENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTC 328
             +S K +   +WIGVF+C + R V Y C++HSF ESC   P+ +    CP+ P+  KTC
Sbjct: 241 MSRSGKHK---KWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTC 297

Query: 329 PCGRTALEELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKC 388
            CG T L ++ + R+ C DPIPTCD RCGKPL CGKH+CP TCH   CM+PCLQI+  KC
Sbjct: 298 CCGNTTLIDMQQKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKC 357

Query: 389 ACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLD 448
           +C++ TF  PC F G+P CNIKCE+LMSCRRHRC  RCCSG+P A+ R   +    D  D
Sbjct: 358 SCQERTFLTPCQFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKND 417

Query: 449 ESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRC 508
           ESL+EA+HIC K CN  LSCG+H C  KCHPGKCPPCLESDSNDLVCPCG +V+ APVRC
Sbjct: 418 ESLIEAEHICFKNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRC 477

Query: 509 GTKLPTCNHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVC 568
           GT  P CN+PCI  +RG   CGH+   H CH     CPPCT  V+KPCKCGK T  RT+C
Sbjct: 478 GTVRPNCNYPCINTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTIC 537

Query: 569 FQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTE 628
           FQ D+SCG KC   L+ C+H CQK CH PG C   C + CG KR  C H C   CHG   
Sbjct: 538 FQNDISCGRKCAAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEI 597

Query: 629 CPDLPCATLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFG 688
           CPD+PC   V + C CGR    V CGA  D+ S T +  L C+++C  +++ + L +   
Sbjct: 598 CPDVPCLEEVVVSCGCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLR 657

Query: 689 IKEETNNFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMD 748
             E TN         + K     T++E+L LP++E  + V+SKQ  WC  I+  L +L++
Sbjct: 658 SSESTNKAEHGSSSVINK----PTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLE 713

Query: 749 DKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLA 808
           DK+R SLHFKPM+ PQR F+ EL+KA+GLYSESQDREP RSVF+K      S  P + L+
Sbjct: 714 DKSRKSLHFKPMKAPQRQFVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLS 771

Query: 809 EAYPLYESFKQLQKERKAQEFQARTTAKLINFEVQD-TEPKVEVAKKNGFLVQNLVAGNT 867
           EA  LY+  K  QKER+  E Q  TT  LI+  + D ++ K   A  N  L+  +    T
Sbjct: 772 EALLLYQRMKTFQKERRDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVT 831

Query: 868 AEDLRRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMA 927
            E+++  F+  LK TL+ +PQ+ +++    A +YP N+   S N E D++ LV +F  + 
Sbjct: 832 VENIKACFDECLKQTLLKDPQFRLINSN--AYIYPSNFLEISANVETDIQRLVPYFSHVC 889

Query: 928 KEAFLADSIS---LCSTEEELERRLDTPVIQEDSP 959
           +   +  ++S   L +   +  + L+   I  + P
Sbjct: 890 ERKQIGYNVSAHKLTADFNKTSQALNNSFISTEDP 924

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/903 (49%), Positives = 562/903 (62%), Gaps = 25/903 (2%)

Query: 48  DDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKT 107
           + + YYE+ + E+  G++Y C+ICTVEMD +C M+AC +CYRV+DY CIR WALK+T  T
Sbjct: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73

Query: 108 VDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVXXXXXXXXXXSCGQTCNASTCMHGCSKIC 167
           VDR WKCPNCY+V+++VP KNR TCWCGK V          SCGQTC A  C HGCSK+C
Sbjct: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133

Query: 168 HLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHP 227
           HLGPH EC   ++  C CGK ++ I CY++K  K+NF+C + CGLP+ C IH C++ CH 
Sbjct: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193

Query: 228 GLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFAC 287
           G CGPC E I         IKCYCG  TR  + CSE       K SK ++   WIG FAC
Sbjct: 194 GPCGPCKEEIAG------DIKCYCGLTTRNKMVCSEVSVVARSKVSKYKS---WIGAFAC 244

Query: 288 ADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDD 347
              R V YSC KHSF E CI+PP++     CP+ P +  TCPCG+T L EL   R  C D
Sbjct: 245 DRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTD 304

Query: 348 PIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRC 407
            I +C   CGK L CG H+CP TCHD  CM+PCL I   KCACEQ  F VPC F   P C
Sbjct: 305 HISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSC 364

Query: 408 NIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLS 467
             KCESLMSCRRHRC +RCCSGRP +++R     R +   DES VEA+H+CLK CN  L 
Sbjct: 365 TAKCESLMSCRRHRCAERCCSGRPHSVKRNSRR-RRESPDDESEVEAQHVCLKDCNRVLL 423

Query: 468 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGES 527
           CGIH C  KCH GKCPPCLESDSNDL+CPCG T+VPAPVRCGTKLP C HPC   +    
Sbjct: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483

Query: 528 TCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCY 587
            CGH P  H CH LD  CPPCT TV K C+CG K ++RT C+  DVSC   C  PLSYC 
Sbjct: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCN 542

Query: 588 HTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRI 647
           H CQ  CH  G CQ+ CKQ CG  R  C H C   CHG T CP+ PC     I C CG  
Sbjct: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602

Query: 648 KKSVTC---GAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDAL 704
             +  C     K D +  ++   L C+E+C   +R ++L  AFG+ E+    TS E +AL
Sbjct: 603 SSTKICSEYAGKDDGIGASQH--LSCDEDCAKFQRHQQLMRAFGVVEKA---TSEEDEAL 657

Query: 705 KKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQ 764
             L   + +F++L LPFTE  LSV++KQ +WC+QIE  L KLMDD +  +LHFKPMR  Q
Sbjct: 658 -LLAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQ 716

Query: 765 RHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKER 824
           R F+ EL+ ++GLYSESQD EP RSV++KK   G S  P + L++A PLY SFK+L++E 
Sbjct: 717 RRFVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREF 774

Query: 825 KAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLV 884
           KA   ++  T KL++  + D+      A  N  L+  L +  +   LR  F  +   TL+
Sbjct: 775 KANS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLL 833

Query: 885 VNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEE 944
             PQY++   G    ++P +Y + S N E+D+  L G+F  + +E  L   IS C  +  
Sbjct: 834 NCPQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSN 891

Query: 945 LER 947
           L R
Sbjct: 892 LNR 894

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] {ON}
            Anc_8.288 YDR128W
          Length = 1178

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 585  YCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDL 632
            YC H   ++  + GNCQ +    C Q     + ECP  C     CPD+
Sbjct: 1129 YCNHPADRSVFICGNCQHIMHPKCAQVWWKVDSECPSGC--GCHCPDV 1174

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 584  SYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPC 623
            +YC+   Q +  + GNCQ V    C ++  N + ECP  C
Sbjct: 1070 TYCHLKAQYSIFVCGNCQHVLHLKCSKEWWNVSKECPTGC 1109

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} similar
            to uniprot|Q03897 Saccharomyces cerevisiae YDR128W
            Hypothetical ORF
          Length = 1133

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 19/40 (47%)

Query: 584  SYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPC 623
            SYC     +   + GNCQ V  +TC +K      ECP  C
Sbjct: 1079 SYCGLKAGRLVFVCGNCQHVTHRTCAEKWWKIGDECPSGC 1118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.134    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,871,838
Number of extensions: 4568276
Number of successful extensions: 14309
Number of sequences better than 10.0: 72
Number of HSP's gapped: 13486
Number of HSP's successfully gapped: 79
Length of query: 965
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 846
Effective length of database: 39,836,145
Effective search space: 33701378670
Effective search space used: 33701378670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)