Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YNL022C2.286ON49049023280.0
Skud_14.3072.286ON49048921190.0
Suva_14.3252.286ON49048921040.0
Smik_14.3092.286ON49048920890.0
NDAI0G006602.286ON49650017520.0
KAFR0H033102.286ON48849217000.0
Kpol_1003.382.286ON49649716970.0
NCAS0G037902.286ON49249616650.0
TPHA0C034002.286ON49449416560.0
TDEL0G021702.286ON48449216510.0
TBLA0B069602.286ON50851016130.0
KNAG0H020002.286ON49849616100.0
CAGL0M06941g2.286ON49249716080.0
SAKL0E07678g2.286ON47749015940.0
KLLA0E08361g2.286ON49149715380.0
Ecym_33252.286ON49649115200.0
Kwal_27.115322.286ON47949615170.0
ZYRO0A01892g2.286ON46549115130.0
KLTH0G10362g2.286ON52949014820.0
ADL215W2.286ON48449314440.0
AFR179C8.171ON7002941643e-11
Kpol_1003.152.247ON6332751562e-10
CAGL0J10032g2.247ON6192051562e-10
TPHA0C031502.247ON6082401553e-10
KAFR0J009702.247ON6102071535e-10
Ecym_23538.171ON6902941527e-10
ZYRO0G08998g8.171ON6833001528e-10
ZYRO0A01562g2.247ON6172031511e-09
Kwal_23.48412.247ON6272811511e-09
KNAG0I018702.247ON6292051501e-09
YNL061W (NOP2)2.247ON6182381501e-09
TBLA0E038502.247ON6322051501e-09
SAKL0E08624g2.247ON6112031492e-09
Smik_14.2662.247ON6182381482e-09
KLLA0F03399g2.247ON6192371482e-09
NCAS0G030302.247ON4902051463e-09
NDAI0D010502.247ON6252051473e-09
KNAG0D020508.171ON6822971455e-09
ADL254W2.247ON6031991455e-09
Skud_14.2712.247ON6192051447e-09
Suva_14.2802.247ON6202051438e-09
TDEL0B043908.171ON6733011439e-09
TPHA0H001508.171ON6493071439e-09
TDEL0C041502.247ON6142401431e-08
KLTH0G09460g2.247ON6372401421e-08
Ecym_32842.247ON6062381393e-08
SAKL0H19448g8.171ON6912951359e-08
NCAS0B043908.171ON6712971359e-08
KNAG0G015108.171ON6662971341e-07
Kpol_1002.1098.171ON6702971331e-07
NDAI0B018308.171ON6862971332e-07
TBLA0A087408.171ON6863011322e-07
TPHA0C028708.171ON6742971304e-07
KAFR0B022208.171ON6862971295e-07
KLTH0H08096g8.171ON6882941279e-07
NCAS0B056408.171ON6593051261e-06
Suva_2.978.171ON6702971261e-06
NDAI0B029808.171ON6792981251e-06
Smik_2.928.171ON6743001214e-06
Skud_2.818.171ON6812971196e-06
YBL024W (NCL1)8.171ON6842971162e-05
KLLA0F12562g8.171ON7043151143e-05
CAGL0K01991g8.171ON6722921125e-05
Kwal_14.20818.171ON272122800.25
Ecym_30036.1ON31980790.37
SAKL0E00660g6.1ON32274731.8
ZYRO0F13486g1.251ON161058742.1
YAR007C (RFA1)4.120ON621117732.4
Kpol_449.126.1ON31977704.1
KNAG0L024406.1ON31781704.4
TDEL0D012701.251ON155159714.5
ZYRO0F00308g6.1ON31980695.1
NCAS0B078001.251ON168927715.3
CAGL0L07678g6.1ON31774695.7
Smik_6.4746.1ON31874696.0
Skud_16.116.1ON31880686.7
TBLA0H018805.370ON170849706.9
YPL266W (DIM1)6.1ON31874687.8
TBLA0H029901.251ON174826698.8
TPHA0K015604.120ON61646689.1
Suva_16.396.1ON31874679.3
KAFR0B064506.1ON31883679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL022C
         (490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   901   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   820   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   815   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   809   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   679   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   659   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   658   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   645   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   642   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   640   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   625   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   624   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   624   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   618   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   597   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   590   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   588   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   587   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   575   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   560   0.0  
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    68   3e-11
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    65   2e-10
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    65   2e-10
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    64   3e-10
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    64   5e-10
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    63   7e-10
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    63   8e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    63   1e-09
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    63   1e-09
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    62   1e-09
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    62   1e-09
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    62   1e-09
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    62   2e-09
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    62   2e-09
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    62   2e-09
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    61   3e-09
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    61   3e-09
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    60   5e-09
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    60   5e-09
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    60   7e-09
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    60   8e-09
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    60   9e-09
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    60   9e-09
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    60   1e-08
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    59   1e-08
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    58   3e-08
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    57   9e-08
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    57   9e-08
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    56   1e-07
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    56   1e-07
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    56   2e-07
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    55   2e-07
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    55   4e-07
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    54   5e-07
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    54   9e-07
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    53   1e-06
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    53   1e-06
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    53   1e-06
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    51   4e-06
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    50   6e-06
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    49   2e-05
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    49   3e-05
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    48   5e-05
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    35   0.25 
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    35   0.37 
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    33   1.8  
ZYRO0F13486g Chr6 complement(1108746..1113578) [4833 bp, 1610 aa...    33   2.1  
YAR007C Chr1 complement(156754..158619) [1866 bp, 621 aa] {ON}  ...    33   2.4  
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    32   4.1  
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    32   4.4  
TDEL0D01270 Chr4 complement(242013..246668) [4656 bp, 1551 aa] {...    32   4.5  
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    31   5.1  
NCAS0B07800 Chr2 complement(1477435..1482504) [5070 bp, 1689 aa]...    32   5.3  
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    31   5.7  
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    31   6.0  
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    31   6.7  
TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5....    32   6.9  
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    31   7.8  
TBLA0H02990 Chr8 complement(732711..737957) [5247 bp, 1748 aa] {...    31   8.8  
TPHA0K01560 Chr11 complement(326850..328700) [1851 bp, 616 aa] {...    31   9.1  
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    30   9.3  
KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {...    30   9.4  

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/490 (90%), Positives = 443/490 (90%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKAHILEDIPKKKGKPLFSR            SKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      DISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
           TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
           GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVP 360
           NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFN             VP
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVP 360

Query: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480
           DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI
Sbjct: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480

Query: 481 GFFAVCFERD 490
           GFFAVCFERD
Sbjct: 481 GFFAVCFERD 490

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/489 (81%), Positives = 421/489 (86%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVL+SCK+YKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKA ILEDIPKKKGKPLFSR            SKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      DI+NDLPPVRWIRINPLKCHPNG+TEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
           TLKV+KWS+LVPGSIYYDE+IPNLFGIHP+DKITAHELYKHGKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
           G  DIVID+CSAPGNKTTHTASYI   PPKDN  RIYAFEKDPERAK+LQKM+K+AGCS 
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVP 360
           NI V VGDFTKLATP+K K  T FIVDPSCSGSGIFGRKFFDS N             +P
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360

Query: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEF+AKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480
           DK+V+EWGWKVAP+ EVIPSWPRRGKVEEF EVFRDG  ++P+QLAEGCIRALPK DGGI
Sbjct: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480

Query: 481 GFFAVCFER 489
           GFFAVCFER
Sbjct: 481 GFFAVCFER 489

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/489 (81%), Positives = 418/489 (85%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAK RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKA ILE+IPKKKGKPLF+R            SKQKRIQMGKHPIK+YVLKFKSP
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      DI NDLPPVRWIRINPLKCHP+G TEPVLAEL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
           T KVD WSELVPGSIY+DE+IPNLFGIHP+DKITAHELYKHGKIIIQDRASCFPAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
           G +DIVID+CSAPGNKTTHTASYI+ EPPKD   +IYAFEKDPERAK+LQKMIK+AGCS 
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVP 360
           NI VNVGDFTKLATPEK K VT FIVDPSCSGSGIFGRKFFDS N             VP
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAVP 360

Query: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEF+AKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480
           DK+V+EWGWKVA + EV+PSWPRRGKVEEFEEVFRDG  +DPQQLAEGCIRALPK DGGI
Sbjct: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480

Query: 481 GFFAVCFER 489
           GFFAVCF R
Sbjct: 481 GFFAVCFVR 489

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/489 (82%), Positives = 426/489 (87%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKA ILEDIPKKKGKPLFSR            SKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      DI+NDLPPVRWIRINPLKC+PNG+TEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
           TLKV+KWSELVP SIYYDE+IPNLFGIHPSDKITAHELYK+GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
           GP+DIVID+CSAPGNKTTHTASYI  EPPKD+ TRIYAFEKDPERAK+LQKMIKIAGCS 
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVP 360
           NI V+VGDFTKLATPEK+KD T FIVDPSCSGSGIFGRKFFDS N             VP
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIVP 360

Query: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEF+AKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480
           DK+V+EWGW+VAP+ EVIP WPRRGKVEEFEEVFR+G  +DPQ+LAEGCIRALPK DGGI
Sbjct: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480

Query: 481 GFFAVCFER 489
           GFFAVCFER
Sbjct: 481 GFFAVCFER 489

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/500 (66%), Positives = 387/500 (77%), Gaps = 15/500 (3%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E++ AK RISGS+QTLVL+SC +YKLK NPKH+YAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK+ IL+DIPKKKGKP++SR            SK KRIQMGKHPIK+YVLK KS 
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      D + D+ PVRWIRINPL+C+   +   VL EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +V+ W+++VPGSIYYDE+IP+L+GIHP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPK-DNNTRIYAFEKDPERAKVLQKMIKIAGCS 299
              DI+ID+C+APGNKTTH ASY++ +  + D + +IYAFEKDPERAK+L+KMIK+AGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 300 PNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXX-------XX 352
            NI V VGDFTK ATP+K+KDVT FIVDPSCSGSGIFGRK+ DS N              
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 353 XXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENE 412
                 VPDEQE++  KE+L+TRLAKLSSFQFQ++KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 361 TEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420

Query: 413 RVVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDP---QQLAEGC 469
           RVV+DLLLD  V++WGWKVA K  VIP+WPRRGK+EEFEEVFRD    DP   Q LA+GC
Sbjct: 421 RVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRD----DPAKCQALADGC 476

Query: 470 IRALPKSDGGIGFFAVCFER 489
           IRALP+ DGGIGFFAVCFER
Sbjct: 477 IRALPRDDGGIGFFAVCFER 496

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/492 (65%), Positives = 377/492 (76%), Gaps = 7/492 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M FYRDATWVLE IE++ +K RISGS+Q+LVLKSC++YKLK+NPKHIYAVLDSCWKYKP+
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVM K+ IL+DIPKKKGKP+++R            SKQKRIQMGKHPIK +VL++KS 
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      D SND+ PVRW RINPL+C P+     V+ EL KKF
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC-PDASA--VMKELEKKF 177

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +V+ W  +VPGSIY+DEFIP LFGIHP DKIT+HELYK G+IIIQDRASCFPAHILNP
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
              D +ID+CSAPGNKTTH ASY++     D+  RI+AFEKDPERAKVLQKMIK+AGCS 
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVP 360
            ISVNVGDFTKLATP K+ DVT FIVDPSCSGSGIFGRK+ DS N             VP
Sbjct: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNG-VP 355

Query: 361 DEQEEFIAKEE--LQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDL 418
           DEQEE   KE   LQ RL+KLSSFQFQ+VKHAMSFP AK+IVYSTCSIHAEENERV +DL
Sbjct: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415

Query: 419 LLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDG 478
           LLD+ V++WGWK+A +  VIP WPRRG V EF+E+FRD    + Q++A+GCIRALP+ DG
Sbjct: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475

Query: 479 GIGFFAVCFERD 490
           GIGFFA+CFERD
Sbjct: 476 GIGFFAICFERD 487

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/497 (64%), Positives = 382/497 (76%), Gaps = 8/497 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRD+TWVLE +EKE AK++ISGS+Q LVLKSCK+YK+KSNP+H+YA + SCWK KPY
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMK++ IL+DIP KKGKP F R            SK KRIQMGKHPIK Y+LK+K+ 
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      + ++D+ PVRWIRINP++   +   EP++ EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +V+ WS++VPG+IY+D++IPNLFG+H  DKIT+HELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
           G +DIVID+C+APGNKTTHTASYI   P KD  T+IYAFEKDPERAK+LQ MIK+AGCS 
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXX-----XXX 355
            I VNVGDFTK+ATPEK+++VT FIVDPSCSGSGIFGRK+ DS N               
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 356 XXXVPDEQEEF--IAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413
              VPDEQEE   + +++L+TRL+KL+SFQFQ+VKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 414 VVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRAL 473
           VVIDLLLDK V+EWGWKVAP+ EVIP+WPRRG   EF +VFRD      Q+LA+GCIR L
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDE-DEKCQELADGCIRVL 479

Query: 474 PKSDGGIGFFAVCFERD 490
           PK DGGIGFFAVCFER+
Sbjct: 480 PKEDGGIGFFAVCFERN 496

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/496 (66%), Positives = 378/496 (76%), Gaps = 11/496 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M FYRDATWVLE +E+E AK RISGS+QTLV +SCKRYKLK NPKH+YAVLDSCWKYKPY
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK+ IL++IPK+KGKP++SR            SK KRIQMGK PIK YVLK KS 
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      D  ND+ PVRWIRINPL+C    + E    E++KKF
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +V+ WS++VPGSIYYDE+IPNLFGIHP DKIT+H LYK GKIIIQDRASCFPAHIL+P
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
             +D+VID C+APGNKTTHTASY+  EP KD   +IYAFEK+PERAK+L KMIK+AGCS 
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXX------ 354
           NI +NVGDFTK+A PEKYKDVT FIVDPSCSGSGIFGRKF DS N               
Sbjct: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGD 356

Query: 355 XXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414
               VPDEQEE+  +E+L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 357 EEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416

Query: 415 VIDLLLDKSVREWGWKVAPKREVIPSWPRRGK-VEEFEEVFRDGVTYDPQQLAEGCIRAL 473
           VIDL+LD  V++WGWKVAP+ +VIP+WPRRGK  E  E    DG +   ++LA GCIRAL
Sbjct: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476

Query: 474 PKSDGGIGFFAVCFER 489
           P+SDGGIGFFAVCFER
Sbjct: 477 PRSDGGIGFFAVCFER 492

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/494 (63%), Positives = 377/494 (76%), Gaps = 5/494 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +EKE AK +ISGSMQ++VLKSCK YK++SNPKHIYAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LE +MKK+ IL +IPKK GKP F R            SK KRIQMGKHP+K+YVLK+K+ 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           L                       D +ND+ PVRW RINP++   +   E +L EL KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +VD WS++  G+IY+DEFIPNLFG+H  DKIT+HELYK GKIIIQDRASCFPAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
           G  DIVIDSC+APGNKTTHTA+YI   P KD   +I+AFEKDPERAKVLQKM++ AGC+ 
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXX---XXXXXXXX 357
            I VNVGDFTK+ATPEK+K+VT FIVDPSCSGSGIFGRKF D+ N               
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 358 XVPDEQ-EEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVI 416
            +P EQ EEF  K++L+TRL+KL+SFQFQ+VKHAM+FP A+K+VYSTCSIHAEENERVVI
Sbjct: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420

Query: 417 DLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKS 476
           DLLLD+++++ GW+VA + +VIP+WPRRG V+EF+EVFRD      +++A GCIRALPK 
Sbjct: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDD-EEKCKEIAGGCIRALPKE 479

Query: 477 DGGIGFFAVCFERD 490
           DGGIGFFAVCFERD
Sbjct: 480 DGGIGFFAVCFERD 493

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/492 (62%), Positives = 375/492 (76%), Gaps = 11/492 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E+E  K R+SGSMQTLVLKSC+RYKLKS+PKH+YAV+DSCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEK+MK++ I +DIPKKKGKP++SR            SKQKRIQMGK PIK+YVLK K+ 
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           L+                      D SND+ PVRWIRINPL+C P  + EPVL EL KKF
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRC-PKNDVEPVLKELIKKF 179

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +V  WS++  G++YYDEF+PNLFG+HP DKIT+HELY+ GKIIIQDR+SCFPAHILNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
           G +D+VID+C+APGNKTTH A++I PE  ++   +IYAFEKDP RA +L+KM  +AGC  
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQ 299

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVP 360
            + ++VGDFTKLA P  +KDVT  IVDPSCSGSGIFGRK  DS N             +P
Sbjct: 300 TVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHN--VAKKKTETDSEIP 357

Query: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DE+E+ +  +++  RL+KL+SFQFQ+VKHAMS P AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 358 DEEEKMVG-DDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLL 416

Query: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDP---QQLAEGCIRALPKSD 477
           D++++EWGWKVA + EVIP WPRRGKV+EFE+VFRD    DP    +LA+GCIRALP+ D
Sbjct: 417 DRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRD----DPVKCNELADGCIRALPQED 472

Query: 478 GGIGFFAVCFER 489
           GGIGFFAVCF+R
Sbjct: 473 GGIGFFAVCFKR 484

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/510 (59%), Positives = 375/510 (73%), Gaps = 23/510 (4%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E +  K R+SGS+ +LV+KSCK++K++SNPKH+YAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           +E++M K+ IL+DIPKKKGKP++ R            SK +RIQMGKHPIK +VL +K+ 
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHXXXXXXXX----XXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAEL 176
           LH                          D ++D+ PVRWIRINP++      ++ ++ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 177 RKKFTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAH 236
           RKKFT KVD WS++ PG IYYDE+IPNLFGI P+DKIT+HELYK+GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 237 ILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNT-------RIYAFEKDPERAKVL 289
           ILN  P D +ID+C+APGNKTTH ASYI      +N+T       R++AFEKDPER+K+L
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMS---LNNDTHINFDKKRVFAFEKDPERSKIL 297

Query: 290 QKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXX 349
            KM+KIAGC   + +N GDFTK+ATPEKY +VT FIVDPSCSGSGIFGRKF D+ N    
Sbjct: 298 DKMVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKK 357

Query: 350 XXXXXXXXXVPDEQE---------EFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIV 400
                      DEQ+         E  AK++L+TRL+KLSSFQFQ+VKHAMSFP+AKKIV
Sbjct: 358 LTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIV 417

Query: 401 YSTCSIHAEENERVVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTY 460
           YSTCSIHAEENERVVIDLLLDK V+EWGWKV P+   IP+W RRG V EFE+VF++    
Sbjct: 418 YSTCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAM 477

Query: 461 DPQQLAEGCIRALPKSDGGIGFFAVCFERD 490
           DP+QLAEGCIR LPK DGGIGFFAVCFER+
Sbjct: 478 DPKQLAEGCIRTLPKEDGGIGFFAVCFERN 507

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/496 (61%), Positives = 373/496 (75%), Gaps = 7/496 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRDATWVLE IE + AK ++SGS+QTLVL SCKR+K+K+NPKHIYAV+ SCW+YKP+
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK+ IL+++P+KKG P+F R            SK KRIQMGKHPIK +VLK+K+ 
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           L+                      D++ND+ PVRW R+NPL+C      + V+ ELRKKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
           T KVD W ++VPGSIYYDE+IPNLF +HP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN--NTRIYAFEKDPERAKVLQKMIKIAGC 298
              DIVID+C+APGNKTTH A++++ +   D     +IYAFEKDPERA+VL KMIKIAGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 299 SPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXX----XXXXX 354
           S  I V VGDFTKLATP+   +V   IVDPSCSGSGIFGRK+ DS N             
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 355 XXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414
               VP+EQEE    + L+TRL+KLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 415 VIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFR-DGVTYDPQQLAEGCIRAL 473
           VIDLLLDK V+E GW+VAP+ +VIP+W RRG V+EF++VFR D  + + Q++A+GCIRAL
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 474 PKSDGGIGFFAVCFER 489
           P+ DGGIGFFAVCFER
Sbjct: 481 PREDGGIGFFAVCFER 496

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/497 (62%), Positives = 376/497 (75%), Gaps = 12/497 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRD+TWVLE +E +  K  R+SGS+QT+VL+ CK+Y++K+NPKHIYA++ SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKS 119
           YL+K+MKK+ +L+ IP+KKGKP FS+            SK KRIQMGKHPIK+YVLK+K+
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 PLHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKK 179
            L+                      D ++D+ PVRWIRINPL+   N +T+ VL EL+KK
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179

Query: 180 FTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILN 239
           F  +V+ W +++PGSIYYDEFIPNL+GIH SDKIT+HELYK GKIIIQDRASCFPAHILN
Sbjct: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PGPSDIVIDSCSAPGNKTTHTASYIY--PEPPKDNNTRIYAFEKDPERAKVLQKMIKIAG 297
           P   D+VID+CSAPGNKTTH A++I+  PE P+++N +IYAFEKDPERA++LQKMIK AG
Sbjct: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 298 CSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXX 357
           C  NI VNVGDFT++ATP KY DVT FI+DPSCSGSGIFGRK  D  N            
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDE--- 356

Query: 358 XVPDEQ--EEFI--AKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413
            VPDE   EE      E+L+ RL+KL+SFQFQ+V+HAMSFP AKKIVYSTCSIHAEENER
Sbjct: 357 -VPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENER 415

Query: 414 VVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRAL 473
           VVIDLLLDK V+ WGW+VA K  V+P+W RRG  EEF+EVF D    + Q+LA+GC+RAL
Sbjct: 416 VVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRAL 475

Query: 474 PKSDGGIGFFAVCFERD 490
           PK DGGIGFFAVCF RD
Sbjct: 476 PKEDGGIGFFAVCFVRD 492

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/490 (61%), Positives = 364/490 (74%), Gaps = 13/490 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MN YRDATWV E +E+E +K +I+GS+QTLVL SCKRYKLK+NPKH+YA++ SCWKYKP+
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEK++KK+ IL+DIPKKKG+P FS             SK KRIQMGKHPIK++VLK K  
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           L                       D SND+ PVRWIRINP++C  NG+ + V  EL+KKF
Sbjct: 121 LQAELAKLKVKLRVTNLSQLVK--DDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             KV  WSE+VPG+IY+DEFIPNLFG+HP+DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
            P D++IDSCSAPGNKTTH A++++         +I+AFEKDPERAK LQKMI++AGC  
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVP 360
           +I V+VGDFTKLA P+K+  VT FIVDPSCSGSGIFGRK  D  N               
Sbjct: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNEVLPEEEQEKEE 356

Query: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
            +Q       +L+TRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENERVVIDLLL
Sbjct: 357 MDQ-------DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 409

Query: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480
           D  V++WGW+V  +  VIP+W RRG VEEF++V++D      Q+LA+GCIRALPK DGGI
Sbjct: 410 DDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQELADGCIRALPKEDGGI 467

Query: 481 GFFAVCFERD 490
           GFFAVCFERD
Sbjct: 468 GFFAVCFERD 477

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/497 (59%), Positives = 362/497 (72%), Gaps = 13/497 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRDATWVLE +E+E +K+ R++GS+QTLVL SCKRYKLK+NP+HIYA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKS 119
           YL+K++KK+ ILED+PKKKGKPLF++            SK KRIQMGKHPIK ++LK ++
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 PLHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKK 179
            L                       D   D+ PVRWIRINP+        + VLAEL KK
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDD-GEDVTPVRWIRINPILVKER--YDDVLAELNKK 177

Query: 180 FTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILN 239
           F  +V+ W ++VPGSIYYDE+IPNLFGIHP DKIT+HE YK GKIIIQDRASCFPAHILN
Sbjct: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237

Query: 240 PGPSDIVIDSCSAPGNKTTHTASYIYPE-PPKDNNTRIYAFEKDPERAKVLQKMIKIAGC 298
           P  +D+VID+C+APGNKTTH A++I+ +   K ++ +I+AFEKDPERAK LQ M+  AGC
Sbjct: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297

Query: 299 SPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXX 358
           +  + ++VGDFTKL  PE +++VT FIVDPSCSGSGIFGRK  D  N             
Sbjct: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357

Query: 359 -----VPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413
                V  E+E F  +++L+ RLAKLSSFQ+Q+VKHAMSFP+AKKI YSTCSIHAEENER
Sbjct: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417

Query: 414 VVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRAL 473
           VVIDLLLD  V+EWGWKV  +  VIP+WPRRG   EFEEVF      + ++LAEGCIRAL
Sbjct: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFP---KEEAKELAEGCIRAL 474

Query: 474 PKSDGGIGFFAVCFERD 490
           PK DGGIGFFAVCFERD
Sbjct: 475 PKEDGGIGFFAVCFERD 491

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/491 (59%), Positives = 362/491 (73%), Gaps = 9/491 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRD++WVLE IE+E +K  RISGS+QTLVL+SCKRYKLK+NPKHIYA++ SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKS 119
           YLEK++K + +L D+P KKG+P+FS+            SK KRI MGKHPIK +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 PLHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKK 179
            L                       D   D+ PVRWIRINP +C   G+ + VL ELRKK
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDA--DMSPVRWIRINPFRCQ--GKVDDVLKELRKK 189

Query: 180 FTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILN 239
           F  +VD W+++VPGSIY DE+IPNL+G+HPSDKIT+HELYK GKIIIQDRASCFPA+ILN
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 240 PGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCS 299
           P P D+VID+CSAPGNKTTH A++I+P+    ++ +IYAFE+D +RA++L+KM+  AGC 
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPD-GNASDVKIYAFERDAKRAEILEKMVTSAGCE 308

Query: 300 PNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXV 359
             I ++VGDFT+LA P+ +KDVT FI+DPSCSGSGIFGR+  D  N              
Sbjct: 309 SCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFE 368

Query: 360 PDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLL 419
             + +E    E  +TRLAKLSSFQFQ+VKHAMSFP AKK+VYSTCSIHAEENERVVIDLL
Sbjct: 369 EQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLL 428

Query: 420 LDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGG 479
           LD++++++GWKVA +  VIP+W RRG + EFEEVF        Q+LA+GCIRALPK DGG
Sbjct: 429 LDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE---QAQELADGCIRALPKEDGG 485

Query: 480 IGFFAVCFERD 490
           IGFFAVCFER+
Sbjct: 486 IGFFAVCFERE 496

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/496 (57%), Positives = 365/496 (73%), Gaps = 23/496 (4%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +EK  +  R++GS+QTLVL SCK+Y LK+NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEK++KK+ IL+D+PKKKGK +F+             +K KRIQMGKHP+K++VLK K+ 
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           L+                      D  ND+ PVRW RINP++CH  G+ E V+AEL KKF
Sbjct: 121 LNSELVRLKIKLKVTDLHQLLK--DDRNDMTPVRWFRINPVRCH--GKHEEVMAELAKKF 176

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +VD W ++VPGSIY+DE+IPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIY----PEPPKDNNTRIYAFEKDPERAKVLQKMIKIA 296
            PSD++ID+C+APGNKTTH A++++    P+ P      I+AFEKDPERAK L+ M+K A
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP-----LIHAFEKDPERAKTLRTMVKTA 291

Query: 297 GCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXX 356
           GCS  I+++VGDFTKLA P  + +V+ FIVDPSCSGSGIFGR+  D  N           
Sbjct: 292 GCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHN------KSREE 345

Query: 357 XXVPDEQEEF--IAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414
             +P ++EE   I  ++++ RLAKL+SFQF++VK+A+SFP+AKK+VYSTCSIHAEENER+
Sbjct: 346 GALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERI 405

Query: 415 VIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALP 474
           VIDLLLD  V+EWGW+V  +   IP+WPRRG   EFE+VFR+G T   ++LAE CIR  P
Sbjct: 406 VIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT--AKELAEACIRVAP 463

Query: 475 KSDGGIGFFAVCFERD 490
           K DGGIGFFAVCFERD
Sbjct: 464 KEDGGIGFFAVCFERD 479

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/491 (58%), Positives = 357/491 (72%), Gaps = 28/491 (5%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRD+TW+LE +E E  K ++SGS+Q+ VLK+C +YK+K+NPKHIYAV+ SCWKY+ Y
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LE++M K+ IL+ IP+KKGKP FSR            SKQKRIQMGKHPIKDYVLK+K+ 
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           LH                      D  +D  PVRWIRINPLKC    +   V+ +L KKF
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQDD-GDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +VD W +L PGSIYYDE++PNLFGIHPS+KIT+H+LYK GK+IIQDRASC PAHILNP
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNN--TRIYAFEKDPERAKVLQKMIKIAGC 298
           G  D+V+D+C+APGNKTTH A++I       N    +I+AFEK+P RAKVLQKM   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 299 SPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXX 358
              + ++VGDFT+LA P++++DVT  +VDPSCSGSGIFGRK  +S N             
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN------------- 342

Query: 359 VPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDL 418
             D Q+     ++LQ RL+KLSSFQFQ+VKHAMS P A+KIVYSTCS+HAEENERVVIDL
Sbjct: 343 --DSQD-----QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395

Query: 419 LLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDG 478
           LLD  V+EWGW+++P+ EV+P+WPRRG  EEFEEVFRD      Q LAE CIRALP+ DG
Sbjct: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDG 454

Query: 479 GIGFFAVCFER 489
           GIGFFAVCF+R
Sbjct: 455 GIGFFAVCFQR 465

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/490 (56%), Positives = 355/490 (72%), Gaps = 7/490 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E      R++GS+QTLVL SCK+Y+LK+NPKHIYA + SCW+Y  +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           L+K++K++ IL+DIPKKKGK +F+             SK KRIQMGKHP+K++VLK+K+ 
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180
           L                       D  ND+ PVRW R+NP++C    ++E +L EL KKF
Sbjct: 167 L--SSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222

Query: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240
             +V+ W+ + PG IY+DE+IP LFG+HP+DKIT+HELYK GK+IIQDRASCFPAHILN 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300
              D++ID+C+APGNKTTH A++I+ +   + + RI+AFEKDPERAK L+ MI  AGC+ 
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVE-SVRIHAFEKDPERAKTLRTMINTAGCTK 341

Query: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVP 360
            I V+VGDFT+LA P K+ DVT FI+DPSCSGSGIFGRK  D  N               
Sbjct: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEK 401

Query: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           +E+ E I+ ++L+ RL KL+SFQF++VKHAMSFP+AKK+VYSTCS+HAEENER+V+DLLL
Sbjct: 402 EEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461

Query: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480
           D  V+EWGW+V  +  VIP+W RRG  +EFEEVFRD  T   ++LAE CIR  PK DGGI
Sbjct: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT--AKELAEACIRVAPKEDGGI 519

Query: 481 GFFAVCFERD 490
           GFFAVCFERD
Sbjct: 520 GFFAVCFERD 529

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/493 (56%), Positives = 354/493 (71%), Gaps = 12/493 (2%)

Query: 1   MNFYRDATWVLEDIEKE-AAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRDA+WVLE IE+E A K +++GS+ +LVL+S K+YKLKS+ +H+YA++ S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLEKVMKKAHILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKS 119
           YL+++++K+ +L+D+P+KKG+P F R            SK+KRI MGKHP+K +VLK ++
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 PLHXXXXXXXXXXXXXXXXXXXXXXDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKK 179
            L                       D   D  PVRWIR+NP +    G+ E VL EL+KK
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQ--DEREDATPVRWIRLNPFRI--RGQREEVLQELQKK 176

Query: 180 FTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILN 239
           F  +V  W EL PGSIY DE++  L+G+HP+DKIT+HELYK GKIIIQDRASCFPA IL 
Sbjct: 177 FPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILA 236

Query: 240 PGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCS 299
           PG SD++ID+C+APGNKTTH A++I+PE   D + +I+AFE+DP+RAK L+KMI  AGC 
Sbjct: 237 PGRSDVIIDACAAPGNKTTHVAAHIFPEGGAD-HAQIHAFERDPQRAKTLRKMIATAGCD 295

Query: 300 PNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXV 359
             I V+VGDFT+ A PE +K+VT FIVDPSCSGSGIFGR+  D+               V
Sbjct: 296 NAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADV 355

Query: 360 PDEQ--EEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVID 417
           P+E+  E   +  EL+ RLAKLSSFQFQ+VKHAMSFP+AKK++YSTCS+HAEENERVVID
Sbjct: 356 PEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVID 415

Query: 418 LLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSD 477
           LLLD  V++ GWKVA + +VIP+WPRRG   EFEEVF D      ++LA GCIR LPK D
Sbjct: 416 LLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPD----QAEELAGGCIRVLPKED 471

Query: 478 GGIGFFAVCFERD 490
           GGIGFFAVCFER+
Sbjct: 472 GGIGFFAVCFERE 484

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 114/294 (38%), Gaps = 57/294 (19%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P ++L   P   V+D C+APG+KT      ++   P+ +   + A + 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGF-VVANDA 204

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATPEKYKDVTCF---IVDPSCSGSGIF 336
           D  R+ +L   +K    +  I VN     F ++ T E  KD   F   + D  CSG G  
Sbjct: 205 DYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTM 264

Query: 337 GRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS-FPA 395
            RK  +                        + K+        L + Q  ++   ++    
Sbjct: 265 -RKNIN------------------------VWKDWGTGSGLGLHTVQLNILNRGLTLLKN 299

Query: 396 AKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVA-----------PKREVIPSWPRR 444
             ++VYSTCS++  ENE VV       ++R+WG K+             +   I SWP  
Sbjct: 300 GGRLVYSTCSLNPIENEAVVA-----AALRKWGAKIKLVNCDDQLLGLVRSTGISSWPVL 354

Query: 445 GKVEEFEEVFRDGV--TYDPQQLAEG-------CIRALPKSDGGIGFFAVCFER 489
            K  E +    DG   T+ P    E        CIR  P      GFF   FE+
Sbjct: 355 DKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 114/275 (41%), Gaps = 55/275 (20%)

Query: 147 SNDLPPVRWIRINPLKCHPNGETEPVLAELRKKFTLK-VDKWSELVPGSIYYDEFIPNLF 205
           +N++P    IR N LK       +   A + K   L+ +  W+++  G   +D  +P   
Sbjct: 279 ANEVPRPISIRTNTLKTR---RRDLAQALVNKGVNLQPIGAWTKV--GLQIFDSQVP--- 330

Query: 206 GIHPSDKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIY 265
                  I A   Y  G+ I+Q  +S  P   L+P  ++ V+D  +APG KTT+ ++ + 
Sbjct: 331 -------IGATSEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM- 382

Query: 266 PEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFI 325
                 N   ++A + +  R K L   I   GC+  I  N   +     P+        +
Sbjct: 383 -----KNTGCVFANDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRIL 434

Query: 326 VDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQ 385
           +D  CSG+G+ G+                         ++ +     +    ++   Q Q
Sbjct: 435 LDAPCSGTGVIGK-------------------------DQSVKSSRTEKDFIQIPHLQKQ 469

Query: 386 MVKHAM-SFPAAKK----IVYSTCSIHAEENERVV 415
           ++  A+ S  A  K    IVYSTCS+  EE+E VV
Sbjct: 470 LLLSAIDSVDANSKTGGVIVYSTCSVAVEEDEAVV 504

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 88/205 (42%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ V+D  SAPG KTT+ ++ +       N
Sbjct: 319 IGATPEYLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM------KN 372

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + + +R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 373 TGCVFANDANKKRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRVLLDAPCSG 429

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S      K  
Sbjct: 430 TGVIGKD---------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKKGG 474

Query: 391 MSFPAAKKIVYSTCSIHAEENERVV 415
           +       IVYSTCS+  EE+E VV
Sbjct: 475 V-------IVYSTCSVAVEEDEAVV 492

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 103/240 (42%), Gaps = 42/240 (17%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G+ I+Q  +S  P   L+P  ++ V+D  +APG KTT+ ++ +       N
Sbjct: 311 IGATSEYLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALM------KN 364

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 365 TGCVFANDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 421

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+                    V   +++FI    LQ +L         ++    S
Sbjct: 422 TGVIGKD---------------QSVKVSRTEKDFIQIPHLQKQL---------LLSAIDS 457

Query: 393 FPAAKK----IVYSTCSIHAEENERVVIDLLLDK--SVREWGWKVAPKREVIPSWPRRGK 446
             A  K    IVYSTCS+  EE+E  V+D  L K  +VR     +A  +E   S+  RGK
Sbjct: 458 VDANSKTGGFIVYSTCSVAVEEDE-AVVDYALRKRPNVRLVDTGLAIGKEGFTSF--RGK 514

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 88/207 (42%), Gaps = 37/207 (17%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G+ I+Q  +S  P   L+P  ++ ++D  SAPG KTT+ ++ +       N
Sbjct: 311 IGATPEYLAGQYILQAASSFLPVIALDPQENERILDMASAPGGKTTYISALM------KN 364

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 365 TGCVFANDANKNRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 421

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+                    V   +++FI    LQ +L         ++    S
Sbjct: 422 TGVIGKD---------------QSVKVSRTEKDFIQIPHLQKQL---------LLSAIDS 457

Query: 393 FPAAKK----IVYSTCSIHAEENERVV 415
             A  K    IVYSTCS+  EE+E VV
Sbjct: 458 VDANSKSGGVIVYSTCSVAVEEDEAVV 484

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 119/294 (40%), Gaps = 57/294 (19%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ + P+ +   + A + 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATPEKYKDVTCF---IVDPSCSGSGIF 336
           D  R+ +L   +K    +  I VN     F ++ T E  KD   F   + D  CSG G  
Sbjct: 204 DYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGTM 263

Query: 337 GRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS-FPA 395
            RK  +                        + K+        L + Q  ++   ++    
Sbjct: 264 -RKNIN------------------------VWKDWATASGLGLHTVQVNILNRGLNLLKD 298

Query: 396 AKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVAP-----------KREVIPSWPRR 444
             ++VYSTCS++  ENE VV       ++R+WG K+             + + I  WP  
Sbjct: 299 GGRLVYSTCSLNPIENEAVVA-----AALRKWGDKIKLVECGDKLPGLIRSQGISQWPVY 353

Query: 445 GKVEEFEEVFRDGV--TYDP---QQLA----EGCIRALPKSDGGIGFFAVCFER 489
            K    ++   +GV  ++ P   ++++    E C+R  P      GFF   FE+
Sbjct: 354 DKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 119/300 (39%), Gaps = 66/300 (22%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTR---IYA 278
           G I  Q+  S  P  +L+  P   V+D C+APG+KT     Y++    +DN+     + A
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLH----RDNDEPSGFVVA 197

Query: 279 FEKDPERAKVLQKMIKIAGCSPNISVN--VGDFTKL-ATPE--KYKDVTCF---IVDPSC 330
            + D +R+ +L   +K    +  I VN     F ++ A P+    KD+  F   + D  C
Sbjct: 198 NDADAKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPC 257

Query: 331 SGSGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHA 390
           SG G   RK  + +                            Q  LA L + Q  ++   
Sbjct: 258 SGDGTM-RKNVNVWRDWTT-----------------------QNGLA-LHNVQLNILNRG 292

Query: 391 MS-FPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVI 438
           +    +  ++VYSTCS++  ENE VV + L     R+WG KV             +   I
Sbjct: 293 LHLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLVRSNGI 347

Query: 439 PSWPRRGKVEEFEEVFRDGV--TYDPQQLAEG-------CIRALPKSDGGIGFFAVCFER 489
             WP   +  E +E   DG   ++ P    E        C+R  P      GFF    E+
Sbjct: 348 NQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 88/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 317 IGATPEYLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KN 370

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P         ++D  CSG
Sbjct: 371 TGCVFANDANKSRTKSLVANIHRLGCTNTIVCN---YDAREFPRVIGGFDRILLDAPCSG 427

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+                    V   +++F+    LQ +L  L S    +  H+ +
Sbjct: 428 TGVIGKD---------------QSVKVSRTEKDFMQIPHLQKQL--LLSAIDSVDSHSKT 470

Query: 393 FPAAKKIVYSTCSIHAEENERVV 415
                 IVYSTCS+  EE+E+VV
Sbjct: 471 ---GGIIVYSTCSVAVEEDEQVV 490

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 115/281 (40%), Gaps = 54/281 (19%)

Query: 147 SNDLPPVRWIRINPLKCHPNGETEPVLAELRKKFTLK-VDKWSELVPGSIYYDEFIPNLF 205
           +N++P    IR N LK       + ++    +   LK +  W+++  G   +D  +P   
Sbjct: 273 ANEVPRPITIRTNSLKTRRRDLAQTLV---NRGVNLKPIGPWTKV--GLQIFDSQVP--- 324

Query: 206 GIHPSDKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIY 265
                  I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ + 
Sbjct: 325 -------IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM- 376

Query: 266 PEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFI 325
                 N   ++A + +  R K L   I   GC+  I  N   +     P+        +
Sbjct: 377 -----KNTGCVFANDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRIL 428

Query: 326 VDPSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQ 385
           +D  CSG+G+  +                    V   +++FI    LQ +L         
Sbjct: 429 LDAPCSGTGVIAKD---------------QSVKVSRTEKDFIQIPHLQKQL--------- 464

Query: 386 MVKHAMSFPAAKK----IVYSTCSIHAEENERVVIDLLLDK 422
           ++    S  A  K    IVYSTCS+  EENE  VID  L K
Sbjct: 465 LLSAIDSVDANSKTGGVIVYSTCSVAVEENE-AVIDYALRK 504

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 328 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM------KN 381

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 382 TGCVFANDANKNRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 438

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S      K  
Sbjct: 439 TGVIGK---------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKKGG 483

Query: 391 MSFPAAKKIVYSTCSIHAEENERVV 415
           +       IVYSTCS+  EE+E VV
Sbjct: 484 I-------IVYSTCSVAVEEDEAVV 501

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 102/238 (42%), Gaps = 38/238 (15%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 316 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 369

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 370 TGCVFANDANKSRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 426

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S      KH 
Sbjct: 427 TGVIGKD---------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 470

Query: 391 MSFPAAKKIVYSTCSIHAEENERVVIDLLLDK--SVREWGWKVAPKREVIPSWPRRGK 446
                   IVYSTCS+  EE+E  VID  L K  +V+     +A  +E   S+  RGK
Sbjct: 471 GV------IVYSTCSVAVEEDE-AVIDYALRKRPNVKLVDTGLAIGKEAFTSY--RGK 519

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 86/205 (41%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ V+D  SAPG KTT+ ++ +       N
Sbjct: 330 IGATPEYLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALM------KN 383

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              I+A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 384 TGCIFANDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 440

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S         
Sbjct: 441 TGVIGK---------------DQSVKVSRTEKDFIQIPHLQKQLILSAIDSLDSNSKNGG 485

Query: 391 MSFPAAKKIVYSTCSIHAEENERVV 415
           +       +VYSTCS+  EE+E VV
Sbjct: 486 V-------LVYSTCSVAVEEDEAVV 503

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 88/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 310 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KN 363

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC   I  N   +     P+        ++D  CSG
Sbjct: 364 TGCVFANDANKARTKSLIANIHRLGCHNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 420

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+                    V   +++F+    LQ +L  LS+    +  H+ +
Sbjct: 421 TGVIGKD---------------QSVKVSRTEKDFMQIPHLQKQLI-LSAID-SVDAHSKT 463

Query: 393 FPAAKKIVYSTCSIHAEENERVV 415
                 IVYSTCS+  EENE VV
Sbjct: 464 ---GGVIVYSTCSVAVEENEAVV 483

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 102/238 (42%), Gaps = 38/238 (15%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 316 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 369

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 370 TGCVFANDANKSRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 426

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S      KH 
Sbjct: 427 TGVIGKD---------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 470

Query: 391 MSFPAAKKIVYSTCSIHAEENERVVIDLLLDK--SVREWGWKVAPKREVIPSWPRRGK 446
                   IVYSTCS+  EE+E  VID  L K  +V+     +A  +E   S+  RGK
Sbjct: 471 GV------IVYSTCSVAVEEDE-AVIDYALRKRPNVKLVETGLAIGKEAFTSY--RGK 519

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 102/237 (43%), Gaps = 34/237 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 313 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM------KN 366

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 367 TGCVFANDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 423

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+                    V   +++F+    LQ +L  LS+          +
Sbjct: 424 TGVIGKD---------------QSVKVSRTEKDFMQIPHLQKQLL-LSAID----SVDSN 463

Query: 393 FPAAKKIVYSTCSIHAEENERVVIDLLLDK--SVREWGWKVAPKREVIPSWPRRGKV 447
                 IVYSTCS+  +ENE  V+D  L K  +V+    K+A  +E   S+  RGK 
Sbjct: 464 SKTGGVIVYSTCSVAVDENE-AVVDYALRKRPNVKLVETKLAIGKEGFTSY--RGKT 517

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 188 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 241

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 242 TGCVFANDANKNRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 298

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S      KH 
Sbjct: 299 TGVIGKD---------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNS-KH- 341

Query: 391 MSFPAAKKIVYSTCSIHAEENERVV 415
                   IVYSTCS+  EE+E VV
Sbjct: 342 -----GGVIVYSTCSVAVEEDEAVV 361

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 323 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMK------N 376

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 377 TGTVFANDANKNRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 433

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S      KH 
Sbjct: 434 TGVIGKD---------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNS-KH- 476

Query: 391 MSFPAAKKIVYSTCSIHAEENERVV 415
                   IVYSTCS+  EE+E VV
Sbjct: 477 -----GGIIVYSTCSVAVEEDEAVV 496

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 113/297 (38%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATP---EKYKDVTCF---IVDPSCSGS 333
           D  R+ +L   +K    +  I VN     F ++ T    EK  D+  F   + D  CSG 
Sbjct: 204 DNRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSF 393
           G   RK  + +                            Q  L  L   Q  ++   +  
Sbjct: 264 GTM-RKNVNVWRDWNT-----------------------QNALG-LHQVQANILNRGLHL 298

Query: 394 -PAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPSW 441
                ++VYSTCS++  ENE VV      +++R+WG KV             + + I  W
Sbjct: 299 LKKGGRLVYSTCSMNPIENEAVVA-----QALRKWGDKVRLVNCDDKLPGLVRNKGISKW 353

Query: 442 PRRGKVEEFEEVFRDGVT---YDPQQ------LAEGCIRALPKSDGGIGFFAVCFER 489
           P   +  E  E  ++G     + P +        E CIR  P      GFF   FE+
Sbjct: 354 PTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVFEK 410

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 85/199 (42%), Gaps = 33/199 (16%)

Query: 219 YKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYA 278
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N   ++A
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFA 362

Query: 279 FEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGR 338
            + +  R K L   I   GC+  I  N   +     P+        ++D  CSG+G+ G+
Sbjct: 363 NDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSGTGVIGK 419

Query: 339 KFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQF--QMVKHAMSFPAA 396
                               V   +++F+    LQ +L  LS+        KH       
Sbjct: 420 D---------------QSVKVNRTEKDFMQIPHLQKQLI-LSAIDSVDSNSKHGGV---- 459

Query: 397 KKIVYSTCSIHAEENERVV 415
             IVYSTCS+  EENE VV
Sbjct: 460 --IVYSTCSVAVEENEAVV 476

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 317 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 370

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 371 TGCVFANDANKSRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 427

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S      KH 
Sbjct: 428 TGVIGKD---------------QSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 471

Query: 391 MSFPAAKKIVYSTCSIHAEENERVV 415
                   IVYSTCS+  EE+E VV
Sbjct: 472 GV------IVYSTCSVAVEEDEAVV 490

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 33/205 (16%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 318 IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 371

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 372 TGCVFANDANKSRTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 428

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+ G+                    V   +++FI    LQ +  L+ + S      KH 
Sbjct: 429 TGVIGK---------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNS-KHG 472

Query: 391 MSFPAAKKIVYSTCSIHAEENERVV 415
                   IVYSTCS+  EE+E VV
Sbjct: 473 GV------IVYSTCSVAVEEDEAVV 491

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 115/301 (38%), Gaps = 67/301 (22%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  +     + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGF-VVANDA 201

Query: 282 DPERAKVLQKMIKIAGCS------------PNISVNVGDFTKLATPEKYKDVTCFIVDPS 329
           D +R+ +L   +K    +            P I  +  D +  A   K+  V C   D  
Sbjct: 202 DSKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRVLC---DVP 258

Query: 330 CSGSGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKH 389
           CSG G   RK  + +                            Q  L  L + QF ++  
Sbjct: 259 CSGDGTM-RKNVNVWRDWTP-----------------------QGGLG-LHTVQFNILNR 293

Query: 390 AMSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV--APKREVIPSWPRRGK 446
            +     K ++VYSTCS++  ENE VV + L     R+WG K+      + +P   R   
Sbjct: 294 GLHLLKNKGRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCEDKLPGLVRSKG 348

Query: 447 VEEFEEVFR--------DGVTYDP------QQLA----EGCIRALPKSDGGIGFFAVCFE 488
           V ++  + R        D  T+D       ++ A    E CIR  P      GFF   FE
Sbjct: 349 VSQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVFE 408

Query: 489 R 489
           +
Sbjct: 409 K 409

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 119/307 (38%), Gaps = 78/307 (25%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L+  P   V+D C+APG+KT      ++ +  + +   + A + 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGF-VIANDA 198

Query: 282 DPERAKVLQKMIKIAGCS------------PNISVNVGDFTKLATPEKYKDVTCFIVDPS 329
           D +R+ +L   +K    S            PN+ +N  D +      K+  + C   D  
Sbjct: 199 DNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASS-QEDLKFDRILC---DVP 254

Query: 330 CSGSGIFGR--KFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMV 387
           CSG G   +    + ++N                           Q  L  L + QF ++
Sbjct: 255 CSGDGTMRKNVNVWKNWNT--------------------------QNALG-LHNVQFNIL 287

Query: 388 KHAMS-FPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKR 435
              ++      K+VYSTCS++  ENE VV  +L     R+WG KV             + 
Sbjct: 288 DRGLTLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRS 342

Query: 436 EVIPSWPRRGKVEEFEEVFR-------DGVTYDPQQLA------EGCIRALPKSDGGIGF 482
           + + +WP   +  + EEV R       +   Y P +        + C+R  P      GF
Sbjct: 343 KGLTTWPVINR--DMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGF 400

Query: 483 FAVCFER 489
           F   FE+
Sbjct: 401 FITMFEK 407

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 103/240 (42%), Gaps = 42/240 (17%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 313 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM------KN 366

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  C+G
Sbjct: 367 TGCVFANDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCTG 423

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+                    V   +++FI    LQ +L         ++    S
Sbjct: 424 TGVIGKD---------------QSVKVSRTEKDFIQVPHLQKQL---------LLSAIDS 459

Query: 393 FPAAKK----IVYSTCSIHAEENERVVIDLLLDK--SVREWGWKVAPKREVIPSWPRRGK 446
             +  K    IVYSTCS+  EE+E +V+D  L K  +V+     +A  +E   S+  RGK
Sbjct: 460 VDSNSKTGGIIVYSTCSVAVEEDE-MVVDYALRKRPNVKLVEAGLAIGKEGFTSY--RGK 516

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 100/240 (41%), Gaps = 42/240 (17%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 327 IGATPEYLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMM------KN 380

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 381 TGCVFANDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 437

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+  +                    V    ++F+    LQ +L         ++    S
Sbjct: 438 TGVIAK---------------DQSVKVSRTDKDFMQIPHLQKQL---------LLSAIDS 473

Query: 393 FPAAKK----IVYSTCSIHAEENERVVIDLLLDK--SVREWGWKVAPKREVIPSWPRRGK 446
             A  K    IVYSTCS+  EENE  V+D  L K  +V+     +A  +E   S+  RGK
Sbjct: 474 VDANSKTGGVIVYSTCSVAVEENE-AVVDYALRKRPNVKLVDAGLAIGKEAFVSY--RGK 530

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 100/238 (42%), Gaps = 38/238 (15%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN 272
           I A   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 305 IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KN 358

Query: 273 NTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSG 332
              ++A + +  R K L   I   GC+  I  N   +     P+        ++D  CSG
Sbjct: 359 TGCVFANDANKARTKSLIANIHRLGCTNTIVCN---YDAREFPKVIGGFDRILLDAPCSG 415

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTR--LAKLSSFQFQMVKHA 390
           +G+  +                    V   +++F+    LQ +  L+ + S         
Sbjct: 416 TGVIAKD---------------QSVKVSRTEKDFMQIPHLQKQLILSAIDSVDSNSKTGG 460

Query: 391 MSFPAAKKIVYSTCSIHAEENERVVIDLLLDK--SVREWGWKVAPKREVIPSWPRRGK 446
           +       IVYSTCS+  EENE  V+D  L K  +V+     +A  +E   S+  RGK
Sbjct: 461 I-------IVYSTCSVAVEENE-AVVDYALRKRPNVKLVDSGLAIGKEGFTSY--RGK 508

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 118/295 (40%), Gaps = 59/295 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTR-IYAFE 280
           G I  Q+  S  P  +L   P+  V+D C+APG+KT      ++ +  +D  T  + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQ--EDEPTGFVVAND 202

Query: 281 KDPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATPEKYKDVTCF---IVDPSCSGSGI 335
            D +R+ +L   +K    +  + VN     F ++ +    K+   F   + D  CSG G 
Sbjct: 203 ADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGT 262

Query: 336 FGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS-FP 394
             RK  +                        + ++        L + Q  ++   ++   
Sbjct: 263 M-RKNVN------------------------VWRDWGTASGLGLHTVQLNILNRGLNLLK 297

Query: 395 AAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPSWPR 443
              ++VYSTCS++  ENE V+   L     R+WG K+             + + I  WP 
Sbjct: 298 DGGRLVYSTCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPGLVRSKGITQWPV 352

Query: 444 RGKVEEFEEVFRDGV--TYDP--QQLA-----EGCIRALPKSDGGIGFFAVCFER 489
             K    +E   +GV  T+ P  ++ A     E CIR  P      GFF   FE+
Sbjct: 353 YDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVFEK 407

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 119/297 (40%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLAT---PEKYKDVTCF---IVDPSCSGS 333
           D  R+ +L   +K    +  + VN     F ++      EK +D+  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSF 393
           G   RK  + +                   +++ A+  L      L + Q+ ++   +  
Sbjct: 264 GTM-RKNVNVW-------------------KDWNAQGAL-----GLHTVQWNILNRGLHL 298

Query: 394 PAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPSW 441
                ++VYSTCS++  ENE VV      +++R+WG K+             + + I  W
Sbjct: 299 LKPNGRLVYSTCSLNPIENEAVVA-----QALRKWGNKIRLVNCDEKLPGLVRSKGISQW 353

Query: 442 PRRGKVEEFEEVFRDGVT---YDPQQLA------EGCIRALPKSDGGIGFFAVCFER 489
           P   +  E +    +GV    + P +        + CIR  P      GFF   FE+
Sbjct: 354 PVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 112/297 (37%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      ++ +  +     I A + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGI-IVANDS 217

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATPEKYKDVTC----FIVDPSCSGSGI 335
           D  R+ +L   +K    S  + VN     F  + T     ++T      + D  CSG G 
Sbjct: 218 DMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGT 277

Query: 336 FGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPA 395
             RK  + +N                  +  +    LQ  +        Q++++      
Sbjct: 278 L-RKNINIWNDWRF--------------QNALGLHRLQNNILNRG---LQLLRN------ 313

Query: 396 AKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVAP-----------KREVIPSWP-- 442
             ++VYSTCS++  ENE V+ + L     R W  +V+            +   I SWP  
Sbjct: 314 GGRLVYSTCSMNPIENEAVIANAL-----RNWAGEVSLVNFDDELPGLIRSRGISSWPVI 368

Query: 443 -------RRGKVEEFEEVFRDGVTYDPQQL--AEGCIRALPKSDGGIGFFAVCFERD 490
                   RG  E  +  F    T D Q+    E CIR  P       FF   FE++
Sbjct: 369 DRNGEMRERGDPETLDSWFPP--TADEQKTFNLEKCIRVYPHQQDTGAFFIAVFEKN 423

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 114/297 (38%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ E  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATPE---KYKDVTCF---IVDPSCSGS 333
           D +R+ +L   +K    +  + VN     F ++   E   + KDV  F   + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCSGD 263

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSF 393
           G   RK  + +                            Q+ L  L + Q  ++   +  
Sbjct: 264 GTM-RKNVNVWRDWNT-----------------------QSGLG-LHTVQLNILNRGLHL 298

Query: 394 PAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPSW 441
              K ++VYSTCS++  ENE VV       ++R+WG K+             + + I +W
Sbjct: 299 LKPKGRLVYSTCSMNPIENEAVVA-----AALRKWGDKIRLVNCDDKLPGLVRSKGISTW 353

Query: 442 P---------RRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFER 489
           P         ++G     E  F        +     CIR  P      GFF   FE+
Sbjct: 354 PVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVFEK 410

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 118/297 (39%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVNV-GDF---TKLAT-PEKYKDVTCF---IVDPSCSGS 333
           D +R+ +L   +K    +  + VN    F    KL T  EK K++  F   + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS- 392
           G   RK  + +                            Q  L  L + Q  ++   ++ 
Sbjct: 264 GTM-RKNVNVWKDWNT-----------------------QGGLG-LHTVQLNILNRGLNL 298

Query: 393 FPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVA-----------PKREVIPSW 441
             +  ++VYSTCS++  ENE VV + L     R+WG K+             + + I +W
Sbjct: 299 LKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGSKIKLVNCDDKLVGLVRSKGISNW 353

Query: 442 PRRGKVEEFEEVFRDGV-------TYDPQQL--AEGCIRALPKSDGGIGFFAVCFER 489
           P   +    +    +G        T + +++   + CIR  P      GFF   FE+
Sbjct: 354 PVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVFEK 410

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 110/301 (36%), Gaps = 68/301 (22%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ E  +     + A + 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGF-VVANDS 203

Query: 282 DPERAKVLQKMIKIAGCS------------PNISVNVGDFTKLATPEKYKDVTCFIVDPS 329
           D  R+ +L   +K    +            P I ++VGD  K     K+  + C   D  
Sbjct: 204 DYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-NKAKDALKFDRILC---DVP 259

Query: 330 CSGSGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKH 389
           CSG G   RK  + +                            Q  L  L + Q+ ++  
Sbjct: 260 CSGDGTM-RKNVNVWKDWNT-----------------------QAGLG-LHTIQYNILNR 294

Query: 390 AMS-FPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVA-----------PKREV 437
            +       ++VYSTCS++  ENE VV      +++R WG K+             +   
Sbjct: 295 GLHLLKTGGRLVYSTCSLNPIENEAVVA-----RALRTWGSKIKIINCDDKLPGLIRSNG 349

Query: 438 IPSWPRRGKVEEFEEVFRDGVT------YDPQQLA---EGCIRALPKSDGGIGFFAVCFE 488
           +  WP   +  E +    +G         D +  A   + C+R  P      GFF    E
Sbjct: 350 VTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFFITVIE 409

Query: 489 R 489
           +
Sbjct: 410 K 410

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 113/297 (38%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT      ++    +     + A + 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGI-VVANDA 202

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATPEKYKDVTCF------IVDPSCSGS 333
           D  R+ +L   +K    +  + VN     F ++A  E   D   F      + D  CSG 
Sbjct: 203 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGD 262

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSF 393
           G   RK  + +                    ++ ++  L      L + Q  ++   +  
Sbjct: 263 GTM-RKNVNVW-------------------RDWTSQGGL-----GLHNIQLNILNRGLHL 297

Query: 394 PAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPSW 441
              K ++VYSTCS++  ENE V+       ++R+WG K+             + + I SW
Sbjct: 298 LKPKGRLVYSTCSMNPIENEAVIA-----AALRKWGSKIRVINCDEKLPGLVRSKGIDSW 352

Query: 442 PRRGKVEEFEEVFRDGV--TYDP-------QQLAEGCIRALPKSDGGIGFFAVCFER 489
           P   +  E  +    GV  T+ P       Q   + CIR  P       FF    E+
Sbjct: 353 PVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITVIEK 409

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 111/297 (37%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  +     + A + 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGF-VVANDA 204

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLAT---PEKYKDVTCF---IVDPSCSGS 333
           D  R+ +L   +K    +  + VN     F ++      +K KD+  F   + D  CSG 
Sbjct: 205 DSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCSGD 264

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS- 392
           G   RK  + +                            Q+ L  L + Q+ ++   ++ 
Sbjct: 265 GTM-RKNVNVWKDWNT-----------------------QSGLG-LHTVQYNILNRGLNL 299

Query: 393 FPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVA-----------PKREVIPSW 441
             +  ++VYSTCS++  ENE VV      +++R WG K+             + + I  W
Sbjct: 300 LKSGGRLVYSTCSLNPIENEAVVA-----QALRTWGDKIKLVNCGDKLPGLVRSQGISQW 354

Query: 442 P---------RRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFER 489
           P          +G     E  F            E CIR  P      GFF    E+
Sbjct: 355 PVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVIEK 411

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 110/294 (37%), Gaps = 57/294 (19%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L       V+D C+APG+KT      ++    +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATPEKYKDVTCF---IVDPSCSGSGIF 336
           D  R+ +L   +K    +  + VN     F ++ T ++      F   + D  CSG G  
Sbjct: 204 DARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTM 263

Query: 337 GRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSF-PA 395
            RK  +                        + K+        L + Q  ++K  ++    
Sbjct: 264 -RKNVN------------------------VWKDWGTASGLGLHTVQLNILKRGLNLLKK 298

Query: 396 AKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVA-----------PKREVIPSWPRR 444
             ++VYSTCS++  ENE VV   L     R+WG K+             + + I +WP  
Sbjct: 299 GGRLVYSTCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPGLVRSKGISNWPVI 353

Query: 445 GKVEEFEEVFRDGVT--YDPQQLAEG-------CIRALPKSDGGIGFFAVCFER 489
            K  E +E   +G T  + P    E        CIR  P      GFF    E+
Sbjct: 354 DKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 110/305 (36%), Gaps = 76/305 (24%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNT---RIYA 278
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++    +D+N     + A
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALH----RDSNEPTGFVVA 194

Query: 279 FEKDPERAKVLQKMIKIAGCSPNISVN-----------VGDFTKLATPEKYKDVTCFIVD 327
            + D  RA +L   +K    +  + VN             D T  +   KY  + C   D
Sbjct: 195 NDSDSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILC---D 251

Query: 328 PSCSGSGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMV 387
             CSG G   RK  +                        + K+        L + Q  ++
Sbjct: 252 VPCSGDGTM-RKNVN------------------------VWKDWNTQNALGLHNVQLNIL 286

Query: 388 KHAMSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVA-----------PKR 435
              +       ++VYSTCS++  ENE VV       ++R+WG K+             + 
Sbjct: 287 NRGLQLLKDNGRLVYSTCSLNPIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRS 341

Query: 436 EVIPSWPRRGKVEEFEEVFRDGVT-----YDPQQLA------EGCIRALPKSDGGIGFFA 484
             I  W    +  E   + +D  +     ++P          E C+R  P      GFF 
Sbjct: 342 NGISHWSVYDR--EMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFI 399

Query: 485 VCFER 489
             FE+
Sbjct: 400 AVFEK 404

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 109/297 (36%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLATPE---KYKDVTCF---IVDPSCSGS 333
           D  R+ +L   +K    +  + VN     F ++   E   K  DV  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS- 392
           G   RK  + +                            Q  L  L + Q  ++   +  
Sbjct: 264 GTM-RKNVNVWKDWNT-----------------------QAGLG-LHTVQLNILNRGLHL 298

Query: 393 FPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPSW 441
                ++VYSTCS++  ENE V+ + L     R+WG K+             + + +  W
Sbjct: 299 LKDGGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLSGLVRSKGVSKW 353

Query: 442 P---------RRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFER 489
           P          +G     E  F        +   + C+R  P      GFF   FE+
Sbjct: 354 PVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 111/298 (37%), Gaps = 61/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L+  P   V+D C+APG+KT      ++ + P+ +   + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGF-VVANDS 197

Query: 282 DPERAKVLQKMIKIAGCSPNISVNVG---------DFTKLATPEKYKDVTCFIVDPSCSG 332
           D +R+ +L   +K    +  + VN           D  K    ++Y      + D  CSG
Sbjct: 198 DSKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCSG 257

Query: 333 SGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   RK  +                        I K+        L + Q  ++   + 
Sbjct: 258 DGTI-RKNVN------------------------IWKDWNTQNSLGLHNVQLNILNRGIQ 292

Query: 393 -FPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV--APKREVIP---SWPRRGK 446
              +  ++VYSTCS+   ENE V+       ++R+WG K+     +E++P   S P   K
Sbjct: 293 LLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPGISK 347

Query: 447 VEEFEEVF---------RDGVTYDPQQLAEG------CIRALPKSDGGIGFFAVCFER 489
            E ++                 + P +          CIR  P      GFF    E+
Sbjct: 348 WEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFFIAVLEK 405

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 107/300 (35%), Gaps = 66/300 (22%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVNV-----------GDFTKLATPEKYKDVTCFIVDPSC 330
           D  R+ +L   +K    +  + VN            G+ +      K+  + C   D  C
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILC---DVPC 260

Query: 331 SGSGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHA 390
           SG G   RK  + +                            Q  L  L + Q  ++   
Sbjct: 261 SGDGTM-RKNVNVWKDWNT-----------------------QAGLG-LHTVQLNILNRG 295

Query: 391 MSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVI 438
           +       ++VYSTCS++  ENE VV + L     R+WG K+             + + +
Sbjct: 296 LHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGV 350

Query: 439 PSWP---------RRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFER 489
             WP          +G     E  F        +   + C+R  P      GFF   FE+
Sbjct: 351 SKWPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVFEK 410

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 109/297 (36%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKL---ATPEKYKDVTCF---IVDPSCSGS 333
           D  R+ +L   +K    +  + VN     F ++       K  D+  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSGD 263

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSF 393
           G   RK  + +                            Q  L  L + Q  ++   +  
Sbjct: 264 GTM-RKNVNVWKDWNT-----------------------QAGLG-LHTVQLNILNRGLHL 298

Query: 394 PAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPSW 441
             +  ++VYSTCS++  ENE V+ + L     R+WG K+             + + +  W
Sbjct: 299 LKSNGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLTGLIRSKGVSKW 353

Query: 442 P---------RRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFER 489
           P          +G     E  F        +   + C+R  P      GFF   FE+
Sbjct: 354 PVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVFEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 107/297 (36%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++ +  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGF-VVANDA 203

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKL---ATPEKYKDVTCF---IVDPSCSGS 333
           D  R+ +L   +K    +  + VN     F ++          DV  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSF 393
           G   RK  + +                            Q  L  L + Q  ++   +  
Sbjct: 264 GTM-RKNVNVWKDWNT-----------------------QAGLG-LHAVQLNILNRGLHL 298

Query: 394 PAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPSW 441
                ++VYSTCS++  ENE VV + L     R+WG K+             + + +  W
Sbjct: 299 LKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGVSKW 353

Query: 442 P---------RRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFER 489
           P          +G     +  F        +   + C+R  P      GFF   FE+
Sbjct: 354 PVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 111/315 (35%), Gaps = 95/315 (30%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L+  P   V+D C+APG+KT      ++ E  + +   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGF-VIANDA 203

Query: 282 DPERAKVLQKMIKIAGCS------------PNISVNVGDFTKLATPEKYKDVTCFIVDPS 329
           D +R+ +L   +K    +            P I V+  + +K     K+  V C   D  
Sbjct: 204 DYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLC---DVP 260

Query: 330 CSGSGIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLAKLSSFQFQMVKH 389
           CSG G   RK  +                        + K+        L   Q  +++ 
Sbjct: 261 CSGDGTM-RKNVN------------------------VWKDWNTGSGLGLHIVQLNILER 295

Query: 390 AMS-FPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWG-------------------- 428
            ++      K+VYSTCS++  ENE V+       ++R WG                    
Sbjct: 296 GLNLLKEGGKLVYSTCSLNPIENEAVIA-----AALRRWGDKVRLVNCDDQLPGLVRSKG 350

Query: 429 ---WKVAPKR---------EVIPSW--PRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALP 474
              WKV  K+           + SW  P   +VE+F                E C+R   
Sbjct: 351 ITEWKVYDKQFQVREKGHENCLDSWFPPTAEEVEKFH--------------LENCMRVYQ 396

Query: 475 KSDGGIGFFAVCFER 489
                 GFF   FE+
Sbjct: 397 HQQNTGGFFITVFEK 411

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 111/292 (38%), Gaps = 62/292 (21%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEK 281
           G I  Q+  S  P  +L   P   V+D C+APG+KTT     ++ +  +     + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGF-VVANDA 201

Query: 282 DPERAKVLQKMIKIAGCSPNISVN--VGDFTKLAT---PEKYKDVTCF---IVDPSCSGS 333
           D  R+ +L   +K    +  + VN     F ++     P K K    F   + D  CSG 
Sbjct: 202 DSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSGD 261

Query: 334 GIFGRKFFDSFNXXXXXXXXXXXXXVPDEQEEFIAKEELQTRLA-KLSSFQFQMVKHAMS 392
           G   RK  + +                         ++  T+ A  L + Q  ++   + 
Sbjct: 262 GTM-RKNVNVW-------------------------KDWNTQGALGLHTVQLNILDRGLH 295

Query: 393 FPAAK-KIVYSTCSIHAEENERVVIDLLLDKSVREWGWKV-----------APKREVIPS 440
                 ++VYSTCS++  ENE VV + L     R WG KV             + + I  
Sbjct: 296 LLQNNGRLVYSTCSMNPIENEAVVAEAL-----RRWGDKVRLVDCSEKLPGLIRSQGITQ 350

Query: 441 WPRRGKVEEFEEVFRDGVT---YDPQQ------LAEGCIRALPKSDGGIGFF 483
           WP   +  E  +   +G+    + P +        E C+R  P      GFF
Sbjct: 351 WPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 49/122 (40%), Gaps = 10/122 (8%)

Query: 222 GKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTR-IYAFE 280
           G I  Q+  S  P  +L   P   V+D C+APG+KT      ++    +D  T  + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALH--ATEDEPTGFVVAND 202

Query: 281 KDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCF------IVDPSCSGSG 334
            D  R+ +L   +K    S N+ V   D       +   D   F      + D  CSG G
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDG 261

Query: 335 IF 336
             
Sbjct: 262 TM 263

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 11/80 (13%)

Query: 242 PSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPN 301
           PSDIV++     GN TT            +   ++ A E DP  A  L K +        
Sbjct: 56  PSDIVLEVGPGTGNLTTRIL---------EKARKVVAVEFDPRMAAELTKRVHGTAAEKK 106

Query: 302 ISVNVGDFTKLATPEKYKDV 321
           + + +GDFTK   P  Y DV
Sbjct: 107 LEIILGDFTKTELP--YFDV 124

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 9/74 (12%)

Query: 242 PSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPN 301
           PSD+V++     GN T             +   R+ A E DP  A  L K +        
Sbjct: 57  PSDVVLEVGPGTGNLTVRIL---------EQARRVVAVEMDPRMAAELTKRVHGTAAEKK 107

Query: 302 ISVNVGDFTKLATP 315
           + + +GDF K   P
Sbjct: 108 LEILLGDFMKTELP 121

>ZYRO0F13486g Chr6 complement(1108746..1113578) [4833 bp, 1610 aa]
            {ON} similar to uniprot|P36126 Saccharomyces cerevisiae
            YKR031C SPO14 Phospholipase D catalyzes the hydrolysis of
            phosphatidylcholine producing choline and phosphatidic
            acid involved in Sec14p-independent secretion required
            for meiosis and spore formation differently regulated in
            secretion and meiosis
          Length = 1610

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 207  IHPSDKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYI 264
            + P DK+   ELY HGK++I D  +C        G ++  I+  S  GN+ +  A+ I
Sbjct: 1016 LGPHDKLVTEELYVHGKVLIVDDRACI------VGSAN--INERSQLGNRDSEVAAII 1065

>YAR007C Chr1 complement(156754..158619) [1866 bp, 621 aa] {ON}
           RFA1Subunit of heterotrimeric Replication Protein A
           (RPA), which is a highly conserved single-stranded DNA
           binding protein involved in DNA replication, repair, and
           recombination
          Length = 621

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 48/117 (41%), Gaps = 18/117 (15%)

Query: 170 EPVLAELRKKFTLKVDKWSELVPGSI----YYDEFIPNLFGIHPSDKITAHELYKHGKII 225
           EP +   RKK+ L VD + ELV            F+ N F  HP++ +   ++   G + 
Sbjct: 86  EPAIVRERKKYVLLVDDF-ELVQSRADMVNQTSTFLDNYFSEHPNETLKDEDITDSGNVA 144

Query: 226 IQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTR-IYAFEK 281
            Q  AS       N G  D++  + +   N+          E P    TR I+A E+
Sbjct: 145 NQTNAS-------NAGVPDMLHSNSNLNANERKFA-----NENPNSQKTRPIFAIEQ 189

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 30/77 (38%), Gaps = 9/77 (11%)

Query: 239 NPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGC 298
           N  PSDIV++     GN T             +   ++ A E DP  A  L K +     
Sbjct: 54  NIKPSDIVLEVGPGTGNLTVRIL---------EQARKVVAVEMDPRMAAELTKRVHGTPA 104

Query: 299 SPNISVNVGDFTKLATP 315
              + + +GDF K   P
Sbjct: 105 EKKLEIMLGDFMKTELP 121

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 32/81 (39%), Gaps = 12/81 (14%)

Query: 235 AHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIK 294
           AHI    PSDIV++     GN T             +   ++ A E DP  A  L K + 
Sbjct: 52  AHI---KPSDIVLEVGPGTGNLTVRIL---------EKAKKVVAVEMDPRMAAELTKRVH 99

Query: 295 IAGCSPNISVNVGDFTKLATP 315
                  + + +GDF K   P
Sbjct: 100 GTPAEKKLDIMLGDFMKTELP 120

>TDEL0D01270 Chr4 complement(242013..246668) [4656 bp, 1551 aa] {ON}
           Anc_1.251 YKR031C
          Length = 1551

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 8/59 (13%)

Query: 206 GIHPSDKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYI 264
            I P DK+   +LY H K++I D  SC        G ++  I+  S  GN+ +  A  I
Sbjct: 946 AIGPQDKLVTEQLYVHAKVLIADDRSCI------IGSAN--INERSQLGNRDSEVAMII 996

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 11/80 (13%)

Query: 242 PSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPN 301
           PSD V++     GN T      +          + YA E DP  A  L K ++       
Sbjct: 57  PSDTVLEVGPGTGNLTVRILEQVR---------KAYAVEMDPRMAAELTKRVRGTDGERK 107

Query: 302 ISVNVGDFTKLATPEKYKDV 321
           + + +GDF K   P  Y DV
Sbjct: 108 LEILLGDFIKTDLP--YFDV 125

>NCAS0B07800 Chr2 complement(1477435..1482504) [5070 bp, 1689 aa] {ON}
            Anc_1.251 YKR031C
          Length = 1689

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 207  IHPSDKITAHELYKHGKIIIQDRASCF 233
            I P DK+   +LY H KI+I D  SC 
Sbjct: 1101 IGPHDKLMTEQLYVHAKILISDDRSCI 1127

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 9/74 (12%)

Query: 242 PSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPN 301
           PSDIV++     GN T             +   ++ A E DP  A  L K +        
Sbjct: 56  PSDIVLEVGPGTGNLTVRIL---------EQARKVVAVEMDPRMAAELTKRVHGTPAEKK 106

Query: 302 ISVNVGDFTKLATP 315
           + + +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 9/74 (12%)

Query: 242 PSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPN 301
           PSD+V++     GN T             +    + A E DP  A  L K ++       
Sbjct: 56  PSDVVLEVGPGTGNLTVRIL---------EQAKSVVAVEMDPRMAAELTKRVRGTQVEKK 106

Query: 302 ISVNVGDFTKLATP 315
           + + +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 11/80 (13%)

Query: 242 PSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPN 301
           PSD+V++     GN T         E  K+    + A E DP  A  L K ++       
Sbjct: 56  PSDVVLEVGPGTGNLTVRIL-----EQAKN----VVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 302 ISVNVGDFTKLATPEKYKDV 321
           + + +GDF K   P  Y DV
Sbjct: 107 LEIMLGDFMKTELP--YFDV 124

>TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5.370
           YHR080C
          Length = 1708

 Score = 31.6 bits (70), Expect = 6.9,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 197 YDEFIPNLFGIHPSDKIT-------AHELYKHGKIIIQDRASCFPAHIL 238
           +  F  N+ GI P +K+        + ++ + GK+ I DR  CF A+IL
Sbjct: 826 FHSFFKNINGISPDEKLIIDITCALSRDILQQGKMYITDRNICFNANIL 874

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 9/74 (12%)

Query: 242 PSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPN 301
           PSD+V++     GN T         E  K+    + A E DP  A  L K ++       
Sbjct: 56  PSDVVLEVGPGTGNLTVRIL-----EQAKN----VVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 302 ISVNVGDFTKLATP 315
           + + +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>TBLA0H02990 Chr8 complement(732711..737957) [5247 bp, 1748 aa] {ON}
            Anc_1.251 YKR031C
          Length = 1748

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 207  IHPSDKITAHELYKHGKIIIQDRASC 232
            I P DKI   +LY H KI+I D  +C
Sbjct: 1051 IGPFDKIVTEQLYVHAKILISDDRNC 1076

>TPHA0K01560 Chr11 complement(326850..328700) [1851 bp, 616 aa] {ON}
           Anc_4.120 YAR007C
          Length = 616

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 169 TEPVLAELRKKFTLKVDKWSELVPGSIYYD---EFIPNLFGIHPSD 211
           TEPV+ + RKKF L +D +  L  GS   +   EF+ + F  H ++
Sbjct: 85  TEPVIVKERKKFVLLIDDYEVLKTGSELINQSSEFLDSYFSHHQNE 130

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 9/74 (12%)

Query: 242 PSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPN 301
           PSD+V++     GN T             +    + A E DP  A  L K ++       
Sbjct: 56  PSDVVLEVGPGTGNLTVRIL---------EQAKNVVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 302 ISVNVGDFTKLATP 315
           + + +GDF K   P
Sbjct: 107 LEILLGDFMKTELP 120

>KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {ON}
           Anc_6.1 YPL266W
          Length = 318

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 11/83 (13%)

Query: 239 NPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGC 298
           N  PSD+V++     GN T             +   ++ A E DP  A  L K +     
Sbjct: 53  NIKPSDVVLEVGPGTGNLTVRIL---------EQARKVVAVEMDPRMAAELTKRVHGTPA 103

Query: 299 SPNISVNVGDFTKLATPEKYKDV 321
              + + +GDF K   P  Y DV
Sbjct: 104 ERKLEIILGDFMKTELP--YFDV 124

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,760,283
Number of extensions: 2135072
Number of successful extensions: 4984
Number of sequences better than 10.0: 85
Number of HSP's gapped: 4971
Number of HSP's successfully gapped: 108
Length of query: 490
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 376
Effective length of database: 40,409,475
Effective search space: 15193962600
Effective search space used: 15193962600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)