Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YNL020C (ARK1)2.284ON63863831410.0
Skud_14.3092.284ON63960223090.0
Smik_14.3112.284ON63764422790.0
Suva_14.3272.284ON63260320060.0
KAFR0H033302.284ON36935712921e-174
TDEL0G021502.284ON66131413121e-173
SAKL0E07722g2.284ON79130913181e-172
NDAI0G006402.284ON62130912831e-169
NCAS0G038102.284ON66130612871e-169
YIL095W (PRK1)2.284ON81037912841e-167
KAFR0J013702.284ON78037912761e-166
Smik_9.842.284ON80831712711e-165
Skud_9.782.284ON80941612701e-165
Suva_9.1042.284ON80531512651e-164
NCAS0B062602.284ON72330912581e-164
Kwal_27.115422.284ON79131412611e-164
KNAG0H020202.284ON59230612411e-163
KLLA0E08405g2.284ON77731312381e-160
NDAI0B035602.284ON75635212251e-159
Kpol_1003.352.284ON71331412141e-158
KLTH0G10318g2.284ON79031412201e-158
CAGL0G02607g2.284ON68831412041e-156
TPHA0C033802.284ON69731812001e-156
TBLA0B059302.284ON71730611941e-155
ZYRO0A01848g2.284ON70431411791e-153
Ecym_33232.284ON74840811831e-152
ADL217W2.284ON75033611721e-151
CAGL0J03432g2.284ON62231111311e-146
Kpol_1039.332.284ON70131411151e-143
TBLA0B069402.284ON144331511471e-141
KNAG0A054302.284ON78831210571e-133
TPHA0D015402.284ON70732010011e-126
KAFR0A010403.273ON9123217965e-94
Kpol_251.43.273ON8383127707e-91
KNAG0J008203.273ON10913217722e-89
NDAI0A057003.273ON11573327733e-89
SAKL0D03234g3.273ON8583057594e-89
CAGL0H10208g3.273ON10273197658e-89
NCAS0A105903.273ON10953257661e-88
TBLA0E025903.273ON10613167624e-88
Kpol_1052.223.273ON11013077626e-88
KNAG0H012203.273ON9133247537e-88
KLTH0C07260g3.273ON9013147501e-87
Kwal_27.109453.273ON9353147486e-87
KAFR0C004303.273ON9493217443e-86
CAGL0K11990g3.273ON9913257437e-86
Skud_2.1793.273ON10903977423e-85
Smik_2.1913.273ON11083177416e-85
Ecym_26503.273ON8943067326e-85
Suva_4.2973.273ON11073177416e-85
TDEL0D035203.273ON10493157361e-84
ZYRO0E06864g3.273ON11153237363e-84
TPHA0A040303.273ON10543457317e-84
TPHA0M011203.273ON7883137181e-83
YBR059C (AKL1)3.273ON11084017292e-83
AGR027C3.273ON9613137215e-83
KLLA0F18612g3.273ON8143067121e-82
TBLA0I019303.273ON13613147097e-80
SAKL0A03344g6.262ON3643492653e-24
KLTH0H03080g6.262ON3463332395e-21
KAFR0A050906.31ON6682652466e-21
Kwal_56.242746.262ON3463372378e-21
TDEL0A067506.262ON3723022362e-20
TPHA0F024306.31ON7983162395e-20
YAR019C (CDC15)3.177ON9742822342e-19
Smik_1.793.177ON9742822342e-19
KNAG0F002901.52ON11253462324e-19
Kpol_1072.198.668ON8962942307e-19
Suva_16.706.262ON3643392238e-19
TBLA0A071501.52ON13913222309e-19
YKL101W (HSL1)2.479ON15183322291e-18
Skud_16.426.262ON3643382211e-18
YPL236C (ENV7)6.262ON3643312211e-18
Ecym_21536.262ON3633502211e-18
Skud_1.723.177ON9742822262e-18
KNAG0F001701.24ON5432752232e-18
KLLA0C01650g1.52ON11123012262e-18
Smik_11.1392.479ON15342342263e-18
KAFR0G012001.24ON5072792214e-18
SAKL0C01716g1.52ON12153242244e-18
Kpol_2002.241.24ON4872672204e-18
NCAS0C041008.141ON9053332235e-18
Ecym_73922.479ON14343582235e-18
Suva_11.1232.479ON15262342227e-18
YDR507C (GIN4)1.52ON11423342219e-18
Skud_4.7831.52ON11353342201e-17
Suva_16.1608.668ON9182932191e-17
Kpol_1065.36.222ON3762892122e-17
Kwal_55.215455.406ON8652162173e-17
Suva_1.863.177ON9742822154e-17
KLTH0F01672g1.52ON11643392164e-17
Ecym_10581.52ON11643122164e-17
CAGL0M02519g8.654ON7563182154e-17
SAKL0E02860g2.479ON13772002154e-17
CAGL0K08514g2.479ON14892482155e-17
TPHA0E038501.24ON4824042115e-17
AFR696C1.52ON11423212145e-17
Smik_6.4416.262ON3643402085e-17
Skud_11.1262.479ON15182342146e-17
KLTH0F16676g5.406ON8782192146e-17
KAFR0D012207.86ON10552182146e-17
Kpol_1037.206.31ON7043262136e-17
SAKL0H06754g8.668ON8842082137e-17
TBLA0A047207.86ON12622292147e-17
KLTH0C10912g6.31ON6973142127e-17
KNAG0A065402.479ON14321982138e-17
KNAG0D048107.86ON14401772139e-17
TBLA0I011502.479ON17453132131e-16
ABL034W2.479ON14253052121e-16
Suva_2.6871.52ON11283342121e-16
KAFR0D041001.52ON11173112111e-16
NDAI0F016006.222ON4122042071e-16
TDEL0A025502.479ON13692062111e-16
KAFR0C014403.92ON10952702111e-16
NDAI0C026806.31ON7504472102e-16
NCAS0A002801.24ON5352802082e-16
KLLA0E21693g5.406ON10162412102e-16
Smik_4.7891.52ON11363342102e-16
CAGL0M02299g8.668ON8932132102e-16
KNAG0E008506.31ON7113212092e-16
Kpol_1023.266.31ON7393012092e-16
ACL006W6.31ON7083022092e-16
KAFR0D032002.479ON14481972102e-16
Kpol_1072.298.654ON8932982092e-16
TPHA0G016308.668ON8712012092e-16
Skud_3.391.52ON10172002092e-16
Suva_2.7031.24ON4851962063e-16
KAFR0D049505.406ON10082132083e-16
KLLA0F13552g2.479ON12672532083e-16
CAGL0F00913g7.86ON12061992084e-16
ZYRO0G03366g2.479ON16161992084e-16
TDEL0C064901.52ON11533232074e-16
YCL024W (KCC4)1.52ON10371982074e-16
ZYRO0F18062g1.24ON4712392044e-16
NCAS0B086001.52ON11173122075e-16
SAKL0E01584g6.31ON6952942065e-16
ZYRO0E07876g6.262ON3693362015e-16
Smik_4.8031.24ON4903212035e-16
NCAS0B044906.222ON3492032005e-16
Smik_13.1596.31ON7052952055e-16
Smik_6.3398.654ON8652652056e-16
YMR001C (CDC5)6.31ON7052952046e-16
TDEL0C067801.24ON4682702026e-16
Ecym_30356.31ON7403022056e-16
Smik_3.541.52ON10322002057e-16
CAGL0L11550g5.406ON10722022057e-16
NDAI0F045201.24ON4892692029e-16
ZYRO0F17402g1.52ON11893512049e-16
NDAI0H024707.86ON14111802041e-15
KLTH0D05566g2.479ON11281992041e-15
KNAG0A030408.654ON6443862021e-15
TBLA0B004906.31ON7873142031e-15
ZYRO0B01166g2.496ON9632752031e-15
Ecym_10301.24ON4402781991e-15
KLTH0D10714g8.654ON8723112021e-15
Smik_4.7673.92ON7581962022e-15
TPHA0E036401.52ON11372002022e-15
Kwal_26.87098.654ON8292192012e-15
AFR724C1.24ON4402781982e-15
NCAS0A057702.479ON14612322022e-15
YDR490C (PKH1)3.92ON7661962012e-15
TBLA0A074601.24ON5161931992e-15
YDR523C (SPS1)1.24ON4902001982e-15
TDEL0H036407.86ON12371802012e-15
Skud_4.7971.24ON4852711982e-15
TBLA0B082503.92ON13471962012e-15
KAFR0G026906.31ON7132951993e-15
Skud_7.928.140ON5632151983e-15
Kwal_26.77882.479ON12673042003e-15
Kpol_2002.461.52ON11232192003e-15
Skud_16.1328.668ON9242941993e-15
NCAS0C016708.668ON8962071993e-15
Skud_13.1546.31ON7052951984e-15
NDAI0A006601.52ON10223261994e-15
TPHA0G032002.479ON15342001994e-15
Kpol_431.92.479ON15521991994e-15
Kwal_56.224766.31ON6972941974e-15
Suva_13.1636.31ON7052861975e-15
TBLA0B023103.92ON8191881975e-15
CAGL0K05709g1.52ON11032111985e-15
Ecym_35863.92ON10771951976e-15
NCAS0C049403.92ON11162731976e-15
Suva_15.2975.406ON10742151976e-15
Sklu_YGOB_Anc_2.4962.496ON6192681966e-15
KLTH0G05214g5.591ON6531981967e-15
SAKL0H07084g8.654ON9192101967e-15
KLTH0D06006g2.496ON9542681967e-15
NDAI0A038702.496ON8952711967e-15
Skud_16.1408.654ON8652651967e-15
TDEL0G043806.31ON7223021951e-14
CAGL0G04609g3.92ON9652831951e-14
YPL141C (FRK1)8.654ON8652651951e-14
TDEL0A027202.496ON9152751951e-14
Suva_3.1901.52ON10242011941e-14
TPHA0J004206.31ON7073051931e-14
KNAG0F029006.31ON6493211931e-14
TBLA0A035705.406ON9752291941e-14
Suva_16.1698.654ON8582711932e-14
YPL150W8.668ON9012901932e-14
Kwal_33.131121.24ON5052811912e-14
YPL209C (IPL1)6.222ON3672011892e-14
CAGL0E05720g6.222ON3582891882e-14
KLLA0C12485g3.92ON9252291932e-14
YCR073C (SSK22)6.341ON13312911932e-14
NDAI0D027502.479ON15151971932e-14
SAKL0G01848g5.406ON8852731922e-14
NDAI0E023908.668ON8831981922e-14
TPHA0G032902.496ON9732281932e-14
Smik_6.3478.668ON9172941922e-14
NCAS0F015807.86ON13821801922e-14
CAGL0J03872g8.654ON6612061913e-14
ZYRO0D05500g7.86ON12621791923e-14
NCAS0D021006.31ON7262881913e-14
TBLA0B039708.654ON12082121923e-14
Skud_4.7643.92ON7561961913e-14
Smik_15.1227.86ON11011841913e-14
NDAI0C017005.406ON10202021914e-14
Skud_8.1635.406ON10762021914e-14
NDAI0E023208.654ON9322121904e-14
KLTH0F00946g1.24ON5121951884e-14
AFL101C6.222ON3672891864e-14
ZYRO0F07194g8.668ON9382001904e-14
SAKL0C00946g1.24ON5642831884e-14
Kpol_1031.105.406ON11272091904e-14
KAFR0K002806.222ON3602071855e-14
TDEL0D053203.92ON10572291905e-14
Kwal_26.78612.496ON9552681895e-14
KAFR0A017602.496ON8852771895e-14
TPHA0G017108.654ON8052121895e-14
KLLA0C08525g6.341ON15512861906e-14
Kwal_26.87518.668ON8482031896e-14
Kwal_47.183075.591ON6212741886e-14
KNAG0J016708.668ON10091981896e-14
Smik_8.422.496ON9392281887e-14
KLLA0B13607g2.496ON9892691887e-14
ZYRO0C07480g6.31ON7742951887e-14
CAGL0J11638g6.31ON7463011887e-14
NDAI0G034508.141ON9483341887e-14
Smik_8.1805.406ON10732021888e-14
ZYRO0E07018g6.222ON3672041838e-14
NDAI0E012908.654ON7292391878e-14
Ecym_55055.406ON10031971888e-14
Suva_16.3823.338ON3982311848e-14
KNAG0K023703.60ON8832551879e-14
Skud_8.392.496ON9232681879e-14
KLTH0D11044g8.668ON8492101871e-13
KLTH0C09548g3.92ON9931941871e-13
Skud_15.1127.86ON11013001871e-13
ZYRO0A06446g5.406ON9432401871e-13
CAGL0I07513g3.92ON10762701871e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL020C
         (638 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...  1214   0.0  
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   894   0.0  
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   882   0.0  
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   777   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   502   e-174
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   509   e-173
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   512   e-172
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    498   e-169
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   500   e-169
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   499   e-167
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   496   e-166
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   494   e-165
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   493   e-165
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   491   e-164
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   489   e-164
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   490   e-164
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   482   e-163
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   481   e-160
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   476   e-159
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   472   e-158
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   474   e-158
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   468   e-156
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   466   e-156
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   464   e-155
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   458   e-153
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   460   e-152
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   456   e-151
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   440   e-146
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   434   e-143
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   446   e-141
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   411   e-133
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   390   e-126
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   311   5e-94
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   301   7e-91
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   301   2e-89
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   302   3e-89
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   296   4e-89
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   299   8e-89
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   299   1e-88
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   298   4e-88
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   298   6e-88
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   294   7e-88
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   293   1e-87
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   292   6e-87
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   291   3e-86
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   290   7e-86
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   290   3e-85
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   290   6e-85
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   286   6e-85
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   290   6e-85
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   288   1e-84
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   288   3e-84
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   286   7e-84
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   281   1e-83
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   285   2e-83
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   282   5e-83
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   278   1e-82
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   277   7e-80
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...   106   3e-24
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    97   5e-21
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             99   6e-21
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    96   8e-21
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    96   2e-20
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    97   5e-20
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    95   2e-19
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    95   2e-19
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    94   4e-19
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    93   7e-19
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    91   8e-19
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    93   9e-19
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    93   1e-18
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    90   1e-18
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    90   1e-18
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    90   1e-18
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    92   2e-18
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    91   2e-18
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    92   2e-18
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    92   3e-18
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    90   4e-18
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    91   4e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    89   4e-18
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     91   5e-18
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    91   5e-18
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    90   7e-18
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    90   9e-18
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    89   1e-17
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    89   1e-17
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    86   2e-17
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    88   3e-17
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    87   4e-17
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    88   4e-17
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    88   4e-17
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    87   4e-17
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    87   4e-17
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    87   5e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    86   5e-17
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    87   5e-17
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    85   5e-17
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    87   6e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    87   6e-17
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    87   6e-17
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    87   6e-17
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    87   7e-17
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    87   7e-17
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    86   7e-17
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    87   8e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    87   9e-17
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    87   1e-16
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    86   1e-16
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    86   1e-16
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    86   1e-16
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    84   1e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    86   1e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    86   1e-16
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    86   2e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        85   2e-16
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    86   2e-16
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    86   2e-16
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    86   2e-16
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    85   2e-16
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    85   2e-16
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    85   2e-16
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    86   2e-16
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    85   2e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    85   2e-16
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    85   2e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    84   3e-16
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    85   3e-16
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    85   3e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    85   4e-16
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    85   4e-16
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    84   4e-16
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    84   4e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    83   4e-16
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    84   5e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    84   5e-16
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    82   5e-16
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    83   5e-16
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     82   5e-16
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    84   5e-16
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    84   6e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    83   6e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    82   6e-16
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    84   6e-16
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    84   7e-16
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    84   7e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    82   9e-16
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    83   9e-16
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    83   1e-15
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    83   1e-15
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    82   1e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    83   1e-15
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    83   1e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    81   1e-15
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    82   1e-15
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    82   2e-15
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    82   2e-15
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    82   2e-15
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    81   2e-15
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    82   2e-15
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    82   2e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    81   2e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    81   2e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    82   2e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    81   2e-15
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    82   2e-15
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    81   3e-15
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    81   3e-15
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    82   3e-15
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    82   3e-15
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    81   3e-15
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    81   3e-15
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    81   4e-15
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     81   4e-15
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    81   4e-15
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    81   4e-15
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    80   4e-15
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    80   5e-15
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    80   5e-15
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    81   5e-15
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    80   6e-15
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    80   6e-15
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    80   6e-15
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    80   6e-15
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    80   7e-15
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    80   7e-15
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    80   7e-15
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     80   7e-15
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    80   7e-15
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    80   1e-14
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    80   1e-14
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    80   1e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    80   1e-14
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    79   1e-14
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    79   1e-14
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               79   1e-14
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    79   1e-14
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    79   2e-14
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    79   2e-14
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    78   2e-14
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    77   2e-14
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    77   2e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    79   2e-14
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    79   2e-14
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    79   2e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    79   2e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    79   2e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    79   2e-14
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    79   2e-14
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    79   2e-14
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    78   3e-14
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    79   3e-14
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      78   3e-14
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    79   3e-14
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    78   3e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    78   3e-14
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    78   4e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    78   4e-14
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               78   4e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    77   4e-14
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    76   4e-14
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    78   4e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    77   4e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    78   4e-14
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    76   5e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    78   5e-14
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    77   5e-14
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    77   5e-14
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    77   5e-14
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    78   6e-14
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    77   6e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    77   6e-14
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    77   6e-14
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    77   7e-14
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    77   7e-14
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    77   7e-14
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    77   7e-14
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     77   7e-14
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    77   8e-14
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    75   8e-14
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    77   8e-14
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    77   8e-14
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    75   8e-14
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    77   9e-14
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    77   9e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    77   1e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    77   1e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    77   1e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    77   1e-13
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    77   1e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    76   1e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    76   1e-13
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    76   1e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    76   1e-13
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    74   1e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    76   1e-13
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    76   1e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    76   2e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    76   2e-13
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    75   2e-13
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    74   2e-13
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    75   2e-13
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    75   2e-13
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    75   2e-13
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     75   2e-13
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    75   2e-13
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    75   2e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    76   2e-13
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    75   2e-13
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    75   2e-13
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    74   2e-13
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    75   2e-13
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    75   3e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    75   3e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    75   3e-13
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    75   3e-13
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    75   3e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    75   3e-13
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    75   3e-13
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    75   3e-13
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    75   4e-13
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    75   4e-13
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    75   4e-13
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    75   4e-13
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    73   4e-13
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    74   4e-13
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    74   4e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    75   4e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    75   5e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    75   5e-13
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    74   5e-13
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    74   5e-13
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    74   6e-13
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    74   6e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    74   6e-13
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    74   7e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    74   7e-13
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    74   7e-13
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    74   7e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       74   7e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    74   7e-13
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    74   7e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    74   7e-13
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    74   7e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    74   7e-13
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    74   8e-13
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    74   8e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    72   8e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    74   8e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    72   8e-13
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    73   8e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    74   9e-13
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    72   9e-13
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    74   9e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    72   9e-13
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    74   9e-13
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    74   1e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    74   1e-12
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               72   1e-12
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    72   1e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    74   1e-12
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    72   1e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    73   1e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    73   1e-12
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    73   1e-12
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    73   1e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    73   1e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    72   1e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    73   2e-12
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    73   2e-12
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    73   2e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    73   2e-12
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    71   2e-12
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    72   2e-12
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    72   2e-12
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     72   2e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    72   2e-12
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    71   2e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    72   2e-12
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    71   2e-12
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    72   2e-12
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      72   3e-12
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    71   3e-12
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    72   3e-12
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    71   3e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    72   3e-12
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    72   3e-12
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    72   3e-12
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    72   3e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    72   3e-12
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    72   3e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    72   3e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    70   3e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    72   3e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    70   3e-12
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    72   4e-12
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    72   4e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    71   4e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    71   4e-12
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    70   5e-12
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    71   5e-12
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    71   5e-12
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    71   5e-12
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    71   5e-12
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    70   5e-12
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    71   5e-12
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    71   5e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    71   5e-12
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    70   6e-12
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    71   6e-12
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    71   6e-12
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    71   6e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    70   6e-12
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    71   6e-12
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    70   7e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    71   7e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    71   7e-12
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    70   7e-12
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    70   8e-12
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    70   8e-12
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    70   8e-12
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    70   8e-12
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    70   8e-12
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    70   8e-12
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    70   8e-12
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    70   9e-12
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    70   9e-12
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    69   9e-12
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    70   9e-12
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    70   1e-11
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    70   1e-11
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    69   1e-11
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    70   1e-11
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    70   1e-11
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    69   1e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    70   1e-11
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    69   1e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    70   1e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    70   1e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    70   1e-11
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    70   1e-11
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    70   1e-11
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    70   1e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    69   1e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    70   1e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    70   1e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    70   1e-11
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    70   1e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    70   1e-11
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    69   1e-11
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    69   1e-11
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    70   2e-11
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    70   2e-11
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    69   2e-11
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    69   2e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    69   2e-11
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    70   2e-11
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    69   2e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    69   2e-11
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    69   2e-11
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    69   2e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    69   2e-11
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    69   2e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    69   2e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    69   2e-11
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    69   2e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    69   2e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    68   2e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    69   2e-11
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    69   2e-11
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    68   2e-11
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    67   2e-11
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    69   3e-11
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    69   3e-11
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    69   3e-11
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    69   3e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     69   3e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    69   3e-11
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    67   3e-11
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    69   3e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              69   3e-11
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    69   3e-11
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    69   3e-11
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    68   3e-11
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    68   3e-11
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    68   3e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    68   3e-11
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    68   4e-11
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    67   4e-11
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    68   4e-11
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    68   4e-11
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    67   4e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    67   4e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    68   4e-11
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    68   4e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    68   4e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    68   4e-11
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    68   5e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    68   5e-11
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    68   5e-11
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    68   5e-11
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    68   5e-11
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    68   5e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    68   5e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    67   5e-11
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    68   5e-11
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    68   5e-11
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    68   6e-11
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    68   6e-11
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    67   6e-11
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    67   6e-11
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    67   6e-11
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    68   6e-11
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    67   6e-11
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    68   6e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    67   6e-11
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    67   6e-11
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    67   7e-11
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    67   7e-11
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    67   7e-11
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    67   8e-11
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    66   8e-11
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    67   8e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    67   8e-11
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    67   8e-11
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    67   8e-11
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    67   8e-11
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               67   8e-11
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              67   8e-11
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     66   8e-11
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    67   8e-11
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    67   9e-11
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    67   9e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    67   9e-11
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    67   1e-10
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    67   1e-10
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    67   1e-10
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    67   1e-10
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    67   1e-10
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    67   1e-10
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    67   1e-10
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    66   1e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    67   1e-10
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    67   1e-10
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    67   1e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    67   1e-10
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    67   1e-10
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    67   1e-10
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    67   1e-10
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    67   1e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    66   1e-10
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    67   1e-10
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    67   1e-10
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    67   1e-10
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    67   1e-10
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    66   1e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    66   1e-10
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    66   1e-10
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    66   2e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    66   2e-10
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    66   2e-10
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    66   2e-10
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    66   2e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    65   2e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    65   2e-10
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    66   2e-10
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    65   2e-10
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    65   2e-10
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    66   2e-10
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    65   2e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    65   2e-10
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    66   2e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    65   2e-10
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    66   2e-10
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    65   2e-10
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    65   3e-10
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    65   3e-10
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    64   3e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    65   3e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       65   3e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    65   3e-10
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    65   3e-10
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    64   3e-10
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    65   3e-10
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    65   3e-10
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    65   3e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    65   3e-10
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     64   3e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    64   3e-10
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    65   3e-10
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    64   3e-10
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    65   4e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    65   4e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    64   4e-10
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    65   4e-10
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    65   4e-10
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    65   4e-10
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    65   4e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    65   4e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    64   4e-10
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    65   4e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    65   4e-10
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    64   4e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   4e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    65   4e-10
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    65   5e-10
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    65   5e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    64   5e-10
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    65   5e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    64   5e-10
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    64   5e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    64   5e-10
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    65   5e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    64   5e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    64   5e-10
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    65   5e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    64   6e-10
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    65   6e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    64   6e-10
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    64   6e-10
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    64   6e-10
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    64   6e-10
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    63   7e-10
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    64   7e-10
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    64   7e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    64   7e-10
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    64   7e-10
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    64   8e-10
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    63   8e-10
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    64   8e-10
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    64   8e-10
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    64   8e-10
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    64   8e-10
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    64   8e-10
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    64   9e-10
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    64   9e-10
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    64   9e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    64   9e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    64   9e-10
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    64   9e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    63   9e-10
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    63   9e-10
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    64   1e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    64   1e-09
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    63   1e-09
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    63   1e-09
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    63   1e-09
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     63   1e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   1e-09
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    63   1e-09
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    63   1e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    63   1e-09
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    62   1e-09
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    62   1e-09
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    63   1e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    62   1e-09
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    63   1e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    63   1e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    62   1e-09
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     63   1e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               63   1e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   2e-09
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    62   2e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    62   2e-09
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    63   2e-09
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    62   2e-09
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    61   2e-09
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    62   2e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    62   2e-09
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    62   2e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    62   2e-09
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    63   2e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    62   2e-09
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    63   2e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    62   2e-09
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    63   2e-09
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    61   2e-09
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    62   2e-09
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    63   2e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    63   2e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               62   2e-09
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    63   2e-09
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    62   2e-09
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    62   2e-09
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    62   2e-09
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    63   2e-09
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    62   2e-09
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    62   2e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    62   2e-09
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    62   2e-09
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    62   2e-09
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     62   2e-09
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    61   2e-09
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    62   2e-09
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    62   2e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    62   3e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    62   3e-09
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    62   3e-09
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    61   3e-09
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    61   3e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    61   3e-09
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    62   3e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    62   3e-09
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    61   3e-09
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    62   4e-09
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    62   4e-09
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    61   4e-09
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    60   4e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     61   4e-09
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    61   4e-09
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    62   4e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    61   4e-09
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    61   4e-09
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    61   4e-09
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    60   4e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    61   5e-09
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    60   5e-09
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    61   5e-09
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    61   5e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    61   5e-09
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    62   5e-09
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    61   5e-09
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    60   5e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    60   5e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    61   6e-09
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              61   6e-09
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    61   6e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    61   6e-09
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    61   6e-09
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    61   6e-09
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    60   6e-09
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    60   7e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    61   7e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    60   7e-09
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    60   7e-09
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    59   7e-09
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               60   8e-09
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    60   8e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    61   8e-09
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    60   8e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    60   8e-09
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    60   8e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    60   8e-09
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    60   9e-09
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    60   9e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    61   9e-09
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   9e-09
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    60   9e-09
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    60   9e-09
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    60   9e-09
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    60   1e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    60   1e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    60   1e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    60   1e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    60   1e-08
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              59   1e-08
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    59   1e-08
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               60   1e-08
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    59   1e-08
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              60   1e-08
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    60   1e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    60   1e-08
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    59   1e-08
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    60   1e-08
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    59   1e-08
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    60   1e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    60   1e-08
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    59   1e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    60   1e-08
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    59   1e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    60   1e-08
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    60   1e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    59   1e-08
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    59   1e-08
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    59   1e-08
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    60   1e-08
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    59   1e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    59   1e-08
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    60   2e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    59   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               59   2e-08
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    59   2e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    60   2e-08
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    59   2e-08
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    59   2e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    59   2e-08
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    60   2e-08
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    59   2e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    59   2e-08
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    59   2e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    59   2e-08
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    59   2e-08
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    59   2e-08
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    58   2e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    59   2e-08
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    58   2e-08
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    59   2e-08
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    58   2e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    59   2e-08
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    59   2e-08
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    59   2e-08
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    59   2e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    58   2e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    59   2e-08
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    58   2e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    59   3e-08
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    57   3e-08
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    59   3e-08
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    59   3e-08
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    58   3e-08
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    59   3e-08
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    59   3e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    59   3e-08
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    59   3e-08
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    58   3e-08
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    57   3e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    58   3e-08
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    58   3e-08
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    58   3e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    59   3e-08
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    59   3e-08
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    59   3e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    59   3e-08
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    59   4e-08
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              58   4e-08
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    57   4e-08
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    58   4e-08
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    59   4e-08
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    58   4e-08
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    58   4e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    58   4e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    58   4e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    58   4e-08
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    57   4e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    58   5e-08
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    58   5e-08
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    57   5e-08
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    57   5e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    58   5e-08
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    58   5e-08
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    57   5e-08
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    58   5e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     57   5e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    59   5e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    58   5e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    58   5e-08
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    57   5e-08
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    58   5e-08
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    58   5e-08
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    57   5e-08
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    58   5e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    58   5e-08
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    57   5e-08
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     57   5e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    58   6e-08
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    57   6e-08
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               57   6e-08
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    58   6e-08
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    58   6e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    58   6e-08
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    58   6e-08
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    57   6e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    57   6e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              58   7e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    58   7e-08
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    57   7e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    58   7e-08
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    58   7e-08
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    58   7e-08
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    57   7e-08
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    57   7e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    57   7e-08
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    57   8e-08
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    57   8e-08
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    58   8e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              57   8e-08
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    57   8e-08
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    57   8e-08
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    57   8e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    57   9e-08
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    57   9e-08
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     57   9e-08
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    57   9e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    57   9e-08
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    57   9e-08
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    57   9e-08
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    57   1e-07
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    56   1e-07
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    56   1e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    56   1e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    57   1e-07
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    57   1e-07
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    57   1e-07
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    57   1e-07
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    57   1e-07
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    57   1e-07
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    56   1e-07
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    57   1e-07
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    57   1e-07
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    57   1e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    57   1e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    57   1e-07
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    56   1e-07
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    56   1e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    57   1e-07
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    56   1e-07
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    57   1e-07
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    57   1e-07
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    57   1e-07
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    57   1e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    57   1e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    55   1e-07
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    57   2e-07
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    57   2e-07
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    56   2e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    57   2e-07
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    55   2e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    56   2e-07
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    56   2e-07
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    56   2e-07
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    56   2e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    57   2e-07
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    56   2e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    56   2e-07
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    57   2e-07
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    56   2e-07
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    55   2e-07
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    55   2e-07
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    56   2e-07
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    56   2e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    56   2e-07
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    56   2e-07
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    56   2e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    56   2e-07
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    56   2e-07
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    56   2e-07
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    56   2e-07
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    55   2e-07
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    56   2e-07
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    56   2e-07
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    56   2e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    55   2e-07
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    56   2e-07
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    56   2e-07
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    55   2e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    55   2e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    55   2e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     56   2e-07
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    56   2e-07
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    56   2e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    56   2e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    55   2e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    55   2e-07
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    55   3e-07
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    55   3e-07
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    56   3e-07
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    56   3e-07
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    55   3e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    56   3e-07
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    56   3e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    55   3e-07
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    55   3e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    55   3e-07
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    55   3e-07
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    55   3e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    55   3e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    55   3e-07
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    55   3e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    55   4e-07
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    55   4e-07
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     55   4e-07
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    55   4e-07
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    55   4e-07
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    55   4e-07
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    55   4e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    55   4e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    55   4e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    55   4e-07
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    55   4e-07
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    54   4e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    55   4e-07
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    55   4e-07
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    54   4e-07
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    55   4e-07
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    55   4e-07
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    55   5e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    55   5e-07
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    55   5e-07
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    55   5e-07
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    54   5e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    54   5e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    55   5e-07
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    55   5e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    54   5e-07
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    55   5e-07
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    55   5e-07
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    55   5e-07
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    54   5e-07
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    54   5e-07
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    55   6e-07
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    54   6e-07
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    54   6e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    55   6e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    54   6e-07
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    55   6e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    55   6e-07
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    55   6e-07
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    54   7e-07
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    54   7e-07
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    54   7e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     54   7e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    54   7e-07
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    54   7e-07
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    54   7e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    54   7e-07
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    55   7e-07
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    54   7e-07
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    54   7e-07
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    55   7e-07
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    54   7e-07
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    54   7e-07
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    54   8e-07
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    54   8e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    54   8e-07
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    55   8e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    54   8e-07
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    54   8e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    54   8e-07
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    54   8e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    54   8e-07
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    54   8e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    54   8e-07
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    54   8e-07
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    54   9e-07
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    54   9e-07
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    54   9e-07
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    54   9e-07
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    54   9e-07
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    54   9e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    54   9e-07
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    53   9e-07
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    54   9e-07
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    54   9e-07
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    54   9e-07
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    53   9e-07
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    54   9e-07
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    54   9e-07
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    54   9e-07
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               54   9e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    54   9e-07
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    54   9e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    54   1e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    54   1e-06
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    54   1e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    54   1e-06
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    54   1e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    54   1e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    54   1e-06
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    54   1e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    54   1e-06
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    54   1e-06
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    54   1e-06
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    54   1e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    54   1e-06
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    54   1e-06
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    54   1e-06
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    54   1e-06
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    54   1e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    54   1e-06
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    54   1e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     54   1e-06
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    54   1e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    53   1e-06
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    54   1e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    54   1e-06
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    53   1e-06
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    54   1e-06
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    54   1e-06
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    54   1e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    54   1e-06
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    54   1e-06
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    53   1e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    53   1e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    53   1e-06
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    53   1e-06
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    53   1e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     53   1e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    54   1e-06
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    53   1e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    53   2e-06
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    53   2e-06
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    52   2e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    53   2e-06
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    53   2e-06
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    53   2e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    53   2e-06
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    53   2e-06
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    53   2e-06
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    53   2e-06
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    52   2e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    53   2e-06
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    53   2e-06
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    53   2e-06
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    53   2e-06
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    53   2e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    52   2e-06
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    53   2e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    53   2e-06
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    52   2e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    53   2e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    53   2e-06
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    52   2e-06
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    53   2e-06
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    53   2e-06
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    53   2e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    53   2e-06
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    53   2e-06
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    53   2e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    53   2e-06
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    53   2e-06
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    53   2e-06
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    53   2e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    52   2e-06
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    53   2e-06
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    53   3e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    52   3e-06
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    52   3e-06
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    52   3e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    52   3e-06
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    52   3e-06
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    52   3e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    52   3e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    52   3e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    52   3e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    52   3e-06
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    52   3e-06
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    52   3e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    52   3e-06
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    52   3e-06
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    52   3e-06
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    52   3e-06
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    52   3e-06
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    52   3e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    52   3e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    52   4e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    52   4e-06
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    52   4e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    52   4e-06
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    52   4e-06
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    52   4e-06
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    52   4e-06
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    52   4e-06
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    52   4e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    51   4e-06
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    52   4e-06
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    52   4e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    52   4e-06
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    52   4e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    51   4e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    52   4e-06
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    51   4e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    52   4e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    52   4e-06
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    52   4e-06
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    51   4e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    52   5e-06
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              52   5e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       52   5e-06
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    51   5e-06
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    51   5e-06
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             52   5e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    52   5e-06
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    52   5e-06
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    52   5e-06
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    51   5e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    52   5e-06
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    51   5e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    52   5e-06
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    52   5e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    52   5e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    51   5e-06
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    51   6e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    52   6e-06
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    51   6e-06
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    50   6e-06
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    52   6e-06
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    51   6e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    51   6e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    51   6e-06
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    51   6e-06
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    51   7e-06
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    51   7e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    51   7e-06
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    51   7e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    51   7e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    51   7e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    51   7e-06
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    51   7e-06
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    51   7e-06
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    51   7e-06
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    51   8e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    51   8e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    51   8e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    51   8e-06
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    51   8e-06
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    51   8e-06
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    51   8e-06
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    50   8e-06
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    51   8e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    51   9e-06
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    51   9e-06
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    51   9e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    51   9e-06
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    50   9e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    50   9e-06
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    51   9e-06
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    50   9e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    51   9e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    51   9e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    51   9e-06
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    51   9e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    51   9e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    50   1e-05
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    50   1e-05
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    51   1e-05
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    50   1e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    51   1e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    50   1e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    50   1e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    50   1e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    50   1e-05
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    50   1e-05
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    50   1e-05
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    50   1e-05
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    50   1e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    50   1e-05
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    47   1e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    50   1e-05
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    50   1e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    50   1e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    50   1e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    50   1e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               50   1e-05
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    50   1e-05
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    50   1e-05
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    50   1e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    50   1e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    50   1e-05
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    50   1e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    49   1e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    50   1e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    50   1e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    50   1e-05
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    50   2e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   2e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    50   2e-05
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    50   2e-05
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    50   2e-05
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    50   2e-05
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    50   2e-05
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    50   2e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    50   2e-05
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    50   2e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    50   2e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    50   2e-05
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    50   2e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    50   2e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    50   2e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    49   2e-05
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    50   2e-05
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    50   2e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               50   2e-05
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    50   2e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    50   2e-05
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    49   2e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    50   2e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    50   2e-05
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    49   2e-05
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    49   2e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    50   2e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    50   2e-05
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    50   2e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    50   2e-05
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    49   2e-05
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    50   2e-05
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    50   2e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    49   2e-05
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    49   2e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    49   2e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    49   2e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    49   2e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    49   2e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    49   2e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    50   2e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    50   2e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    49   2e-05
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    49   2e-05
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    49   2e-05
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    49   2e-05
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    49   2e-05
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    49   2e-05
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    50   2e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    49   2e-05
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    49   3e-05
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    49   3e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    49   3e-05
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    49   3e-05
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               49   3e-05
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    49   3e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    49   3e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    49   3e-05
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    49   3e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    49   3e-05
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    49   3e-05
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    49   3e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    49   3e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    49   3e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    48   3e-05
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    49   3e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    49   4e-05
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    49   4e-05
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    49   4e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    48   4e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    48   4e-05
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    49   4e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    49   4e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    49   4e-05
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    49   4e-05
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    49   4e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   4e-05
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    49   4e-05
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    49   4e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    48   4e-05
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    49   4e-05
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    49   4e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               49   4e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    49   4e-05
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    48   4e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    49   4e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    48   4e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    48   5e-05
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    48   5e-05
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    48   5e-05
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    49   5e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    49   5e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    48   5e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    49   5e-05
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    49   5e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    49   5e-05
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    48   5e-05
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    48   5e-05
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    48   5e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    48   5e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    48   5e-05
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    48   5e-05
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    49   5e-05
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    48   5e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    48   5e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    48   5e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    48   5e-05
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    48   6e-05
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    48   6e-05
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    48   6e-05
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    48   6e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    48   6e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    48   6e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    48   6e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    48   6e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    48   6e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    48   6e-05
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    48   6e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    48   6e-05
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              48   6e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    48   6e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    48   6e-05
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    48   6e-05
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    48   6e-05
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    47   6e-05
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    48   6e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    48   6e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    48   6e-05
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    48   7e-05
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    48   7e-05
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     47   7e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    48   7e-05
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    48   7e-05
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    48   7e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    48   7e-05
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    47   7e-05
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    48   7e-05
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    48   7e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    48   7e-05
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    48   7e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    48   7e-05
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    48   8e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    48   8e-05
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    48   8e-05
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    48   8e-05
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       48   8e-05
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    48   8e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    47   8e-05
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    47   8e-05
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    48   9e-05
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    48   9e-05
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    48   9e-05
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    46   9e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    48   9e-05
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    47   9e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    47   9e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    47   9e-05
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    47   9e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    47   9e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    47   9e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    47   1e-04
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    47   1e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    47   1e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    47   1e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    47   1e-04
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    47   1e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    47   1e-04
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    47   1e-04
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    47   1e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    47   1e-04
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    47   1e-04
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    47   1e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    47   1e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    47   1e-04
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    47   1e-04
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    47   1e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   1e-04
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    47   1e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    47   1e-04
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    47   1e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    47   1e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   1e-04
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    47   1e-04
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    47   1e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    47   1e-04
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    47   1e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    47   1e-04
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    47   1e-04
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    46   1e-04
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    47   1e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    47   1e-04
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    47   1e-04
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    47   1e-04
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    47   1e-04
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    47   1e-04
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    47   1e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    47   1e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    47   1e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    47   1e-04
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    47   1e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    46   1e-04
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    47   1e-04
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    47   1e-04
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    47   1e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    47   1e-04
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    47   1e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    47   1e-04
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               47   1e-04
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    47   1e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    46   2e-04
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    47   2e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    47   2e-04
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    47   2e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    47   2e-04
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    47   2e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    47   2e-04
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    47   2e-04
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    47   2e-04
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    47   2e-04
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    46   2e-04
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    47   2e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    47   2e-04
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    47   2e-04
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    47   2e-04
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    46   2e-04
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    47   2e-04
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    47   2e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    46   2e-04
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    47   2e-04
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    46   2e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    46   2e-04
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    46   2e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    46   2e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    47   2e-04
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    46   2e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    46   2e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               46   2e-04
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    46   2e-04
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    46   2e-04
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    46   2e-04
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    46   2e-04
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    47   2e-04
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    46   2e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    46   2e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    46   2e-04
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    46   2e-04
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    46   2e-04
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    46   2e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    46   2e-04
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    46   2e-04
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              46   2e-04
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    46   2e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    46   2e-04
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    46   2e-04
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    46   2e-04
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     46   2e-04
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    46   2e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    46   2e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    46   2e-04
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    46   3e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    46   3e-04
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    46   3e-04
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    46   3e-04
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    46   3e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    45   3e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    45   3e-04
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    46   3e-04
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    46   3e-04
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    46   3e-04
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    45   3e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    46   3e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    46   3e-04
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    46   3e-04
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    46   3e-04
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    45   3e-04
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    46   3e-04
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    45   3e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    45   3e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    45   3e-04
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    45   3e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    45   3e-04
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    45   3e-04
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    45   3e-04
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    45   4e-04
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    45   4e-04
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    45   4e-04
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    45   4e-04
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    45   4e-04
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    45   4e-04
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    45   4e-04
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    45   4e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    45   4e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    45   4e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    45   4e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    45   4e-04
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    45   4e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    45   4e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    45   4e-04
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    45   4e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    45   4e-04
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    45   5e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    45   5e-04
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    45   5e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    45   5e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    45   5e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    45   5e-04
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    45   5e-04
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    45   5e-04
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    45   5e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    45   5e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    45   5e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    45   5e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    45   5e-04
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    45   5e-04
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    45   6e-04
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    45   6e-04
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    45   6e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    45   6e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    45   6e-04
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    45   6e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   6e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    45   6e-04
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    44   7e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    45   7e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    45   7e-04
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    45   7e-04
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    44   7e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    44   7e-04
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    45   7e-04
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    44   7e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    45   8e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      45   8e-04
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    45   8e-04
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    44   8e-04
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    45   8e-04
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    44   8e-04
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    44   8e-04
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    44   8e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    44   9e-04
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    44   0.001
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    44   0.001
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    45   0.001
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    44   0.001
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    44   0.001
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    44   0.001
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    44   0.001
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    44   0.001
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    44   0.001
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    44   0.001
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    43   0.001
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    44   0.001
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    44   0.001
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    44   0.001
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    44   0.001
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    44   0.001
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    44   0.001
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    44   0.001
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    44   0.001
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    43   0.001
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    44   0.001
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    44   0.001
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    44   0.001
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    44   0.001
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    44   0.001
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    44   0.001
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    44   0.001
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    44   0.001
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    44   0.001
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    44   0.001
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    43   0.001
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    44   0.001
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    44   0.001
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    43   0.002
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    44   0.002
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    43   0.002
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    43   0.002
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      44   0.002
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     44   0.002
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    43   0.002
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    43   0.002
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    44   0.002
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    43   0.002
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    43   0.002
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    43   0.002
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    43   0.002
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    43   0.002
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    44   0.002
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    43   0.002
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    43   0.002
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    43   0.002
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    43   0.002
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    43   0.002
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    43   0.002
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    43   0.002
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    43   0.002
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    43   0.002
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    43   0.002
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    43   0.002
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    43   0.002
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    43   0.002
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    43   0.002
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    43   0.002
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    43   0.002
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    43   0.002
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    43   0.002
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    43   0.002
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    43   0.002
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    42   0.003
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    43   0.003
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    42   0.003
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    42   0.003
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    43   0.003
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    43   0.003
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    43   0.003
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    43   0.003
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    43   0.003
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    42   0.003
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    42   0.003
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    42   0.003
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    42   0.003
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    42   0.003
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.003
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    42   0.003
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    42   0.003
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    42   0.003
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    43   0.003
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    42   0.003
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    42   0.003
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    42   0.003
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    42   0.004
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    42   0.004
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    42   0.004
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    42   0.004
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    42   0.004
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    42   0.004
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    42   0.004
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    42   0.004
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    42   0.004
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    42   0.004
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    42   0.004
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    42   0.004
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    42   0.004
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    42   0.004
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    42   0.004
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    42   0.004
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    42   0.005
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      42   0.005
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    42   0.005
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      42   0.005
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    42   0.005
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    42   0.005
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     42   0.005
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    42   0.005
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    42   0.005
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    42   0.006
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    42   0.006
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    42   0.006
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    42   0.006
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    42   0.006
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    42   0.007
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    42   0.007
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    42   0.007
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    41   0.007
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    42   0.007
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    42   0.007
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    41   0.007
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    41   0.007
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     41   0.007
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    41   0.007
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    41   0.008
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    41   0.008
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    41   0.008
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    41   0.008
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    41   0.009
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    41   0.009
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    41   0.009
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    41   0.009
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    41   0.009
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    41   0.009
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    41   0.010
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    41   0.010
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    41   0.011
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    41   0.011
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    41   0.011
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    41   0.011
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    41   0.012
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    41   0.012
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    40   0.012
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    41   0.012
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    40   0.013
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    40   0.014
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    40   0.014
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    40   0.015
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    40   0.015
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.015
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    40   0.016
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    40   0.016
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    40   0.016
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    40   0.016
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    40   0.016
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    40   0.017
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    40   0.017
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    40   0.017
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      40   0.018
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    40   0.018
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    40   0.018
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    40   0.019
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    40   0.019
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    40   0.019
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    40   0.020
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    40   0.021
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    39   0.021
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    40   0.022
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    40   0.022
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    39   0.022
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    40   0.023
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    40   0.023
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    40   0.023
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    40   0.024
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    39   0.027
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    39   0.027
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    39   0.027
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    39   0.027
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    39   0.028
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    39   0.029
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    39   0.029
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    39   0.030
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    40   0.030
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    39   0.030
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    39   0.034
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    39   0.034
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    39   0.034
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    39   0.035
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    39   0.035
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    39   0.037
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.044
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    38   0.044
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    39   0.045
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    39   0.046
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    39   0.047
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    38   0.053
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    39   0.053
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               39   0.053
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    38   0.053
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    39   0.054
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.058
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    38   0.060
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               38   0.060
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    38   0.062
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    38   0.062
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    38   0.065
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    38   0.065
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    38   0.067
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    38   0.068
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    38   0.068
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             38   0.079
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    37   0.079
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    38   0.088
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    37   0.090
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    38   0.090
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    38   0.091
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    38   0.093
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    38   0.098
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    37   0.10 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    38   0.10 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    37   0.11 
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    38   0.11 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    37   0.12 
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    37   0.12 
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    37   0.13 
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    37   0.14 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    37   0.15 
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    37   0.17 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    37   0.17 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    37   0.17 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    37   0.18 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    37   0.18 
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    37   0.19 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    37   0.20 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    37   0.21 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    37   0.25 
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    36   0.26 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    36   0.27 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    36   0.27 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    36   0.28 
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 36   0.29 
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    36   0.29 
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    36   0.29 
TBLA0C06190 Chr3 complement(1501660..1503108) [1449 bp, 482 aa] ...    36   0.31 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    36   0.31 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    36   0.31 
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    36   0.36 
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    36   0.39 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    35   0.40 
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    36   0.42 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    35   0.43 
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    35   0.49 
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    35   0.49 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    35   0.49 
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     35   0.56 
KAFR0A00170 Chr1 complement(27115..30279) [3165 bp, 1054 aa] {ON...    35   0.59 
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    35   0.62 
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    35   0.63 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    35   0.65 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    35   0.66 
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    35   0.76 
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    35   0.78 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    35   0.82 
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    34   0.86 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    35   0.86 
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    35   0.88 
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    35   0.91 
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    34   0.92 
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    34   0.93 
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    34   0.93 
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    34   1.0  
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    34   1.0  
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    34   1.0  
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    34   1.1  
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    34   1.1  
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    34   1.1  
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     34   1.2  
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    34   1.2  
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    34   1.3  
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    34   1.3  
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    34   1.3  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    34   1.4  
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    34   1.4  
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    33   1.5  
AFR066C Chr6 complement(541523..542635) [1113 bp, 370 aa] {ON} S...    33   1.5  
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    34   1.5  
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    34   1.6  
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    33   1.7  
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    33   1.7  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    33   1.8  
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    33   1.8  
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    33   2.0  
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    32   2.1  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    33   2.2  
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    33   2.2  
KNAG0B01260 Chr2 (237922..240345) [2424 bp, 807 aa] {ON} Anc_3.3...    33   2.2  
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    33   2.4  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    33   2.5  
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    33   2.7  
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    33   2.8  
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    33   3.0  
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    33   3.2  
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    32   3.2  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    32   3.3  
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    33   3.5  
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    32   3.5  
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    32   3.6  
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    32   3.6  
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    32   3.6  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    33   3.6  
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    32   3.8  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    32   3.9  
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    32   4.0  
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...    32   4.5  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    32   4.7  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    32   4.9  
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     32   5.2  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    32   5.6  
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    32   6.3  
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    32   6.5  
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    32   6.8  
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    31   7.4  
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    31   8.0  
YOL109W Chr15 (110297..110638) [342 bp, 113 aa] {ON}  ZEO1Periph...    30   9.7  

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score = 1214 bits (3141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/638 (93%), Positives = 595/638 (93%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTMPNATFQISMADNTT 360
           NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTMPNATFQISMADNTT
Sbjct: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTMPNATFQISMADNTT 360

Query: 361 TAQMHPNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELK 420
           TAQMHPNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELK
Sbjct: 361 TAQMHPNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELK 420

Query: 421 ANSATKLKQAIVSEAHTFRQNNSIDFPLQNIIPQXXXXXXXXXXXXXGDVDELKKTRSLG 480
           ANSATKLKQAIVSEAHTFRQNNSIDFPLQNIIPQ             GDVDELKKTRSLG
Sbjct: 421 ANSATKLKQAIVSEAHTFRQNNSIDFPLQNIIPQYEDSSSSSDESYSGDVDELKKTRSLG 480

Query: 481 SYSTRGNIKKNQSVKESLTSSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDNSKDDLN 540
           SYSTRGNIKKNQSVKESLTSSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDNSKDDLN
Sbjct: 481 SYSTRGNIKKNQSVKESLTSSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDNSKDDLN 540

Query: 541 KPSYEDLDVSKQNLKNSIQQRMIDKLNSSEESFNARKMSKVKLHEKGEIDKPTMLKSSGX 600
           KPSYEDLDVSKQNLKNSIQQRMIDKLNSSEESFNARKMSKVKLHEKGEIDKPTMLKSSG 
Sbjct: 541 KPSYEDLDVSKQNLKNSIQQRMIDKLNSSEESFNARKMSKVKLHEKGEIDKPTMLKSSGP 600

Query: 601 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGRKLSLDK 638
                                        AGRKLSLDK
Sbjct: 601 ISKDKKTKPTPPPKPSHLKPKPPPKPLLLAGRKLSLDK 638

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/602 (74%), Positives = 499/602 (82%), Gaps = 10/602 (1%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQPQIGTYNVGTQLTVGSHQVEI+KYLTSGGFAQVYSALI+PPDPHS+S++ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMRLL+NNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPPRN QELSYVQQDI KNTTAQYRSPEM+D FRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEKGG+ AILSG FEFP YP+YSEQL+ LIRDILVQ+P  RPNVYQLLKRISIMQ
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTMPNATFQISMADNTT 360
           NVPCPI+DIQV QAP SHLNLTELHQLSATQNI SLNS +T+E  +PNA FQ SM D  T
Sbjct: 301 NVPCPISDIQVPQAPDSHLNLTELHQLSATQNIRSLNSHSTIERPIPNAAFQSSMPDAAT 360

Query: 361 TAQMHPNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELK 420
             Q   +RK SQ + + + + SA+  Q   DKS+++ H LDP L E   S+ S + N  K
Sbjct: 361 --QTLFSRKKSQTSDNTTLNYSAENPQTSLDKSESVSHVLDPLLFESGMSNTSKSLNRAK 418

Query: 421 ANSATKLKQAIVSEAHTFRQNNSIDFPLQNIIPQXXXXXXXXXXXXXGDVDELKKTRSLG 480
            +S TKLKQ I SEAH FR N +++ PL+NIIPQ              DVD+L+KT+SLG
Sbjct: 419 VSSTTKLKQVIDSEAHNFRHNYTMNLPLRNIIPQDDDSSSSSDELYPEDVDKLEKTQSLG 478

Query: 481 SYSTRGNIKKNQSVKESLTSSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDNSKDDL- 539
           SY +R N KK +SVKESLTSSSLPG+S T T TK++LK E  P  STFVNT+DNSK+   
Sbjct: 479 SYISRDN-KKGESVKESLTSSSLPGSSLTATPTKLDLKLETLP-NSTFVNTVDNSKNSFR 536

Query: 540 -----NKPSYEDLDVSKQNLKNSIQQRMIDKLNSSEESFNARKMSKVKLHEKGEIDKPTM 594
                N  +Y+D+ VS+Q+LKNSI+QRM+DKLNSSEESFNARKM K K  EK    KP  
Sbjct: 537 NFSKSNPLAYDDVSVSRQDLKNSIRQRMLDKLNSSEESFNARKMPKAKASEKESTGKPIA 596

Query: 595 LK 596
           LK
Sbjct: 597 LK 598

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/644 (70%), Positives = 500/644 (77%), Gaps = 13/644 (2%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQPQIGTYNVGT+LTVGSHQVEIIKYLTSGGFAQVYS LI+PPDPH+N++VACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKA+L NGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRLHEFEILQI+SQVTQGVAAMHALQPPLIHRDIKIENVLIS NNEYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCGIIR PRNSQELSYVQQDILKNTTAQYRSPEMID FRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEKGG+ AILSGKFEFPLYPNYSEQLK LIRDILVQ+P HRP+V+QLLKRISIMQ
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTMPNATFQISMADNTT 360
           NVPCPINDIQ VQAPSSHLNLTELHQLSATQNI SLNS   M N++P   FQ S   N  
Sbjct: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360

Query: 361 TAQMHPNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELK 420
           TAQ  P ++ S I YD +  N AK SQ   +      +AL     E  A S  NN  + +
Sbjct: 361 TAQTLPIKEESNIFYDPTSCNFAKDSQSRLN------NALSRSPFELEAVSDLNNVKD-E 413

Query: 421 ANSATKLKQAIVSEAHTFRQNNSIDFPLQNIIPQXXXXXXXXXXXXXGDVDELKKTRSLG 480
           ANS T+LKQ IVSEAH FRQNNS++  L N+IP              GD DELKKT+SL 
Sbjct: 414 ANSTTRLKQTIVSEAHNFRQNNSLNLSLPNMIPHNDDSSSSSDESYPGDTDELKKTQSLS 473

Query: 481 SYSTRGNIKKNQSVKESLTSSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDNSKDDL- 539
           SYSTR N K++Q V+E LTSSSLPG+SFT   TKVNL H++S FK T  NT+D  K++  
Sbjct: 474 SYSTRSNTKRDQPVEEYLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTSTNTVDGLKNNTL 533

Query: 540 -----NKPSYEDLDVSKQNLKNSIQQRMIDKLNSSEESFNARKMSKVKLHEKGEIDKPTM 594
                N P+Y+ +  SKQ+LKNSIQQRM++KLNSSEESFNARK+S VK   +   + P +
Sbjct: 534 SLSKNNLPAYDYVGGSKQDLKNSIQQRMLEKLNSSEESFNARKISNVKEGGQEGTNIPII 593

Query: 595 LKSSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGRKLSLDK 638
           LKS                                AG+KLSL+K
Sbjct: 594 LKSKASTLKDKKIKPTPPPKPLHLKPKPPPKPLFLAGQKLSLEK 637

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/603 (68%), Positives = 462/603 (76%), Gaps = 28/603 (4%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI+PPDPH+NS+VACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAM+LL+NNRYVVSYIDSHAAKA LHNGSYEVFVLMEYCERGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRLHE EILQIM QVTQGVAAMHALQPPLIHRDIKIENVLISA NEYKLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPPRN QELSYV+QD+LKNTTAQYRSPEM+D FRGLPIDEKSDIWALGIFLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEKGG+ AIL+G+FEF  YPNYSEQL+ LI  +LVQ+P  RPNV+QLLK+I+ MQ
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTMPNATFQISMADNTT 360
           N P PI D+Q VQ PS+HLNL ELHQ SATQNI SLNS +  EN+M N  FQ  M  N  
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360

Query: 361 TAQMHPNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELK 420
           TAQ  P R+ SQ   +A+ S+S  GS               P + E    +  N  N+  
Sbjct: 361 TAQSLPTRENSQAFINAT-SSSLTGS---------------PSIFETGVCNTLNIFNQPN 404

Query: 421 ANSATKLKQAIVSEAHTFRQNNSIDFPLQNIIPQXXXXXXXXXXXXXGDVDELKKTRSLG 480
            N  TKLKQAI SEAH+FR+++ I+  L NIIPQ             GDVDELKKTRSLG
Sbjct: 405 TNPTTKLKQAIDSEAHSFRKSDPINLSLPNIIPQDNDSSSSSDESYTGDVDELKKTRSLG 464

Query: 481 SYSTRGNIK-----KNQSVKESLTSSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDNS 535
           SYST  N K     K +SVK SLT+SS PG+S      K+  K ++ P ++ FV  +D+ 
Sbjct: 465 SYSTHENAKGGESVKGESVKASLTTSSSPGSSSALKPAKIESKRQSLP-ETAFVGVVDSG 523

Query: 536 KDDL------NKPSYEDLDVSKQNLKNSIQQRMIDKLNSSEESFNARKMSKVKLHEKGEI 589
           KD L      N+P  + + VSKQ+LKNSIQQRMI+ LNSSEESFNARK S+ K  E    
Sbjct: 524 KDSLPSDPKSNRPVKDSVSVSKQDLKNSIQQRMINLLNSSEESFNARKKSRAKATEDEGP 583

Query: 590 DKP 592
            KP
Sbjct: 584 GKP 586

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  502 bits (1292), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 240/357 (67%), Positives = 289/357 (80%), Gaps = 15/357 (4%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP+I TY+ GT L VGSHQV IIKY+TSGGFAQ+Y+  I+PPD   +S++ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN++VVSYIDSHA+K+  +NGSYEVF+LMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL E E+L I SQV QG+AAMHALQPPL+HRDIKIENVLIS +N+YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           V GIIRPP N QEL YVQ D+LKNTTAQYRSPEMID +RGLPIDEKSDIWA+G+FLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-GGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299
           YYTTPFEK GG+ AILS ++E+P +P YSE+LK LI  +L+++P  RPN+YQ+++ IS M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QNVPCPINDIQVVQAPSSH------------LNLTELHQL--SATQNILSLNSPTTM 342
           QNVPCPI +  +V     H            LN+++ H +     Q IL  +S + M
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQRILEQHSSSPM 357

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  509 bits (1312), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 232/314 (73%), Positives = 270/314 (85%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP+I  YN GT LTVGSH  ++I YLTSGGFAQVYSA I P D   +S+VACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN++VVSYIDSHAAK+   NGSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL EFEIL IMSQVTQG+AAMHALQPPLIHRDIKIENVLIS   +YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPP+N QE +YVQ D+LKNTTAQYRSPEMID +RG PIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEKGG+LAIL  +F+FP  P YS++LKGLIR +L+++P  RPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 NVPCPINDIQVVQA 314
            + CP+ +  +++A
Sbjct: 301 GIQCPVRNFYLLRA 314

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  512 bits (1318), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/309 (74%), Positives = 271/309 (87%), Gaps = 1/309 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           M+QP + TY  GT LTVGSH+  IIKYLTSGGFA +YSA I+PPDP+S SS+ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLN+LRAEVDAM+LLK +++VVSYIDSHAAK+ L+NGSYEVF+LMEYC RGGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL EFE+L+IMSQV+QGVAAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPP+N QEL+YVQ DILKNTTAQYRSPEMID +RGLP+DEKSDIWALG+FLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G++AIL  KF+FP YP YS+QLK LI  +L ++P  RPN+ QLL  +S +Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NVPCPINDI 309
            VPCP+ + 
Sbjct: 300 GVPCPVKNF 308

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  498 bits (1283), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 230/309 (74%), Positives = 264/309 (85%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQPQ+  Y+ GT L+VGSHQ  IIKYLTSGGFAQVY+A I+P DP  NSS+ CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN +VVSYIDSHAAK   + GSYEVF+LMEYC+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRLHE EIL IMSQV+QGVAAMHALQPPL+HRDIKIENVL+++   YKLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCGIIRPP N QE +YVQ DI+KNTTAQYRSPEMI+  +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+ AIL   F+FP +P+YS+++K LIR  L   P  RPN+YQLL+ +S +Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NVPCPINDI 309
           NVPCPI D 
Sbjct: 301 NVPCPIPDF 309

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  500 bits (1287), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/306 (73%), Positives = 263/306 (85%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQPQI  Y  GT LTVGSH+V+++KYLTSGGFAQ+Y+  I+PPD  +N++VACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVD M+LL+NN +VVSYIDSHAAK   + GSYEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQ RL E EIL IMSQVTQG+AAMHAL PPL+HRDIKIENVL+++  EYK+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCGIIRPP N+QE+SYVQ DI+KNTTAQYR+PEMID +RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+ AIL   F+FP YP YS++LK LI  +L++ P  RPN YQ+L+ +S MQ
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NVPCPI 306
           NV CPI
Sbjct: 301 NVQCPI 306

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  499 bits (1284), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 295/379 (77%), Gaps = 20/379 (5%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+A I+PPDP+SN+++ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG-SYEVFVLMEYCERGGLID 119
           P K  LNTLRAEVDAM+LL+NN++VVSYIDSHAA+++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179
           FMNTRLQNRL E EIL+IMSQ  QG+ AMHALQPPLIHRDIKIENVLIS +  YK+CDFG
Sbjct: 119 FMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKL 239
           SV G+IRPPRN+QE +YVQ DIL NTTAQYRSPEMID +RGLPIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299
           CYYTTPFEK G+  IL  ++++P +P YS++LK LIR +L++ P  RPN+ Q+L+ +S +
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QNVPCPINDIQVVQAPSSHLNLTELHQLSAT-----------QNILSLNSPTTME----- 343
           QN PCPI +  +++A + + N     + S+T           Q++ S+N P  M      
Sbjct: 299 QNKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHV 358

Query: 344 NTMPN-ATFQISMADNTTT 361
           +T PN  TF IS+ DN  T
Sbjct: 359 STTPNLGTFPISINDNNKT 377

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  496 bits (1276), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 235/379 (62%), Positives = 293/379 (77%), Gaps = 18/379 (4%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MN PQI T+  G  LTVGSH  ++IKYLTSGG+AQVY   I+P DP+ NS++ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LLKNNR+VVSYIDSHA+K+ ++NG+YEVFVLME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MN+RLQ+RL E EIL IMS  +QG+AAMH LQP L+HRDIKIENVLIS NNEYK+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCGI+RPP+N QE ++V  DI+KNTTAQYRSPEM+D  +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEK-GGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299
           YYTTPFEK GG+ AIL  +F++P YP YS++LK LIR +L ++P  RPNV Q+L+ +S +
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QNVPCPI----------NDIQVVQAPSSHLNL-TELHQLSATQNILSLNSPTTMENTMPN 348
           Q +PCPI          N+ + ++ P  ++ + T L Q S   N+ SLN      +T+P 
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLN------DTLPT 354

Query: 349 ATFQISMADNTTTAQMHPN 367
           A  + +      T Q  P+
Sbjct: 355 AALKFNQTTIPPTNQHSPH 373

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  494 bits (1271), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 227/317 (71%), Positives = 270/317 (85%), Gaps = 3/317 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+A I+PPDP++N+++ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179
           FMNTRLQNRL E EIL+IMSQ  QG+AAMHALQPPLIHRDIKIENVLIS N  YK+CDFG
Sbjct: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178

Query: 180 SVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKL 239
           SV G+IRPPRN+QE +YVQ DIL NTTAQYRSPEMID +RGLPIDEKSDIWALGIFLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238

Query: 240 CYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299
           CYYTTPFEK G+  IL  ++++P +P YS++LK LIR +L++ P  RPN+ Q+L+ +S +
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298

Query: 300 QNVPCPINDIQVVQAPS 316
           Q  PCPI +  +++A S
Sbjct: 299 QIKPCPIRNFYLLRAMS 315

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  493 bits (1270), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 249/416 (59%), Positives = 307/416 (73%), Gaps = 22/416 (5%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MN PQI  Y+ GT LTVGSH  +IIKYLTSGGFAQVY+A I+PPDP+SN++ ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179
           FMNTRLQ+RL E EIL+IMSQ  QG+AAMH LQPPLIHRDIKIENVLIS +  YK+CDFG
Sbjct: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKL 239
           SV G+IRPPRNSQE +YVQ DIL NTTAQYRSPEMID +R  PIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299
           CYYTTPFEK G+ AIL  ++++P +P YS++LKGLI  +L++ P  RPN+ Q+L+ +S +
Sbjct: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298

Query: 300 QNVPCPINDIQVVQA-----------PS-SHLNLTELHQLSATQNILSLNS--PTTMENT 345
           QN PCPI +  +++A           PS ++++  +L      Q I  L S  P T   T
Sbjct: 299 QNEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRT 358

Query: 346 MPN-ATFQISMADNTTTAQMHPNRKPSQIAYDASFSNS--AKGSQPLFDKSQNMYH 398
            PN  T   ++ +N  T  + P R  +Q   D +  N      S PL D   ++Y+
Sbjct: 359 TPNLGTLTKAITNNNQTESILPVR--TQPESDLNLGNPLMKTKSVPLSDDFASLYY 412

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  491 bits (1265), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 267/315 (84%), Gaps = 3/315 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVYSA I+PPDP+S++++ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG-SYEVFVLMEYCERGGLID 119
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLMEYCERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEYCERGGLID 118

Query: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179
           FMNTRL+NRL E EIL IM Q  QG+AAMHALQPPLIHRDIKIENVLIS    YK+CDFG
Sbjct: 119 FMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFG 178

Query: 180 SVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKL 239
           SV G+IRPP+N QE +YVQ DIL NTTAQYRSPEMID +RGLPIDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299
           CYYTTPFEK G+ AIL  ++++P +P YS++LK LIR +L++ P  RPN+ Q+L+ +S +
Sbjct: 239 CYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QNVPCPINDIQVVQA 314
           QN PCPI +  +++A
Sbjct: 299 QNRPCPIRNFYLLRA 313

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  489 bits (1258), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/309 (71%), Positives = 263/309 (85%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP I TY  GT LTVGSH  +IIKYLTSGGFAQ+Y+  I+P +P++NS  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAM+LLKNNR+VVSYIDSHAA++ +  G+YEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL E EIL I+SQ  QGV+AMHALQP LIHRDIKIENVLISA  E+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VC  IRPPRN QEL+YVQ D+LKNTTAQYR+PEM+D +RGLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEKGG+ AIL  ++++P +P Y+++LK LIR  L++DP  RPN+ QLL+ IS +Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NVPCPINDI 309
            +PCPIN+ 
Sbjct: 301 GIPCPINNF 309

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  490 bits (1261), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/314 (70%), Positives = 264/314 (84%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP  G Y  GT LTVGSHQ  IIKYLTSGGFA +YSA I+P DP+S  +VACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDAM+LL+ N++VVSYIDSHAAK+   +GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL E E+L+IMS +TQG+AAMHAL PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPP+N+QE SYVQ DILKNTTAQYRSPEMID +RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK GD AIL  +F+FP YP YS++LK LI  +L ++P  RPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPINDIQVVQA 314
           NVPCP+ +  ++++
Sbjct: 301 NVPCPLRNFYLLRS 314

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  482 bits (1241), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/306 (70%), Positives = 257/306 (83%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP I TY  GT LTVGSHQV+IIKYLT+GGFAQ+Y   I+P DP S +++ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLN LRAEVDAM+LL+NNR VVSYIDSHAAK+   NG+YEVF+LMEYCE GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           +N+RLQNRL E E++ IM  V+QGVAAMHALQPPL+HRDIKIENVL+S NNE+KLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           V G IRPP N QEL+ VQ DI++NTTAQYRSPEMID  RG PIDEKSDIWALG+FLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+  IL+ ++EFP +P YS++L+ LI  +L   P HRPN+Y ++K +S M+
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NVPCPI 306
           N+ CPI
Sbjct: 301 NISCPI 306

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  481 bits (1238), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 216/313 (69%), Positives = 261/313 (83%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQPQI  Y  GT L VGSHQV+++KYL SGGFA VYS  I+PPDP    +VACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVD+M+ L+ N+++VSYIDSHA K+ ++ G YEV++LMEYC  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL EFEIL IMSQV+QGVAAMHALQPPLIHRDIKIENVL+S N+E+KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           V G+IR PRN++E +YVQ DI+KNTTAQYR PEMID +RGLPIDEKSDIWALG+FLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+ AIL+ KFEFP YP YS+++K LI  +L  DP  RPN+ Q+++ +S +Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 NVPCPINDIQVVQ 313
            +PCPI +  +++
Sbjct: 301 GIPCPIKNFYLLR 313

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  476 bits (1225), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 232/352 (65%), Positives = 276/352 (78%), Gaps = 8/352 (2%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP I  Y  GT LTVG+H+  I KYLTSGGFAQ+Y+  I P D +S S+VACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           P K  LNTLRAEVDAM+LLKNNR+VVSYIDS+A K+  +NGSYEV +LMEYCE GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MN+RLQNRL E EIL I+SQ  QGVA MHALQP L+HRDIKIENVL S N E+KLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG IRPPRN QELSYVQ DILKNTTAQYR PEM+D +RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+ AIL  KF++P +P YS++LK LIR +L ++P  RPN+ +LL+ IS +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NVPCPINDIQVVQAP--SSHLNL---TELHQLSATQNILSLNSPTTMENTMP 347
            VPCPI +  +++A   ++ + L   T + +++  Q I  LN+ T    TMP
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNART---QTMP 349

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  472 bits (1214), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 255/314 (81%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP I TY  G  L VG H   I+KYLTSGG+AQVY A I+PPD  + S + CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNT RAEVDAM+LL+N  +VVSYIDS+AAK+ LHNG+YEV +LME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL EFEIL IMSQVTQGVAAMH+L+PPL+HRDIKIENVLIS + EYKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPP + QE ++VQ DILKNTTAQYR+PEMID  R LPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+ AIL  ++E+  YP+YS+ LK LIR +L   P  RPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NVPCPINDIQVVQA 314
            +PCPI +  + +A
Sbjct: 301 GIPCPIKNFYLERA 314

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  474 bits (1220), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 258/314 (82%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQ     Y  GT+LTVGSH+  IIKYLTSGGFA +Y+A I P D  S + +ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLN LRAEVDAM+LL+ N++VVSYIDSHAAK+ +H+GSYEVF+LMEYC  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL E E+L+I S +TQG+AAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPP+N QE +YVQ DILKNTTAQYR+PEMID +RG PI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+ AIL  +F+FP YP YS+ LK LI  +L ++P  RPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPINDIQVVQA 314
             PCP+ +  V +A
Sbjct: 301 GTPCPLRNFYVTRA 314

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  468 bits (1204), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/314 (68%), Positives = 260/314 (82%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP++   NVGTQLTVG+H V+I+KYLTSGGFAQ+Y+  I      + S+VACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDAM+LL NN++VVSYIDSHA ++  ++G+YEVF+LMEYCE GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL E EIL IMSQ TQG+A MHAL PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           V G+IRPPRN QEL YVQ DI+KNTTAQYR PEM+D +RGLPIDEK+DIWALG+FLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+ AIL  +F+FP +PNYS++LK LI+ +L + P  RPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NVPCPINDIQVVQA 314
           NVPCPI +  +++A
Sbjct: 301 NVPCPIRNFYLLRA 314

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  466 bits (1200), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/318 (67%), Positives = 258/318 (81%), Gaps = 4/318 (1%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP+I  Y  G  L VGSHQ +I+KYLTSGGFAQVY   I+P D HS S++ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAM----LHNGSYEVFVLMEYCERGG 116
           PDK SLN  RAEV+AM+LL+NN+YVVSYIDSHAAK+     + NGSYEVF+LMEYC   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLC 176
           LIDFMNTRLQNRL EFEIL IMS V+QGVAAMHALQPPL+HRDIKIENVLIS  NE+KLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFL 236
           DFGSVCG+IRPP N  EL +VQ DILKNTTAQYRSPEM+   + +PI+EKSDIWALG+FL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRI 296
           YK+CYYTTPFEK G+ AIL  ++++P YP YS+ LK LIR +L+ DP  RPN+ Q+++ +
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SIMQNVPCPINDIQVVQA 314
           S +Q VPCP+ +  + +A
Sbjct: 301 SRLQGVPCPLKNFYLERA 318

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  464 bits (1194), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 205/306 (66%), Positives = 256/306 (83%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP I  Y+ GT+L VG HQV IIKYLTSGGFAQ+Y   +NPP+P +  ++ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           P+K  LNTLRAEV+AM+LLK   +VV YIDS+AA+++ ++G+YEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL EFE+L IM+QVTQG+ AMH+L PPLIHRDIKIENVLIS+N EYK+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           V GIIRPP+N++E ++VQQDI+KNTTAQYR PEM+D +RG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFE GG+ AIL  ++++P YP YS +LK LIR +L++ P  RPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NVPCPI 306
            +PCP+
Sbjct: 301 GIPCPL 306

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  458 bits (1179), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/314 (66%), Positives = 256/314 (81%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MN P+I TY  GT L+VG+H  +I+KY+ SGGFAQVYSA + P D  + ++  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           P+K  LN LRAEV+AM+LLK +++VV YIDSHAA+++L NG+YEVF+LME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL E+EIL IMSQVTQG+AAMHALQPPLIHRDIKIENVLISA+ EYK+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           V G IRPPRN QE ++VQ DILKNTTAQYRSPEMID +R   IDEKSDIWALGIFLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEKGGD AIL  +++F  +P YS++LK LI  +L Q P  RPN+ Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NVPCPINDIQVVQA 314
            V  P+ +  +++A
Sbjct: 301 GVSSPMRNFYLLRA 314

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  460 bits (1183), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 223/408 (54%), Positives = 290/408 (71%), Gaps = 19/408 (4%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQ    ++  GT LTVGSH+V+++KYLTSGGFAQ+Y   +  PD      VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD-VACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAM+LL+ N+++VSYIDSHA+K++L+NGSYEV +LMEYC RGGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQ+RL EFE+L+IM+QV QG+ AMHALQPPLIHRDIKIENVLI+ N + K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPP+N+ ELSYVQ DILKNTTAQYR+PEMID +RG  +DEKSDIWALG+FLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G++AIL   F+FP YP YS +LK LI  +L ++P HRPN  Q+L+ +  +Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNS---------PTTMENTMPNATF 351
             PCP+ +  + ++    +     H  S +Q ++++N          P    + +P+ T 
Sbjct: 300 GQPCPVKNFYLERSLKQQIPSQLRH--SVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTM 357

Query: 352 QISMADNTTTAQMHPNRKPSQIAYDASFSNSAK---GSQPLFDKSQNM 396
            +       T    P  +P+++  D +   S      +   +DK+QN 
Sbjct: 358 NMGY----VTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNF 401

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  456 bits (1172), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 264/336 (78%), Gaps = 4/336 (1%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQ        G  LTVGSH+V+II+YLTSGGFAQ+YS  +  P P    S+ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM++LK +R+VVSYIDSHAAK+  H+G+YEV++LMEYC RGGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MN+RLQ RL EFE+L+IMS V QG+ AMHAL PPLIHRDIKIENVLIS + ++K+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           V G+IRPP+N+ E +YVQ DILKNTTAQYR+PEMID +R LP+DEKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           Y+TTPFEK G+ AIL  KF+FP YP Y+++LK LI  +L + P  RPN+ Q+L+ +S +Q
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSL 336
            VPCP+ +  + +    H   T +H  SA+Q  L L
Sbjct: 300 GVPCPLPNFYLERM--KHGACTPVHH-SASQPALPL 332

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  440 bits (1131), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/311 (63%), Positives = 251/311 (80%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MN P I  Y  GT +TVGSH V I+KYLTSGG+AQ+YSA I P D    +++A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAM+ LK+++Y+VSYIDSHAAK+   +G+YEVF++MEYC RGGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QGVAAMH LQPPLIHRDIKIENVLIS +++YKLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           V G IRPP+  +EL+YV+ DI+ +TTAQYR+PEM+D  +G  +++KSDIWALG+FLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFE+ G+  IL+G  EFP YP+YS+ +K LI  +L ++P HRPN++Q+++ +S + 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NVPCPINDIQV 311
           NV CPI +I V
Sbjct: 301 NVNCPIPNIHV 311

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  434 bits (1115), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 247/314 (78%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQ Q+  Y   T +TVGSH  +I+KYL SGG+AQVYSA + P D    +++ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PDK SLN LRAEVDA+++L+N +YVVSYIDSHA+K   H GSYEVFVLMEYC  G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           +NTRL+NRL E EIL IM+QV  GVA MH LQP LIHRDIKIEN+LIS N EYK+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240
           VCG+IRPPR+ +E+ Y+Q DI+KNTTAQYRSPEM+D  +G  I+EKSDIWALG+FL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           YYTTPFEK G+ AIL  +F++P YP YS+ LK +IR +L  DP  RPN+ QL++ +S +Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NVPCPINDIQVVQA 314
            +  P+ +  + +A
Sbjct: 301 GIVPPMKNFYLSRA 314

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  446 bits (1147), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 201/315 (63%), Positives = 246/315 (78%), Gaps = 2/315 (0%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSN--SSVACLKRV 58
           MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYS  +       N   ++ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLI 118
           IVPDK  LNTLRAEVDAM+LLK N+Y+VSYIDSHA ++ L  G YEVF+LMEYC RGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDF 178
           DF+NTRL +RL EFEIL+IMS V QGVAAMH LQPPLIHRDIKIENVLIS N +YK+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYK 238
           GS C ++RPP+  QE +++  DI+ NTTAQYRSPEMID + G PIDEKSDIWALG+FLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 LCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISI 298
           LCYYTTPFEK G+ AIL+ KF+FP YP YS+ ++ +I  +L +DP  RPN+ Q+L+++S 
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 299 MQNVPCPINDIQVVQ 313
           +Q VPCPI +  + +
Sbjct: 301 LQGVPCPIENFMLTR 315

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  411 bits (1057), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 244/312 (78%), Gaps = 6/312 (1%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           MNQP I  Y  G  + VGSHQ +I+KYLTSGGFAQ+YS  I+P D ++NS++ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           P+K  LN LR EVDAM+LLKNNR+VVSYIDS+AAK+   NGSYEVF+LMEYCERG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           MNT+L+ RL E E+L IM+QV QG+AAMH L PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKS---DIWALGIFLY 237
           VCGIIRPPRN QEL YVQ D++KNTTAQYRSPEMID  +G PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRIS 297
            L +YT  F +  ++AIL+G++++P YP YS++LK ++R +L   P  RPN+ QLL+ IS
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 IMQNVPCPINDI 309
            +QN+PCPI++ 
Sbjct: 298 KIQNIPCPIDNF 309

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  390 bits (1001), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 236/320 (73%), Gaps = 1/320 (0%)

Query: 9   YNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNT 68
           Y  GT+L V SH+V I  YLTSGGFAQVY+A I     +    + CLKRVIVP+K SLN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128
           LRAEVDAM++LKNN+Y+VSYIDSHA +      SY V +LMEYC   GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPP 188
           L E EIL+IM+ V+QGV  MH LQPPL+HRDIKIENVL+S +  +KLCDFGSV G++R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 RNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            +S+E  Y+Q DILKNTTAQYRSPEM++   G PI+EKSDIWALGI LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 GGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPIND 308
            G  AI+ GKF +P YP Y++ LK +IR +L  +P  RPN+ QLL+ +  +Q+   P+ +
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 IQVVQAPSS-HLNLTELHQL 327
             V +A SS  ++ T+ H++
Sbjct: 309 FYVQRAMSSLQMDTTQPHRI 328

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  311 bits (796), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 159/321 (49%), Positives = 205/321 (63%), Gaps = 22/321 (6%)

Query: 9   YNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA--------LINPPDPHSNSSV-------- 52
           +N G  + VG H+VEIIKYL  GGFAQ+YS           N PD   +S++        
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 53  -----ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFV 107
                ACLKRV+VPD+  LN LR EV+ MR LK    +V Y DS+A++    N  +EV +
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLI 167
           LME C    L+D+MN RL  +L E EIL+IM  VT G++ MH LQ PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 SANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKS 227
            ++N +KLCDFGS         + QE++ + Q+I  +TT QYRSPEMID +R LPIDEKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 228 DIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRP 287
           DIWALG+FLYKL +YTTPFE  G  AIL  K+E P   NYS +L  LI  +L ++P  RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNLRP 317

Query: 288 NVYQLLKRISIMQNVPCPIND 308
           N+YQ++ ++ I   +  PI D
Sbjct: 318 NIYQVMHQVCITIGIEPPIKD 338

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  301 bits (770), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 204/312 (65%), Gaps = 10/312 (3%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPDPHS-----NSSVACLK 56
           + +Y  GT + VG H+VE++KYL  GGFA++Y       ++  DP+      N    CLK
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGG 116
           RV+V D   LN +R EV+ MR LK    VV Y DS+A++ +     YEV +LME C    
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 117 LIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLC 176
           L+D+MN RL  +L E EIL+IM  VT  VA MH L  PLIHRDIKIENVL+ + N +KLC
Sbjct: 146 LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 177 DFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFL 236
           DFGS    +    + Q+++ + Q+I  +TT QYRSPEMID +R LP++EKSDIWALG+FL
Sbjct: 206 DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 237 YKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRI 296
           YKL +YTTPFE+ G  AIL  K+EFPL  NYS +L  LI  +L ++P  RPN+YQ+L +I
Sbjct: 266 YKLMFYTTPFERTGQFAILHSKYEFPLN-NYSSKLINLIIVMLAENPNLRPNIYQVLNQI 324

Query: 297 SIMQNVPCPIND 308
             +  +  P++D
Sbjct: 325 CYISGIKNPMDD 336

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  301 bits (772), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 205/321 (63%), Gaps = 20/321 (6%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVY----SALINPPDP-----------HSNS 50
           I  ++ G  + VGSH VEI+KYLT GGFAQ+Y    +  +N  D                
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 51  SVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLME 110
            + CLKRV+V D+  L+ ++ EV+ M+ L+    VV Y DS+A +    NG +EVF+LME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISAN 170
           YC    L+D+MN RL  +L E EIL IM  +T GV+ +H L  PLIHRDIKIENVL+  N
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 NEYKLCDFGSVCGIIRPP--RNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSD 228
           N +KLCDFGS    I PP    +Q++S +  DI  +TT QYRSPEMID FR LP++EK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPN 288
           IWALG+FLYKL +YTTPFE  G  AIL  K+E P   +YSE+L  LI  +L ++P  RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIP-QSHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 VYQLLKRISIMQNVPCPINDI 309
           +YQ+L  I  + NV  PI DI
Sbjct: 323 IYQVLSEICSILNVEVPIPDI 343

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  302 bits (773), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 162/332 (48%), Positives = 208/332 (62%), Gaps = 31/332 (9%)

Query: 6   IGT--YNVGTQLTVGSHQVEIIKYLTSGGFAQVY----------------------SALI 41
           +GT  +  GTQ+ VGSH+VEIIKY+  GGFAQ+Y                      S   
Sbjct: 19  VGTEKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDR 78

Query: 42  NPPDPH--SNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLH 99
             P+P       +ACLKRV+V D+  LN +R EV+ M+ LK    VV Y DS+A++   H
Sbjct: 79  QAPNPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRR--H 136

Query: 100 NGS--YEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIH 157
           NG+  +EV +LME C    L+D+MN RL  +L E EIL+IM  +T  V+ MH L+ PL+H
Sbjct: 137 NGASGFEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLH 196

Query: 158 RDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDT 217
           RDIKIENVL+ A N +KLCDFGS    +      Q+++ + Q+I  +TT QYRSPEMID 
Sbjct: 197 RDIKIENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDL 256

Query: 218 FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRD 277
           +R LPIDEKSDIWALGIFLYKL ++ TPFE  G  AIL  K+EFP   NYS +L  LI  
Sbjct: 257 YRCLPIDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIII 315

Query: 278 ILVQDPRHRPNVYQLLKRISIMQNVPCPINDI 309
           +L ++P  RPN+YQ+L  I  M NV  PI DI
Sbjct: 316 MLAENPNLRPNIYQVLDNICSMMNVEVPIEDI 347

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  296 bits (759), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 149/305 (48%), Positives = 196/305 (64%), Gaps = 9/305 (2%)

Query: 12  GTQLTVGSHQVEIIKYLTSGGFAQVY--------SALINPPDPHSNSSVACLKRVIVPDK 63
           GT + VGSH+VEI+KYL  GGFA +Y        + L  P        +ACLKRV+V D+
Sbjct: 35  GTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE 94

Query: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNT 123
             LN LR EV+ M+ LKN+  +V Y DS+A++    +  YEV +LME C    L+D+MN 
Sbjct: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154

Query: 124 RLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCG 183
           RL  +L E E+L+IM  VT+ VA MH L  PLIHRDIKIENVL+ + N +KLCDFGS   
Sbjct: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214

Query: 184 IIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYT 243
                   Q+++ +  +I  +TT QYR+PEMID +R LPIDEKSDIWALGIFLYKL +YT
Sbjct: 215 CFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYT 274

Query: 244 TPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVP 303
           TPFE  G  AIL  K++ P   NYS +L  LI  +L ++P  RPN+YQ++ ++  +  V 
Sbjct: 275 TPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVD 333

Query: 304 CPIND 308
            P  D
Sbjct: 334 VPFED 338

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  299 bits (765), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 211/319 (66%), Gaps = 13/319 (4%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPDPHSNSS----- 51
           +N P    Y  G  ++VG+H+VEI+ YL  GGFAQ+Y       +N  +   + S     
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 52  -VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLME 110
            +ACLKRVIV D+  LN +R EV+ M+ LK++  +V Y DS+A++       +EV +LME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISAN 170
            C    L+D+MN RL+ +L E EIL+IM  V+ G++ MH L  PLIHRDIKIENVL+ AN
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 NEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIW 230
           N +KLCD GS      P  ++Q+++ + Q+I  +TT QYR+PEMID +R LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPN-YSEQLKGLIRDILVQDPRHRPNV 289
           ALGIFLYKL +YTTPFE  G +AIL  K++FP  PN YS ++  LI  +L ++P  RPN+
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFP--PNKYSSKIINLIIIMLAENPNLRPNI 309

Query: 290 YQLLKRISIMQNVPCPIND 308
           +Q++  I  + N+P PI D
Sbjct: 310 FQVVYHICSIMNLPVPIED 328

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  299 bits (766), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 207/325 (63%), Gaps = 16/325 (4%)

Query: 3   QPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LINPPDPHSNS---------SV 52
           +P    Y  GTQ+ VG+H+VEIIKY+  GGFAQ+Y+   I   +   N+          V
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG--SYEVFVLME 110
           ACLKRV+V D+  LN +R EV+ M+ L+    +V Y DS+A++   HNG   +EV +LME
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRR--HNGFPGFEVLLLME 133

Query: 111 YCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISAN 170
            C    L+D+MN RL  +L E EIL+IM  VT  V+ MH L  PL+HRDIKIENVL+ A 
Sbjct: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193

Query: 171 NEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIW 230
           N +KLCDFGS           Q+++ + Q+I  +TT QYRSPEMID +R LPIDEKSDIW
Sbjct: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253

Query: 231 ALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVY 290
           ALGIFLYKL ++TTPFE  G  AIL  K+EFP   NYS +L  LI  +L ++P  RPN+Y
Sbjct: 254 ALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIY 312

Query: 291 QLLKRISIMQNVPCPINDIQVVQAP 315
           Q+L  I  +  +  PI D Q  + P
Sbjct: 313 QVLHNICSISGMKVPIED-QYAEGP 336

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  298 bits (762), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 199/316 (62%), Gaps = 15/316 (4%)

Query: 7   GTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA--------LINPPDPHSN------SSV 52
           G Y  GT + VGSH+VE+IKY+  GGFAQ+Y+           + P  + N        +
Sbjct: 97  GNYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDI 156

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYC 112
           ACLKRV+V D   LN +R EV+ M+ L+    VV Y DS+A+        YEV +LME+C
Sbjct: 157 ACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFC 216

Query: 113 ERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNE 172
               L+D+MN RL  RL E EI++IM   T G+A +H L+ PLIHRDIKIENVL+   N 
Sbjct: 217 PNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENN 276

Query: 173 YKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWAL 232
           +KLCDFGS         N ++++   Q+I  NTT QYRSPEMID +R  PIDEKSDIWAL
Sbjct: 277 FKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWAL 336

Query: 233 GIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           G+FLYKL ++TTPFE+ G  AIL  K+EFP   NYS +L  LI  +L ++P  RPN+YQ+
Sbjct: 337 GVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQV 395

Query: 293 LKRISIMQNVPCPIND 308
           L+ +  +     P+ND
Sbjct: 396 LQYLCSINGWKVPLND 411

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  298 bits (762), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 196/307 (63%), Gaps = 11/307 (3%)

Query: 12  GTQLTVGSHQVEIIKYLTSGGFAQVY--SALINPPDPHSNSS--------VACLKRVIVP 61
           G+ + VG+ +VEI+KYLT GGFAQ+Y    L N  +  SN+S        +ACLKRV+V 
Sbjct: 28  GSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRVLVQ 87

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           D+  LN +R EV+ M+LLK    +V Y DS+A++       +EV +LME C    L+DFM
Sbjct: 88  DENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLLDFM 147

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
           N RL  +L E EIL IM  VT  VA MH L PPLIHRDIKIENVL+ + N +KL DFGS 
Sbjct: 148 NQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADFGST 207

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCY 241
                     Q+++ + QDI  +TT QYRSPEMID ++ LPIDEKSDIWALGIFLYKL +
Sbjct: 208 SKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYKLLF 267

Query: 242 YTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQN 301
           Y TPFE  G  AIL  K++FP   NYS +L  LI  +L ++P  RPN+YQ+L  I  +  
Sbjct: 268 YITPFEMTGQFAILHSKYDFP-QTNYSSRLINLIIIMLSENPNLRPNIYQVLHEICSISG 326

Query: 302 VPCPIND 308
               I D
Sbjct: 327 TRLEITD 333

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  294 bits (753), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 203/324 (62%), Gaps = 24/324 (7%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI-------------NPPDPHSNSSV 52
           +  Y  G  + VGSH+VEI++Y+  GGFAQ+YS                   D      +
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGS--------YE 104
           ACLKRVIV D+  LN LR EV+ M+ L     +V Y DS+A++  L NG+        +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           V +LME C    L+D+MN RL  +L E EIL++M  V+  +A MH L+ PLIHRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPID 224
           VL+   N +KLCDFGS           ++++Y+ Q+I  +TT QYRSPEMID +R LPID
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPR 284
           EKSDIWALGIFLYKL ++TTPFE+ G  AIL  KFEFP   NYS +L  LI  +L ++P 
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPN 311

Query: 285 HRPNVYQLLKRISIMQNVPCPIND 308
            RPN+YQ+L +I  ++ VP PI D
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIAD 335

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  293 bits (750), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 195/314 (62%), Gaps = 10/314 (3%)

Query: 4   PQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------NPPDPHSNSSVAC 54
           P +     G+Q+ VG+H+VEI+KYL  GGFA +Y              P         AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV  M+ L     +V Y DSHA+++      +EV +LME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
             L+D+MN RL  +L E EIL+IM  VT+ +A MH L  PLIHRD+KIENVL+  +N +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGI 234
           LCDFGS    +      QE++ +  +I  +TT QYRSPEMID +R LPIDEKSDIWALGI
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
           FLYKL +YTTPFE  G  AIL  K+EFP+  NYS +L  LI  +L ++P  RPN+YQ++ 
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFPIN-NYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 RISIMQNVPCPIND 308
            +  +  V  PI D
Sbjct: 323 NLCSIMKVENPIED 336

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  292 bits (748), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 197/314 (62%), Gaps = 10/314 (3%)

Query: 4   PQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALI---------NPPDPHSNSSVAC 54
           P +     G+Q+ VG+H+VEI+KYL  GGFA +Y              P        +AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV  M+ L     +V Y DSHA++A   +  +EV +LME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
             L+D+MN RL  +L E EIL+IM  VT+ +A MH L  PLIHRD+KIENVL+ AN+ +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGI 234
           LCDFGS           QE++ +  +I  +TT QYRSPEMID +R LPI+EKSDIWALGI
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
           FLYKL +YTTPFE  G  AIL  K+EFP+  NYS +L  LI  +L ++P  RPN+YQ++ 
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 295 RISIMQNVPCPIND 308
            +  +  V  P+ D
Sbjct: 365 NLCSILKVKNPLED 378

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  291 bits (744), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 150/321 (46%), Positives = 201/321 (62%), Gaps = 18/321 (5%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPDPHSNSS---------- 51
           I  +  G  L VG+H+VEI+ YLT GGFAQ+Y      ++N  D   N S          
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 52  ---VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVL 108
              VACLKRV+V D+  LN +R EV+ M+ L+    +V Y DS+A ++   N  YEV +L
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLIS 168
           ME C    L+++MN RL  +L E E+L+IM  VT GVA MH L+ PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 ANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSD 228
           +NN +KLCDFGS           Q+++ + Q++  +TT QYRSPEMID +R LPI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPN 288
           IWALG+FLYKL +YTTPFE  G  A+L  KF+ P    YS ++  L+  +L ++   RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPN 326

Query: 289 VYQLLKRISIMQNVPCPINDI 309
           +YQ++  I  +  V  PI DI
Sbjct: 327 IYQVMHYICQLIQVDTPILDI 347

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  290 bits (743), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 206/325 (63%), Gaps = 27/325 (8%)

Query: 3   QPQIG-TYNVGTQLTVGSHQVEIIKYLTSGGFAQVY----------------SALINPPD 45
           QPQI   +  G  +TVGSH+VE++ YL  GGFAQ+Y                 ++  P  
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 46  PHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG---- 101
           P    S ACLKRV+V D+  LN +R+EV+ M+ L+    +V Y DS+A++   ++G    
Sbjct: 149 P---GSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQ 205

Query: 102 SYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIK 161
            +EV +LME C    L+D+MN RL  +L E EI +IM  +T  VA MH L  PLIHRDIK
Sbjct: 206 GFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIK 265

Query: 162 IENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGL 221
           IENVL+ ANN +KLCDFGS         + Q+++ + QD+  +TT QYRSPEMID F+ +
Sbjct: 266 IENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYI 325

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPN-YSEQLKGLIRDILV 280
           PI+EKSDIWALG+FLYKL ++TTPFE+ G  A+L  KFEFP  PN YS +L  LI  +L 
Sbjct: 326 PINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP--PNSYSSKLINLIIVMLA 383

Query: 281 QDPRHRPNVYQLLKRISIMQNVPCP 305
           ++P  RPN+YQ+L  +S + N   P
Sbjct: 384 ENPSLRPNIYQVLYYLSEVTNREVP 408

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  290 bits (742), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 167/397 (42%), Positives = 228/397 (57%), Gaps = 27/397 (6%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPD-----PHSNSS 51
           M  P +  Y  G  + VG+H+VEI+ YL  GGFAQ+Y       +N  D     P     
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEY 111
           +ACLKRV+V D+  LN +R EV+ M+ LK    VV Y DS+A++       +EV +LME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANN 171
           C    L+D+MN RL  +L E EI++IM  V   ++ MH L  PLIHRDIKIENVL+ A +
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWA 231
            +KL DFGS           Q+++ + Q+I  +TT QYRSPEMID +R LPI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQ 291
           LGIFLYKL ++TTPFE  G  AIL  K+EFP+   YS +L  LI  +L ++P  RPN+YQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKRISIMQNVPCPINDIQVVQAP--------------SSHLNLTELHQLSATQNILSLN 337
           +L  +  + NV  PI D +  + P              +  L + +L Q    QN    +
Sbjct: 313 VLCHLCDILNVEVPIED-KYAEGPYNFARYTQFQNKLQNVQLQMYQLQQKKIVQNSKLSD 371

Query: 338 SPTTMENTMPNATFQIS--MADNTTTAQMHPNRKPSQ 372
           S   + N M  ++F+IS  +  N +   M  +RK SQ
Sbjct: 372 SEENLLNDMFLSSFEISSKLPMNASDGPMTVSRKASQ 408

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  290 bits (741), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 198/317 (62%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPD-----PHSNSS 51
           M  P +  +  G  + VG+H+VE+I YL  GGFAQ+Y       +N  D     P     
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ M+ LK    VV Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANN 171
           C    L+D+MN RL  +L E EI++IM  V   ++ MH L  PLIHRDIKIENVL+ ANN
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWA 231
            +KL DFGS           Q+++ + Q+I  +TT QYRSPEMID +R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQ 291
           LGIFLYKL ++TTPFE  G  AIL  K+EFP+   YS +L  LI  +L ++P  RPN+YQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKRISIMQNVPCPIND 308
           +L  +  + N+  PI D
Sbjct: 313 VLYHLCEILNIEVPIED 329

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  286 bits (732), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 148/306 (48%), Positives = 194/306 (63%), Gaps = 9/306 (2%)

Query: 11  VGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPDPHSN----SSVACLKRVIVPD 62
            G+ L VG H+VEII+YL  GGFA +Y        N  D H +      +ACLKRV V D
Sbjct: 30  AGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVND 89

Query: 63  KPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMN 122
           +  LN LR EV+ M+ LK    VV Y DS+A++       +EV +LME C  G L+D+MN
Sbjct: 90  ENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMN 149

Query: 123 TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVC 182
            RL  +L E E+L+IM  +T+G++ MH L+ PLIHRDIKIENVL+ + N +KLCDFGS  
Sbjct: 150 QRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTS 209

Query: 183 GIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYY 242
             +      QE++ +  +I  +TT QYRSPEMID +R L I+EKSDIWALGIFLYKL +Y
Sbjct: 210 TCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFY 269

Query: 243 TTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNV 302
           TTPFE  G  AIL  K++ P   N+S +L  LI  +L ++P  RPN+YQ+L  I  +   
Sbjct: 270 TTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMEC 328

Query: 303 PCPIND 308
             PI D
Sbjct: 329 DVPIED 334

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  290 bits (741), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 151/317 (47%), Positives = 197/317 (62%), Gaps = 10/317 (3%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPD-----PHSNSS 51
           M  P +  Y  G  + VG+H+VEI+ YL  GGFAQ+Y+      +N  D     P     
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ M+ LK    VV Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANN 171
           C    L+D+MN RL  +L E EI++IM  V   ++ MH L  PLIHRDIKIENVL+ A N
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWA 231
            +KL DFGS           Q+++ + Q+I  +TT QYRSPEMID +R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQ 291
           LGIFLYKL ++TTPFE  G  AIL  K+EFP+   YS +L  LI  +L ++P  RPN+YQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKRISIMQNVPCPIND 308
           +L  I  + N   PI D
Sbjct: 313 VLYHICDILNAEVPIED 329

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  288 bits (736), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 151/315 (47%), Positives = 197/315 (62%), Gaps = 12/315 (3%)

Query: 4   PQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPD-----PHSNSSVAC 54
           P +  +  G  + VG+H+VE++ YL  GGFAQ+Y       +N  +     P     VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCER 114
           LKRV+V D+  L+ +R EV+ M+ L   + +V Y DS+A +    N  +EV +LME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
             L+D+MN RL  +L E EIL+IM  V+  V+ MH L+ PLIHRDIKIENVL+ A N +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGI 234
           LCDFGS           QE++ + Q+I  +TT QYR PEMID +R LPI+EKSDIWALGI
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKGGDLAILSGKFEFPLYPN-YSEQLKGLIRDILVQDPRHRPNVYQLL 293
           FLYKL ++ TPFE  G  AIL  K+EFP  PN YS QL  LI  +L ++P  RPN+YQ+L
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFP--PNHYSSQLINLIIIMLAENPFVRPNIYQVL 314

Query: 294 KRISIMQNVPCPIND 308
             I  M  V  PI D
Sbjct: 315 NHICTMIGVEVPIED 329

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  288 bits (736), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 198/323 (61%), Gaps = 22/323 (6%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYS---------------ALINPPD 45
           + +P +  Y  GT + VG+ QVEII ++  GGFAQ+YS               A + P D
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 46  PHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEV 105
                 +ACLKRV+VPD+  L+ +R EV+ M+ L+  + ++ Y DS+A++       YEV
Sbjct: 74  ------IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEV 127

Query: 106 FVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENV 165
            +LME C    L+D+MN RL  RL E EIL++M   T  ++ MH L  PLIHRDIKIENV
Sbjct: 128 LLLMELCPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENV 187

Query: 166 LISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDE 225
           L+ A N +KLCDFGS           Q+++ + Q+I  NTT QYRSPEMID +R LPI+E
Sbjct: 188 LVDAQNNFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINE 247

Query: 226 KSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRH 285
           KSDIWALGIFLYKL ++ TPFE  G  +IL  K+EFP    YS +L  LI  +L ++P  
Sbjct: 248 KSDIWALGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYV 306

Query: 286 RPNVYQLLKRISIMQNVPCPIND 308
           RPN+YQ++  I  +     PI D
Sbjct: 307 RPNIYQVMHHICSVIGCEVPIED 329

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  286 bits (731), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 158/345 (45%), Positives = 207/345 (60%), Gaps = 33/345 (9%)

Query: 2   NQP-QIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPDPHSN------- 49
           N+P  I  Y  GT LTVG  ++EI+KYLT GGFAQ+Y+      +N  D           
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 50  ----SSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG---- 101
                 VACLKRV+VPD+  L+ +R EVD M+ L N   +V Y DS+A+K   ++     
Sbjct: 92  NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTT 151

Query: 102 -----------SYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
                       +E+ +LMEYC    L+DFMN RL  +L E EIL+ M+ +T  V  MH 
Sbjct: 152 NNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHY 211

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
           L  PLIHRDIKIENVL+ +NN +KL DFGS   I  P    Q+++ + +DI  NTT QYR
Sbjct: 212 LAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYR 271

Query: 211 SPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQ 270
           SPEMID ++ LPIDEKSDIWALG+ LYKL +YTTPFE  G  AIL  K+EFP   NYS +
Sbjct: 272 SPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSK 330

Query: 271 LKGLIRDILVQDPRHRPNVYQLLKRI-SIMQNVPCPINDIQVVQA 314
              LI  +L ++P  RPN++Q+L  + SI   +    N++Q  Q 
Sbjct: 331 FINLIIIMLAENPNLRPNIFQVLYYLKSISNTMNSNNNEVQNTQV 375

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  281 bits (718), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 195/313 (62%), Gaps = 10/313 (3%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSAL---------INPPDPHSNSSVACLK 56
           I TY  G  + VG H+VEIIKYL  GGFA++Y A          IN         + CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGG 116
           RV+V D   LN +R EV  M+ L     +V   DS+A++       YEV +LME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLC 176
           L+D+MN RL  +L E EIL+IM  VT  VA MH L  PLIHRDIKIENVL+ + N +KLC
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFL 236
           DFGS    +      ++++ + Q++  +TT QYRSPEMID +R + I+EKSDIWALGIFL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRI 296
           YKL +Y TPFE+ G  AIL  K+EFP + +YS +L  LI  +L ++P  RPN+YQ+L  I
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SIMQNVPCPINDI 309
             + N+  PI+DI
Sbjct: 395 CKIINIKTPIDDI 407

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  285 bits (729), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 166/401 (41%), Positives = 226/401 (56%), Gaps = 35/401 (8%)

Query: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPD-----PHSNSS 51
           M  P +  Y  G  + VG+H+VE++ YL  GGFAQ+Y       +N  D     P     
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEY 111
           VACLKRV+V D+  LN +R EV+ M+ LK    +V Y DS+A++       +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANN 171
           C    L+D+MN RL  +L E EI++IM  V   ++ MH L   LIHRDIKIENVL+ A N
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWA 231
            +KL DFGS           Q+++ + Q+I  +TT QYRSPEMID +R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQ 291
           LG+FLYKL ++TTPFE  G  AIL  K+EFP+   YS +L  LI  +L ++P  RPN+YQ
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLKRISIMQNVPCPIND------------------IQVVQAPSSHLNLTELHQLSATQNI 333
           +L  +  + NV  PI D                  +Q VQ     L + +L Q    QN 
Sbjct: 313 VLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQ-----LQMYQLQQKKIMQNN 367

Query: 334 LSLNSPTTMENTMPNATFQIS--MADNTTTAQMHPNRKPSQ 372
              +S   + N M  ++F+IS  +  N +      +R PSQ
Sbjct: 368 KLSDSEENLLNDMFLSSFEISSKLPMNASDGHAAVSRIPSQ 408

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  282 bits (721), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 195/313 (62%), Gaps = 21/313 (6%)

Query: 11  VGTQLTVGSHQVEIIKYLTSGGFAQVYSA--------------LINPPDPHSNSSVACLK 56
            G+ + VG HQVE+I+YL  GGFA +Y                ++ P D        CLK
Sbjct: 31  AGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGD------TVCLK 84

Query: 57  RVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGG 116
           RV V D+  LN LR EV+ M+ L+N   +V Y DS+A++       YEV +LME C  G 
Sbjct: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144

Query: 117 LIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLC 176
           L+D+MN RL  +L E E+L+IM  +T G++ MH  + PLIHRDIKIENVL+ A+N +KLC
Sbjct: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204

Query: 177 DFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFL 236
           DFGS    +    + QE++ +  +I  +TT QYRSPEMID +R LPI+EKSDIWALGIFL
Sbjct: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264

Query: 237 YKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRI 296
           YKL +YTTPFE  G  AIL  K+E P   ++S +L  L+  +L ++P  RPNVYQ++  I
Sbjct: 265 YKLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323

Query: 297 SIMQNVPCPINDI 309
             M      I+D+
Sbjct: 324 CSMMECEVKIDDL 336

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  278 bits (712), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 194/306 (63%), Gaps = 11/306 (3%)

Query: 13  TQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPDPHSNS------SVACLKRVIVPD 62
           TQ+ VG+H+ EI+++L  GGFA +Y      L N  D   +S       +ACLKRVIVPD
Sbjct: 33  TQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPD 92

Query: 63  KPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMN 122
           +  LN LR EV+ M+ L+ +  +V Y DS+A++    +  +E+ +LME C +  L+D+MN
Sbjct: 93  ENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN 152

Query: 123 TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVC 182
            +L  +L E EIL+IM  V+  +A MH L  PLIHRDIKIENVL+  ++ +KLCDFGS  
Sbjct: 153 NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212

Query: 183 GIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYY 242
                    Q+++ +  +I  +TT QYRSPEMID +R LPI+EKSDIWALGIFLYKL +Y
Sbjct: 213 MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272

Query: 243 TTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNV 302
           TTPFE  G  AIL  K+E P    YS +L  LI  +L ++P  RPN+YQ++  +  +   
Sbjct: 273 TTPFELTGQFAILHSKYEIP-QNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKC 331

Query: 303 PCPIND 308
             P  D
Sbjct: 332 DVPFTD 337

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  277 bits (709), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 196/314 (62%), Gaps = 12/314 (3%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LINPPDPHSN----------SSVAC 54
           I  Y  G  ++VG+HQV+I  YL  GGFAQ+Y    I+  +   N            +AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCER 114
           LKRV+V D+  LN +R EV+ M+LL+    +V Y DS+A +       YE+ +LME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
             L+D+MN RL+ +L+E EI++IM   T  V+ MH L  PLIH+DIK+EN+L+ +NN +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGI 234
           LCDFGS         +  +++ + Q+I  +TT QYRSPEMID +R LPI+E SDIWALG+
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
           FLYKL ++ TPFE+ G  +IL  KF+ P+  NY  +L  LI  +L ++   RPN+YQ++ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 RISIMQNVPCPIND 308
            I  + N P PI D
Sbjct: 331 EICSITNTPLPIED 344

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score =  106 bits (265), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 151/349 (43%), Gaps = 75/349 (21%)

Query: 18  GSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMR 77
           G H   I + L  GGF+ VY           N+ +  LK++  P       + +  +AMR
Sbjct: 25  GQHYA-IQRLLGEGGFSFVYLV-----QSRENNDLFALKKIHCP----FGNIESVSEAMR 74

Query: 78  LLKNNRYVVSYIDSHAAKAML---HNGSYEVFVLMEYCERGGLIDFMNTRLQN--RLHEF 132
            + + +   S   +H   + +    +GS  VF+L+ Y   G L+D +NT L +   + E 
Sbjct: 75  EVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGTTISEE 134

Query: 133 EILQIMSQVTQGVAAMH-------------ALQPPLIHRD-------------------- 159
           EI++I+  V +G+  MH             ++   L +RD                    
Sbjct: 135 EIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDSLELD 194

Query: 160 --------------------IKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQ 199
                               IK  N++ S++    +CD GS         +  +L   Q+
Sbjct: 195 VLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQE 254

Query: 200 DILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL------- 252
              ++ T  +RSPE+++      IDEK DIW+LG  LY +C+  +PFE+   L       
Sbjct: 255 WCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTY 314

Query: 253 AILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQN 301
           AI +GKF  P   NYS +L  +I+D +  D + RP++ +LL R+  +Q 
Sbjct: 315 AIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 96.7 bits (239), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 147/333 (44%), Gaps = 55/333 (16%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVP--DKPSLNTLRAE 72
           ++V  H+  I + L  GGF+ VY       +   N  +A LK++  P     S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLV-----ESRENGLMA-LKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQN--RLH 130
           VD  +  K+  Y+   IDS   +    +GS  V++L+ Y  +G L D +N  L +  ++ 
Sbjct: 73  VDNYQKFKSP-YIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EFEILQIMSQVTQGVAAMHALQPP-----------------------------------L 155
           E E++++   V +G+  +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 156 IHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI 215
            H DIK  N++IS+     + D GS         + Q L   Q+   ++ T  + +PE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----GGDL--AILSGKFEFPLYPNYS 268
           D      I EK D+W+ G  +Y +C+  +PFE+     G  +  ++ +GK+  P   NYS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 EQLKGLIRDILVQDPRHRPNVYQLLKRISIMQN 301
             L  +++  L  DP  RP+V +L+  +  +Q+
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 99.4 bits (246), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 130/265 (49%), Gaps = 41/265 (15%)

Query: 46  PHSNSSVACLKRVIVPDKPSLN---TLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGS 102
           P S++++A  K  I   K   N   T+  E++  +L+  ++ ++S ID     A +    
Sbjct: 70  PTSDATLALKKLPINDYKLKTNRRSTILKEIEIHKLVNGHKNIISMIDHFEIDATM---- 125

Query: 103 YEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKI 162
              ++++E C  G L D +  R +  L E+E  ++M Q+   V  +H  +  ++H D+K+
Sbjct: 126 ---YMVLELCGAGSLYDII-CRSKRSLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKL 179

Query: 163 ENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT-----TAQYRSPEMIDT 217
            N+LI ++N  +LCDFG               S+V  DI  N+     T  Y SPE+I  
Sbjct: 180 SNILIDSSNNLQLCDFGH--------------SFVSTDIDNNSINKFGTPNYLSPEIISN 225

Query: 218 F-----RGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYS 268
           F     + L   ++SDIW++GI LY + +  TPFE    +     I+  K+ F      S
Sbjct: 226 FILSDKKDLYFPKESDIWSIGIVLYAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVS 285

Query: 269 EQLKGLIRDILVQDPRHRPNVYQLL 293
            ++K LI++IL   P  R  + +++
Sbjct: 286 NKVKKLIQNILKIQPLERKTIVEIV 310

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 95.9 bits (237), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 87/337 (25%), Positives = 145/337 (43%), Gaps = 63/337 (18%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVD 74
           +++   +  I K L  GG + VY  L+   +      +  LK+   P      ++ +   
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVY--LVESKE----GELFALKKTRCP----FGSIGSISP 68

Query: 75  AMRLLKNNR-----YVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQN-- 127
           AM+ + N +     Y+   +DS   +    +GS  V+VL+ Y  +G L D +N  L +  
Sbjct: 69  AMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 128 RLHEFEILQIMSQVTQGVAAMHALQP---------------------------------- 153
           ++ E +IL++   + +G+  +H   P                                  
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 154 -PLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNS-QELSYVQQDILKNTTAQYRS 211
               HRD+K  N++IS  +   + D GS C   R   NS Q L   Q+    N T  Y +
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAA 245

Query: 212 PEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----GGDL--AILSGKFEFPLY 264
           PE++D      I EK DIW+ G  +Y +C+  +PFE+     G  +  AI +GK+  P  
Sbjct: 246 PEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRG 305

Query: 265 PNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQN 301
            +YS  L  LI   L  +P  RP+V +L+  +  +Q 
Sbjct: 306 TSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 132/302 (43%), Gaps = 58/302 (19%)

Query: 55  LKRVIVP--DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYC 112
           LKR+  P  +  S++    EVD  +  ++  Y+++ +DS   +    +GS  + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQSP-YIITLVDSQVVQE--KDGSKTLCILLPYF 129

Query: 113 ERGGLIDFMNTRL--QNRLHEFEILQIMSQVTQGVAAMH--------------------- 149
             G L D +N  L     + E E ++IM  + +G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 150 ----AL---QPPL----------------IHRDIKIENVLISANNEYKLCDFGSVCGIIR 186
               A      PL                +HRDI++ N+L S+     + D GS C    
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 PPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
                 +L+ +Q  +  N +  Y +PE+++      ID K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EK-----GGDL--AILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299
           E+     G  L  AI  GK+ FP    YSE L  +I+  L  DP  RP++ +LL  +  +
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 300 QN 301
           Q 
Sbjct: 370 QT 371

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 138/316 (43%), Gaps = 39/316 (12%)

Query: 28  LTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAE---VDAMRLLKNNRY 84
           L  GGFA+ +         H    V       +  K S+ T R +   +  +++ +N RY
Sbjct: 99  LGEGGFARCF---------HIKDDVGISFACKIVSKKSIKTERTKFKLLSEIQIHQNLRY 149

Query: 85  VVSYIDSHAAKAM-LHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQ 143
                 SH  K M        V++L+E C  G L+D +  R    L E E+  + +QV  
Sbjct: 150 ------SHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCG 201

Query: 144 GVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILK 203
            +  MH+    +IHRD+K+ NV    N   K+ DFG    +     N  E  Y       
Sbjct: 202 AINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG--- 252

Query: 204 NTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGK----- 258
             T  Y +PE+I + + +    ++DIW+LGI +Y +     PF+   D+  +  K     
Sbjct: 253 --TPNYIAPEVILS-KQIGHSFEADIWSLGIMIYAMVLGKPPFQ-AKDVTTIYEKIKLCQ 308

Query: 259 FEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSH 318
           +EFP     +  +K LI+D+LV DP  RP +  +LK      + P  +      + P   
Sbjct: 309 YEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKYNWFKHSFPPKLPSTIFTEVPLYF 368

Query: 319 LNLTELHQLSATQNIL 334
           + L+ L+ L   +N L
Sbjct: 369 IELSTLNSLKHFKNCL 384

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 133/282 (47%), Gaps = 33/282 (11%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S Q  + + +  G +  VY A+    + H++  VA +K V+  +   LN + AE+  ++ 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEVVYENDEELNDIMAEISLLKN 76

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           L +N  +V Y   H         SYE+++L+EYC  G L   + +R    L E E    +
Sbjct: 77  LNHNN-IVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYV 127

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
           +Q   G+  +H     +IHRDIK  N+L+SA+N  KL DFG V  I+    NS  L+   
Sbjct: 128 TQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG 180

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGK 258
                  T  + +PE++   RG      SDIW+LG  + ++     P+    D  I    
Sbjct: 181 -------TLNWMAPEILGN-RG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 259 FEFPLYP--NYSEQLKGLIRDILVQDPRHRPNVYQLLKRISI 298
                YP  ++SE LK  +    V++   RP   QLLK + I
Sbjct: 231 ENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWI 272

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 133/282 (47%), Gaps = 33/282 (11%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S Q  + + +  G +  VY A+    + H++  VA +K ++  +   LN + AE+  ++ 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYENDEELNDIMAEISLLKN 76

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           L N+  +V Y   H         SYE+++L+EYC  G L   + +R    L E E    +
Sbjct: 77  L-NHHNIVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYV 127

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
           +Q   G+  +H     +IHRDIK  N+L+SA+N  KL DFG V  I+    NS  L+   
Sbjct: 128 TQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG 180

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGK 258
                  T  + +PE++   RG      SDIW+LG  + ++     P+    D  I    
Sbjct: 181 -------TLNWMAPEILGN-RG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 259 FEFPLYP--NYSEQLKGLIRDILVQDPRHRPNVYQLLKRISI 298
                YP  ++SE LK  +    V++   RP   QLLK + I
Sbjct: 231 ENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHVWI 272

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 156/346 (45%), Gaps = 51/346 (14%)

Query: 5   QIGTYNVGTQLTVGS-HQVEIIKYLTSGGFA--QVYSALINPPDPHSNSSVACLKRVIVP 61
           QIG++ +G  L +GS  +V++    T+G  A  +V S  I       +S+V  +     P
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI-----FQDSNVTSMVDNTTP 68

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  M+LL N+  V+   D     + L       ++++EY E+G L + +
Sbjct: 69  DALPYGIER-EIVIMKLL-NHANVLRLYDVWETNSNL-------YMVLEYAEKGELFNLL 119

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
             R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 120 VER--GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDTKYNIKIADFGMA 175

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIFLY 237
                            +D L  T+     Y +PE++    G+P     SD+W+ G+ LY
Sbjct: 176 A-------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILY 219

Query: 238 KLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQ 291
            L     PF E+ G+     L + +G+FE P     S++ + LI  ILV +P  R     
Sbjct: 220 ALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARD 279

Query: 292 LLKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLN 337
           +LK   ++Q  P   +   +   P      T LH L+ T + +  N
Sbjct: 280 ILKH-PLLQKYPSIKDSKSIRNLPRED---TYLHPLAETNSAIDEN 321

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 135/294 (45%), Gaps = 66/294 (22%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVP--DKPSLNTLRAEVD 74
           VG+++  I+K +  G F +VY AL  P            K+V++   DK   N +R    
Sbjct: 36  VGNYK--ILKQIGEGSFGKVYLALHKP----------THKKVVLKSSDKTDPNVVR---- 79

Query: 75  AMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEI 134
              +  + ++   YI       +      +V++++EYC    L D++ ++   R+   E 
Sbjct: 80  --EIFYHRQFDFPYITKLYEVIITET---KVWMVIEYCPNKELYDYLLSK--KRISLDES 132

Query: 135 LQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQEL 194
            +I +Q+   V   H+L    +HRD+K+EN+L+  +N  KL DFG               
Sbjct: 133 ARIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFG--------------- 175

Query: 195 SYVQQDILKNT-------TAQYRSPEMI--DTFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
               +D  KNT       T  Y +PE++  + + G  I    DIWALGI LY +   T P
Sbjct: 176 --FTRDFSKNTQLETICGTTVYMAPELLRREKYDGYKI----DIWALGILLYTIINGTMP 229

Query: 246 FE----KGGDLAILSGKFEFPLYPN--YSEQLKGLIRDILVQDPRHRPNVYQLL 293
           F+    K  +L I+S     P Y N  +++    L+  +L +DP  RP + Q+L
Sbjct: 230 FDEDDPKKTELKIISAS---PDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 85/339 (25%), Positives = 144/339 (42%), Gaps = 61/339 (17%)

Query: 13  TQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVAC-----LKRVIVPDKPSLN 67
           T + V   + +I + L  GG + VY   +        + VA      LK++I P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRL-- 125
               E++  +  ++  YV+  IDS   +    +GS  +++++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLHEFEILQIMSQVTQGVAAMH---------------------------------ALQ 152
              + E E ++IM  V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDI 201
             ++           HRDI   N+L S++    + D GS         N  +L  +Q+ +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----GGDL--AI 254
             N T  Y +PE++       +D K DIW+LG   Y L +  +PFE+     G  +  AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
            +GK+ FP    +SE L  +I+  +  DP  RP   QLL
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 89/322 (27%), Positives = 149/322 (46%), Gaps = 50/322 (15%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGG----FAQVYSALINPPDPHSNSSVACLKRVIVP 61
           +G + +G  L +GS     + Y +S G       +  A+ N  + ++N+S + L   + P
Sbjct: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFN--NDNANASDSAL---LTP 71

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  M+LL N+  V+   D     + L       ++++EY E+G L + +
Sbjct: 72  DSLPYGIER-EIIIMKLL-NHPNVLRLYDVWETDSNL-------YMVLEYAEKGELFNLL 122

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
             R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 123 VER--GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA 178

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIFLY 237
                            +D L  T+     Y +PE+I    GLP    ++D+W+ GI L+
Sbjct: 179 A-------------LETEDKLLETSCGSPHYAAPEIIS---GLPYHGLETDVWSCGIILF 222

Query: 238 KLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQ 291
            L     PF E+ G+     L + SG+FE P     S + + LI  IL  DP+ R    +
Sbjct: 223 ALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTRE 282

Query: 292 LLKRISIMQNVPCPINDIQVVQ 313
           +LK   ++Q  P  I D + ++
Sbjct: 283 ILKH-PLVQKYPS-IKDSKTIR 302

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/332 (25%), Positives = 149/332 (44%), Gaps = 57/332 (17%)

Query: 6   IGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKP 64
           +G + +G  L  GS  +V + K + +G  A +         P   + V C     VP+  
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIV------PKKKAFVHCSNNGTVPNSY 131

Query: 65  SLNTLRAEVDAMRLL--------KNNRY----------VVSYIDSHAAKAMLHNGSYEVF 106
           S + + + V +  +         + N Y          ++S+ +  A   +  N S E++
Sbjct: 132 SSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKS-ELY 190

Query: 107 VLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVL 166
           +++EY + G L D++ ++   +L E E +    Q+ +GV+  H+    + HRD+K EN+L
Sbjct: 191 LVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLL 246

Query: 167 ISANNE-YKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTFRGL 221
           +   N   K+ DFG +  +  P +           +LK +     Y SPE++    + G 
Sbjct: 247 LDKKNRRIKIADFG-MAALELPNK-----------LLKTSCGSPHYASPEIVMGRPYHGG 294

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGLIRD 277
           P    SD+W+ GI L+ L     PF     K   L + SGK++ P   N S + + LI  
Sbjct: 295 P----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMP--SNLSSEARDLISK 348

Query: 278 ILVQDPRHRPNVYQLLKRISIMQNVPCPINDI 309
           ILV DP  R    ++LK   I +    P+N +
Sbjct: 349 ILVIDPEKRITTQEILKHPLIKKYDDLPVNKV 380

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 146/338 (43%), Gaps = 71/338 (21%)

Query: 13  TQLTVGSHQVEIIKYLTSGGFAQVY-----SALINPPDPHSNSSVACLKRVIVPDKPSLN 67
           T + V   + +I + L  GG + VY        ++  +  + + +  LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMRLLKNNR-----YVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMN 122
                 + MR ++N +     YV+  IDS   +    +GS  +++++ Y   G L D +N
Sbjct: 81  ------NGMREIENYKRFQSPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSIN 132

Query: 123 TRL--QNRLHEFEILQIMSQVTQGVAAMH------------------------------- 149
            RL     + E E ++IM  VT+G+  +H                               
Sbjct: 133 RRLLEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLE 192

Query: 150 --ALQPPLI-----------HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSY 196
              L+  ++           HRDI   N+L S++    + D GS         N  +LS 
Sbjct: 193 DTPLEMDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSE 252

Query: 197 VQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----GGD 251
           +Q+ +  N T  Y +PE+++      +  K DIW++G   Y L +  +PFE+     G  
Sbjct: 253 LQEWVNDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGAS 312

Query: 252 L--AILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRP 287
           L  AI +GK+ FP    +SE+L  +I+  +  DP  RP
Sbjct: 313 LTYAINTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 138/331 (41%), Gaps = 61/331 (18%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVA-----CLKRVIVPDKPSLNTL 69
           + V   +  I + L  GG + VY   ++      ++ +A      LK++I P   S++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 70  RAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRL--QN 127
             E++  +  ++  YV+  IDS   +    +GS  +++++ Y   G L D +N RL    
Sbjct: 83  MREIENYKRFQSP-YVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 128 RLHEFEILQIMSQVTQGVAAMH-------------------------------------- 149
            + E E ++IM  VT+G+  +H                                      
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 150 ------ALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILK 203
                 A      HRDI   N+L S++    + D GS         N  +LS +Q+ +  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 204 NTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----GGDL--AILS 256
           N T  Y  PE+++      +  K DIW+LG   Y L +  +PFE+     G  L  AI +
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 GKFEFPLYPNYSEQLKGLIRDILVQDPRHRP 287
           GK+ FP    +SE L  +I+  +  DP  RP
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 143/350 (40%), Gaps = 67/350 (19%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPS 65
            G +  G ++++      +   L  G    +Y   +  P    +  V  LK+V  P   +
Sbjct: 15  CGFWFDGVRISINGKSYLVTTLLREGELTALYQ--VKCPKRSHSGGVYALKKVTCPIGRA 72

Query: 66  LNTLRAEVDAMRLLK-NNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTR 124
               RA  +     + N+ Y+ + +D   A+    NG+  +++L+ Y   G L D +N  
Sbjct: 73  DFVTRAMTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNM 130

Query: 125 L--QNRLHEFEILQIMSQVTQGVAAMHA-------------------------------- 150
           +   + L E  ++++M  + +GV  MH                                 
Sbjct: 131 IIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDA 190

Query: 151 -----LQPPL--------IHRDIKIENVLISANNEYKLCDFGSVCGIIRPP----RNSQE 193
                L PPL        +H  +  EN+++S+     + +  S    +R P     NS+ 
Sbjct: 191 MELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKL 247

Query: 194 LSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLA 253
           L  +Q+ + +N+   Y  PE++D      I  + DIW+LG   Y L Y  + F +   L 
Sbjct: 248 LG-LQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLC 306

Query: 254 -------ILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRI 296
                  I +G F FP  P YS+ LK +++  LV DP  RP++Y+ L + 
Sbjct: 307 GTPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQF 356

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 131/282 (46%), Gaps = 33/282 (11%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S Q  + + +  G +  VY A+    + H++  VA +K ++      LN + AE+  ++ 
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYESDEELNDIMAEISLLKN 76

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           L N+  +V Y   H         SYE+++L+EYC  G L   + +R    L E E    +
Sbjct: 77  L-NHDNIVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYV 127

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
           +Q   G+  +H     +IHRDIK  N+L+SA+N  KL DFG V  I+    NS  L+   
Sbjct: 128 TQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG 180

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGK 258
                  T  + +PE++   RG      SDIW+LG  + ++     P+    D  I    
Sbjct: 181 -------TLNWMAPEILGN-RG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 259 FEFPLYP--NYSEQLKGLIRDILVQDPRHRPNVYQLLKRISI 298
                YP  ++SE LK  +    V++   RP   QLLK   I
Sbjct: 231 ENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHAWI 272

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 128/275 (46%), Gaps = 30/275 (10%)

Query: 24  IIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPD-KPSLNTLRAEVDAMRLLKNN 82
           I K +  G F  V+ A+ N         V  +K + + D +     +  E+  M LLK+ 
Sbjct: 18  IDKCVGKGNFGDVFKAMNN-----VTKEVVAIKIINLDDSEEETFEIIKEMRLMSLLKS- 71

Query: 83  RYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVT 142
            Y+  YI +        N  Y ++++MEYC  G   D + T  +  L E ++  ++  V 
Sbjct: 72  PYIARYITTI-------NEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVL 124

Query: 143 QGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDIL 202
            G+  +HA     IHRDIK  N+L++ +   K+ DFG           S E+    +   
Sbjct: 125 LGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFGV----------SAEMRSTMKAKT 172

Query: 203 KNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFE 260
              T  + +PE++    G+  +EKSDIW+LGI  Y+L     P  K   + ++    K +
Sbjct: 173 FVGTPYWMAPEVVMN-EGMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRK 231

Query: 261 FP-LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
            P L+  Y+  +K  I   L++DP  RP+  +LL+
Sbjct: 232 PPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLE 266

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 139/301 (46%), Gaps = 46/301 (15%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPS 65
           IG + +G+ L VGS    ++ Y  + G  Q    +I+    ++  S      +I  + P 
Sbjct: 14  IGPWKLGSTLGVGSTGKVVMAYNETKG-QQAAVKIISKSIFNAQGST-----MIGGNDPD 67

Query: 66  L--NTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNT 123
           +    +  E+  M+LL N+  V+   D       +   S ++++++EY E+G L + +  
Sbjct: 68  VLPYGIEREIIIMKLL-NHPNVLRLYD-------VWETSKDLYMVLEYVEKGELFNLLVE 119

Query: 124 RLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCG 183
           R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      KL DFG    
Sbjct: 120 R--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMAA- 174

Query: 184 IIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIFLYKL 239
                          +D L  T+     Y +PE++    GLP    +SD+W+ G+ LY L
Sbjct: 175 ------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYAL 219

Query: 240 CYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
                PF E+ G+     L + SGKFE P     S + + LI  IL  DP  R    ++L
Sbjct: 220 LTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREIL 279

Query: 294 K 294
           K
Sbjct: 280 K 280

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 116/234 (49%), Gaps = 32/234 (13%)

Query: 85  VVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQG 144
           ++S+ +  A   +  N S E+++++EY + G L D++ ++   +L E E +    Q+ +G
Sbjct: 170 LISHTNVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLIHRDIKIENVLISANNE-YKLCDFGSVCGIIRPPRNSQELSYVQQDILK 203
           V+  H+    + HRD+K EN+L+   N   K+ DFG +  +  P +           +LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFG-MAALELPNK-----------LLK 272

Query: 204 NTTA--QYRSPEMI--DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAIL 255
            +     Y SPE++    + G P    SD+W+ GI L+ L     PF     K   L + 
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 SGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDI 309
           SGK++ P+  N S + + LI  ILV DP  R    ++LK   I +    P+N I
Sbjct: 329 SGKYQMPM--NLSAEARDLISKILVIDPAKRITTQEILKHPLIKKYDDLPVNKI 380

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 134/279 (48%), Gaps = 27/279 (9%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S   +I + +  G F  VY A+ N    +    V  L+         ++ L  E+  +  
Sbjct: 13  SSLFDIKECVGRGNFGDVYKAIDNITKKYVAIKVINLEY----SDEDIDLLAQEIFFLAE 68

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           LK++ Y+++YI +      +       +++M+YC  G   D +     N + E ++  I+
Sbjct: 69  LKSD-YIINYITTIMEDVSM-------WIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIV 120

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
             V  G+  +H  +   IHRDIK  N+L++ + + KL DFG V G I+        + ++
Sbjct: 121 KNVLLGLQYLHEQKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIK--------ATLK 169

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG- 257
           +D    T   + +PE+I+       DEK DIW+LGI  Y+L     P  K   + +++  
Sbjct: 170 RDTFVGT-PYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSL 228

Query: 258 -KFEFP-LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
            K + P L+  Y++  K  I   L++DP+ RPNV  LLK
Sbjct: 229 VKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 151/324 (46%), Gaps = 50/324 (15%)

Query: 5   QIGTYNVGTQLTVGSH-QVEIIKYLTSGGFA--QVYSALINPPDPHSNSSVACLKRVIVP 61
           +IG + +G+ L  GS  +V + ++ T+G  A  ++ S  I      +NSS      ++  
Sbjct: 22  KIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSST-----IVGS 76

Query: 62  DKPSL--NTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLID 119
           + P L    +  E+  M+LL N+  V+   D    K+ L       ++++EY E+G L +
Sbjct: 77  NDPDLLPYGIEREIIIMKLL-NHTNVLRLYDVWETKSNL-------YMVLEYVEKGELFN 128

Query: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179
            +  R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG
Sbjct: 129 LLVER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFG 184

Query: 180 SVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIF 235
                              +D L  T+     Y +PE++    GLP    +SD+W+ G+ 
Sbjct: 185 MAA-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVI 228

Query: 236 LYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNV 289
           LY L     PF E  G+     L + SG++E P     S + + LI  IL  DP  R   
Sbjct: 229 LYALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKT 288

Query: 290 YQLLKRISIMQNVPCPINDIQVVQ 313
            ++LK   ++Q  P  I D + ++
Sbjct: 289 REILKH-PLLQKYPS-IKDSKSIR 310

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 89.4 bits (220), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 133/267 (49%), Gaps = 30/267 (11%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRV-IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYI 89
           G F  VY A        +N ++  +K V +   +  ++ L  E+  +  L++  Y+ +YI
Sbjct: 24  GNFGDVYKAF-----DKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-PYITNYI 77

Query: 90  DSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMH 149
            +     M+ + S  ++++MEYC  G   D + T   N L E ++  I  +V +G+  +H
Sbjct: 78  TT-----MIEDVS--MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLH 130

Query: 150 ALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQY 209
             +   IHRDIK  N+L++   + KL DFG V G IR     +  ++V        T  +
Sbjct: 131 DQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TMKRGTFV-------GTPYW 178

Query: 210 RSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFP-LYPN 266
            +PE+++       +EK+DIW+LGI +Y+L     P  K   + ++    + + P L+  
Sbjct: 179 MAPEVVNK-ESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQ 237

Query: 267 YSEQLKGLIRDILVQDPRHRPNVYQLL 293
           YS+  KG +   LV+DP  RP+   LL
Sbjct: 238 YSDVAKGFVAACLVKDPNLRPSAEMLL 264

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 140/333 (42%), Gaps = 71/333 (21%)

Query: 10  NVGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LINPPDPHSNSSVA---------CLKRVI 59
           N  T + VGS +  + K +  G FA V+ A LI P  PH + SV          C    I
Sbjct: 26  NERTTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKI 85

Query: 60  VP-----DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCER 114
           VP     +K  L  L  E+  ++ + ++ ++V  ID           S + +++MEYC  
Sbjct: 86  VPRSKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSL 137

Query: 115 GGLIDFMNTRLQ----------------------NRLHEFEILQIMSQVTQGVAAMHALQ 152
           G L   +  R Q                      N LH+  IL  + Q++  +  + +  
Sbjct: 138 GDLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN 197

Query: 153 PPLIHRDIKIENVLISA-----NNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA 207
             L+HRDIK +N+L+SA     N+     D G V     P     +  + +   L NT+ 
Sbjct: 198 --LVHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSM 253

Query: 208 Q--------YRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL---- 255
                    Y +PE+++  +    + K+D+W++G  LY++CY   PF+    L +     
Sbjct: 254 AETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIK 310

Query: 256 --SGKFEFPLYPNYSEQLKGLIRDILVQDPRHR 286
             +    FP Y      LK LI  +L  DP+ R
Sbjct: 311 KANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 157/358 (43%), Gaps = 69/358 (19%)

Query: 2   NQPQIGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALINPPD--PHSNSSVACLKRV 58
           N+  +G + +G  L  GS  +V + K + +G  A +    I P     H+N+ +  L   
Sbjct: 57  NRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIK---IVPKRNVRHNNTQLTSLPYG 113

Query: 59  IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLI 118
           I            E+  M+L+ +   +  Y         +     E+++++EY E G L 
Sbjct: 114 I----------EREIIIMKLISHPNVMALY--------EVWENKPELYLVLEYVEGGELF 155

Query: 119 DFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANN-EYKLCD 177
           D++ +R   +L E E +    Q+ QGV+  H     + HRD+K EN+L+   N   K+ D
Sbjct: 156 DYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPENLLLDKKNLSVKIAD 211

Query: 178 FGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMI--DTFRGLPIDEKSDIWAL 232
           FG                    D L  T+     Y SPE++    + G P    SD+W+ 
Sbjct: 212 FGMAA-------------LETTDKLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSC 254

Query: 233 GIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPN 288
           GI L+ L     PF     K   L + SGK++ P   N S + K LI  IL+ DP  R  
Sbjct: 255 GIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMP--QNISNEAKDLIAKILIVDPAMRIT 312

Query: 289 VYQLLKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSPTTMENTM 346
           + ++L+   +++         Q  ++ SS    + LH L +T NI+ L S   ++ ++
Sbjct: 313 IDEVLEHPLLLK--------YQKTRSKSS----SNLHALDSTPNIVVLESEDKIDESI 358

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 32/234 (13%)

Query: 85  VVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQG 144
           ++S+ +  A   +  N S E+++++EY + G L D++ +R   +L E E +    Q+ +G
Sbjct: 170 LISHANVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLIHRDIKIENVLI-SANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILK 203
           V+  H+    + HRD+K EN+L+   N + K+ DFG +  +  P +           +LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFG-MAALELPNK-----------LLK 272

Query: 204 NTTA--QYRSPEMI--DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAIL 255
            +     Y SPE++    + G P    SD+W+ GI L+ L     PF     K   L + 
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 SGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDI 309
           SGK++ P+  N S + + LI  ILV DP  R    ++L+   I +    P+N +
Sbjct: 329 SGKYQMPM--NLSLEARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPVNKM 380

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 89.7 bits (221), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 88/334 (26%), Positives = 148/334 (44%), Gaps = 46/334 (13%)

Query: 6   IGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVY---SALINPPDPHSNSSVACLKRVIVP 61
           IG + +G  L +GS  +V++ +  ++G  A V     A+ N  +    S V        P
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGS----TTP 71

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  M+LL N+  V+   D       +   + ++++++EY E+G L + +
Sbjct: 72  DALPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLL 122

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
             R    L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 123 VER--GPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA 178

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMIDTFRGLPIDE-KSDIWALGIFLYK 238
                           +  +L+ +     Y +PE++    G+P     SD+W+ G+ L+ 
Sbjct: 179 A------------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 LCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           L     PF E+ G+     L +  G+FE P     S + + LIR IL  DP  R     +
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDI 283

Query: 293 LKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQ 326
           LK   ++Q  P   +   +   P     LT L +
Sbjct: 284 LKH-PLLQKYPSIRDSKSIRGLPREDTYLTPLSE 316

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/334 (26%), Positives = 149/334 (44%), Gaps = 46/334 (13%)

Query: 6   IGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVY---SALINPPDPHSNSSVACLKRVIVP 61
           IG + +G  L +GS  +V++ +  ++G  A V     A+ N  +    S V      I P
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGS----ITP 71

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  M+LL N+  V+   D       +   + ++++++EY E+G L + +
Sbjct: 72  DALPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLL 122

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
             R    L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 123 VER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA 178

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMIDTFRGLPIDE-KSDIWALGIFLYK 238
                           +  +L+ +     Y +PE++    G+P     SD+W+ G+ L+ 
Sbjct: 179 A------------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 LCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           L     PF E+ G+     L +  G+FE P     S + + LI  IL  DP+ R     +
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDI 283

Query: 293 LKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQ 326
           LK   ++Q  P   +   +   P     LT L +
Sbjct: 284 LKH-PLLQKYPSIRDSKSIRGLPREDTYLTPLSE 316

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 134/293 (45%), Gaps = 64/293 (21%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY AL  P          CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQVGEGSFGKVYLALHRPTHRK-----VCLK---TSDKNDPNIVR------ 81

Query: 77  RLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ 136
            +  + ++   YI       +      +V++ +EYC    L D + +   +R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTET---KVWMALEYCPGKELYDHLLS--LHRISLLECAE 136

Query: 137 IMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSY 196
           + +Q++  V   H++    +HRD+K+EN+L+  N   KL DFG                +
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------F 178

Query: 197 VQQDILKNT------TAQYRSPEMID--TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            ++ + K T      T  Y +PE+I+  T+ G  I    DIW+LG+ LY L   + PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDD 234

Query: 249 GGDLAILSGKFEFPLY---PNYSEQL-----KGLIRDILVQDPRHRPNVYQLL 293
             ++     K ++ +    PNY   L     K LI  +L ++P+ RP++ Q+L
Sbjct: 235 DDEV-----KTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 128/289 (44%), Gaps = 41/289 (14%)

Query: 23  EIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVI----VPDKPSLNTLRAEVDAMRL 78
           EI + L  G F +VY         H  S + C  +V+    + +       + E+D    
Sbjct: 119 EIGRKLGKGKFGKVYCV------RHKPSGLICALKVMNKMEIVNFNVQKQFKREIDI--- 169

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
               +Y +++ +     A  H+ S  V+++MEY   G L   +  +    +++      +
Sbjct: 170 ----QYHLNHKNLTKLYAFFHD-SKNVYLVMEYLIGGELYKLL--KKNGPMNDITASNYV 222

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
            Q+T  +  MH  +  +IHRD+K EN+LI  NN+ KL DFG     I  P N +  +   
Sbjct: 223 YQMTDALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFGWS---IYNPNNQKRKTLC- 276

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGD----LAI 254
                  T  Y SPE+I +      DE  D+WALGI  Y+L     PFE+         I
Sbjct: 277 ------GTIDYLSPELISSRE---YDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRI 327

Query: 255 LSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVP 303
                +FP  PN S + + LI ++L   P  R N+ Q++    I +N P
Sbjct: 328 AKSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVMNHPWIEKNKP 374

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 104/216 (48%), Gaps = 26/216 (12%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY    +++V+MEYC  G L   +      ++ E  I  IM ++    A MH  +  +I
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMHIHKDGVI 137

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+ +   KLCDFG    + +     Q ++          T  + +PE+I 
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEVI- 187

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAI--LSGKFEFPLYPN--YSEQLK 272
              G+  D K DIW+LGI  Y++     P+ +   L    L  K + P      +S  LK
Sbjct: 188 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALK 246

Query: 273 GLIRDILVQDPRHRPNVYQLLKR--ISIMQNVPCPI 306
            +I   L +DP+ RP+   LLK   I + +NVP  I
Sbjct: 247 EIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVSI 282

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 130/282 (46%), Gaps = 33/282 (11%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S Q  + + +  G +  VY A+    + H++  VA +K ++  +   LN + AE+ ++  
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAI----NKHTDQVVA-IKEIVYENDEELNDIMAEI-SLLK 75

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
             NN  +V Y   H         SYE+++L+EYC  G L   + +R    L E E    +
Sbjct: 76  NLNNNNIVKY---HG----FIRKSYELYILLEYCANGSLRRLV-SRSPTGLSENESKTYV 127

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
           +Q   G+  +H     +IHRDIK  N+L+SA+N  KL DFG V  I+    NS  L+   
Sbjct: 128 TQTLWGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG 180

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGK 258
                  T  + +PE++   RG      SDIW+LG  + +L     P+    D  I    
Sbjct: 181 -------TLNWMAPEILGN-RG--ASTLSDIWSLGATVVELLTKNPPYHNLTDANIYYAV 230

Query: 259 FEFPLYP--NYSEQLKGLIRDILVQDPRHRPNVYQLLKRISI 298
                YP   +SE LK  +    V++   RP   QLLK   I
Sbjct: 231 ENDTYYPPTAFSESLKDFLSKCFVKNMYKRPTADQLLKHAWI 272

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 91/339 (26%), Positives = 150/339 (44%), Gaps = 47/339 (13%)

Query: 5   QIGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDK 63
           +IG + +G+ L  GS  +V + ++ ++G  A V     +     SNSS      ++  + 
Sbjct: 22  KIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSST-----IVGSND 76

Query: 64  PSL--NTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           P +    +  E+  M+LL N+  V+   D     + L       ++++EY E+G L + +
Sbjct: 77  PDVLPYGIEREIIIMKLL-NHPNVLRLYDVWETNSSL-------YMVLEYVEKGELFNLL 128

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
             R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 129 VDR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA 184

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIFLY 237
                            +D L  T+     Y +PE++    GLP    +SD+W+ GI L+
Sbjct: 185 A-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILF 228

Query: 238 KLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQ 291
            L     PF E+ G+     L + SGKFE P     S + + LI  IL  DP  R     
Sbjct: 229 ALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRG 288

Query: 292 LLKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQLSAT 330
           +LK   ++Q  P   +   +   P     L  L  +  T
Sbjct: 289 ILKH-PLLQKYPSIKDSKSIRNLPREDTYLNPLDSVDGT 326

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 135/312 (43%), Gaps = 66/312 (21%)

Query: 5   QIGTYNVGTQLTVGS------------HQVEIIKYLTSGGFAQVYSALINPPDPHSNSSV 52
           +IG + +G  L VGS             Q+  +K ++   F    S  +   DP      
Sbjct: 16  RIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPD----- 70

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYC 112
                 ++P       +  E+  M+LL N+  V+   D       +   S ++++++EY 
Sbjct: 71  ------VLP-----YGIEREITIMKLL-NHPNVLRLYD-------VWETSTDLYMVLEYV 111

Query: 113 ERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNE 172
           E+G L + +  R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+     
Sbjct: 112 EKGELFNLLIER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFN 167

Query: 173 YKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSD 228
            KL DFG                   +D L  T+     Y +PE++    GLP    +SD
Sbjct: 168 IKLADFGMAA-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESD 211

Query: 229 IWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQD 282
           +W+ G+ LY L     PF E  G+     L + SG+FE P     S + + LI  IL  D
Sbjct: 212 VWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVD 271

Query: 283 PRHRPNVYQLLK 294
           P  R    ++LK
Sbjct: 272 PSGRIKTREILK 283

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 82/318 (25%), Positives = 145/318 (45%), Gaps = 58/318 (18%)

Query: 51  SVACLKRVIVPDKPSLNT-LRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLM 109
           ++  +KR  +   PS  T +  E++A++ L +   V         + +L N  Y + +++
Sbjct: 95  AIKLIKRDFITKDPSKETKIYREINALKHLSHPNIV-------KLEEVLQNSKY-IGIVL 146

Query: 110 EYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISA 169
           EY   G    F+  +   RL E    ++ SQ+   V  +H+    L+HRD+K+EN+L+  
Sbjct: 147 EYAAGGEFYKFIQRK--RRLKENHACRLFSQLISAVHYIHS--KGLVHRDLKLENLLLDN 202

Query: 170 NNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEMIDTFRGLPID-EK 226
                + DFG V   +R           Q  ++K +     Y +PE++ + R  P D  K
Sbjct: 203 EENLIITDFGFVNEFLR-----------QNGMMKTSCGSPCYAAPELVVSNR--PYDARK 249

Query: 227 SDIWALGIFLYKLCYYTTPFE------KGGDLA-----ILSGKFEFPLYPNYSEQLKGLI 275
           +D W+ GI L+ +     P++       G D++     IL+   +FP Y N     + L+
Sbjct: 250 ADTWSCGIILFAMLAGYLPWDDDPKNPDGHDISRLYNYILNTPLKFPEYIN--PVPRDLL 307

Query: 276 RDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLNLT--ELHQLSATQNI 333
           R ILV DP+ R N+  + K                 +++ S+ L++T  E  +LS T+NI
Sbjct: 308 RKILVIDPKKRINIRSIEKH--------------PWLESHSTFLSITPDEWDRLSNTKNI 353

Query: 334 LSLNSPTTMENTMPNATF 351
              + P    N  P +T+
Sbjct: 354 YRKSKPQFYPNKRPGSTY 371

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 98/200 (49%), Gaps = 31/200 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+F+++EY E G L D++ ++   +L E E +    Q+ QGVA  H     + HRD+K E
Sbjct: 144 ELFLVLEYVEGGELFDYLVSK--GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPE 199

Query: 164 NVLI-SANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTF 218
           N+L+   N++ K+ DFG                     +L+ +     Y SPE++    +
Sbjct: 200 NLLVDKKNHQIKIADFGMAA------------LETTNKLLETSCGSPHYASPEIVMGKNY 247

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGL 274
            G P    SD+W+ GI L+ L     PF     K   L + SGK+  P   N S + + L
Sbjct: 248 HGSP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKYHMPQ--NISSEAQDL 301

Query: 275 IRDILVQDPRHRPNVYQLLK 294
           I  IL+ DPR R  + ++L+
Sbjct: 302 ISKILIVDPRGRITINEVLQ 321

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 119/248 (47%), Gaps = 39/248 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L E E +   +Q+ QGV+  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 164 NVLISANNEY-KLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRG 220
           N+L+   N+  K+ DFG     +  P    E S          +  Y SPE++    + G
Sbjct: 256 NLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 305

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGLIR 276
            P    SD+W+ GI L+ L     PF     K   L + +G+F+ P Y   +   K LI 
Sbjct: 306 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTNDAKDLIT 359

Query: 277 DILVQDPRHRPNVYQLLKR--ISIMQNVPCPINDIQVVQAPSSHLNLTELHQLSATQNIL 334
            ILV +P  R  + ++L    I   +N P  I  + ++    S+   ++LH       +L
Sbjct: 360 RILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLLGRGKSN---SDLH-------VL 409

Query: 335 SLNSPTTM 342
             N+P T+
Sbjct: 410 EYNTPATV 417

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 85.9 bits (211), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 97/404 (24%), Positives = 184/404 (45%), Gaps = 44/404 (10%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDK-PSLNTLRAEVDAMRLLKNNRYVVSYI 89
           G F  VY A+       + S V  +K V + +    +  L  E+  +  LK+  ++ +YI
Sbjct: 24  GNFGDVYKAI-----DKNESKVVAIKIVNLENTDEDIELLTQEIFFLSELKS-PFITNYI 77

Query: 90  DSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMH 149
            +      +       +++MEYC  G   D +       + E ++  I+    +G+  +H
Sbjct: 78  TTLTEDVTM-------WIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLH 130

Query: 150 ALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQY 209
             +   IHRDIK  N+L++   + KL DFG V G IR     +  ++V        T  +
Sbjct: 131 DQKK--IHRDIKAANILLTDCGKVKLGDFG-VSGQIRA--TMKRGTFVG-------TPYW 178

Query: 210 RSPEMIDT-FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFP-LYP 265
            +PE+I+   +G   +EK+DIW+LGI  Y+L     P  K     ++    K + P L+ 
Sbjct: 179 MAPEVINKQCKGY--NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHG 236

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPI-NDIQVVQAPSSHLNLTEL 324
            YSE+ K  +   L++DP+ RP++  LL+   ++ N    +  D+ ++++     N ++ 
Sbjct: 237 QYSEKAKYFVSLCLIKDPKQRPSIEALLETDFLLPNTVLNLKEDVDLIKSIKLKNNYSKT 296

Query: 325 --HQLS-----ATQNILSLNSPTTMENTMPNATFQ--ISMADNTTTAQMHP-NRKPSQIA 374
             +QL+      ++NI+S N   +  N      ++  I   +  T  +M    + P+   
Sbjct: 297 PKYQLNQKIYDGSENIMSWNFDVSENNNSIQEIYENNIQTTEAATLQKMSELEKSPTTPT 356

Query: 375 YDASFSN-SAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDN 417
            D   S  S++   P+ + S+  +  LD      +A  ++N ++
Sbjct: 357 LDMRTSKPSSQLETPMTNISERSFRRLDKTKNNIVAGKITNTND 400

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 140/321 (43%), Gaps = 67/321 (20%)

Query: 5   QIGTYNVGTQLTVGS------------HQVEIIKYLTSGGFAQVYSALINPPDPHSNSSV 52
           +IG + +G  L  GS             Q+  +K ++   F    S  +   DP      
Sbjct: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD----- 69

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYC 112
                 ++P       +  E+  M+LL N+  V+   D       +   + ++++++EY 
Sbjct: 70  ------VLP-----YGIEREIIIMKLL-NHPNVLRLYD-------VWETAQDLYMVLEYV 110

Query: 113 ERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNE 172
           E+G L + +  R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+     
Sbjct: 111 EKGELFNLLVQR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFN 166

Query: 173 YKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSD 228
            KL DFG               +   +D L  T+     Y +PE++    GLP    +SD
Sbjct: 167 IKLADFGMA-------------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESD 210

Query: 229 IWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQD 282
           +W+ G+ LY L     PF E+ G+     L + SGK+E P     S + + LI  IL  +
Sbjct: 211 VWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVE 270

Query: 283 PRHRPNVYQLLKRISIMQNVP 303
           P  R    ++LK   ++Q  P
Sbjct: 271 PEQRIKTREILKH-PLLQKYP 290

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 139/340 (40%), Gaps = 75/340 (22%)

Query: 13  TQLTVGSHQVEIIKYLTSGGFAQVY------------SALINPPDPHSNSSVACLKRVIV 60
           T + V   + +I + L  GG + VY            + +I P        +  LK++I 
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITP-------EMYALKKIIC 73

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           P   S++    E++  +  ++  YV+  IDS   +    NGS  +++++ Y   G L D 
Sbjct: 74  PSVESISNGMREIENYKRFQSP-YVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDS 130

Query: 121 MNTRL--QNRLHEFEILQIMSQVTQGVAAMH----------------------------- 149
           +N RL     + E E ++IM  VT+G+  +H                             
Sbjct: 131 INRRLLEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAML 190

Query: 150 ---------------ALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQEL 194
                          A      HRDI   N+L S+     + D GS         +  +L
Sbjct: 191 LEDTPLEMDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQL 250

Query: 195 SYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----G 249
           S +Q+ +  N T  Y +PE+++      +  K DIW++G   Y L +  +PFE+     G
Sbjct: 251 SELQEWVNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHG 310

Query: 250 GDL--AILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRP 287
             +  AI +GK+ FP    +SE L  +I+  +  DP  RP
Sbjct: 311 ASITYAINTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 116/234 (49%), Gaps = 32/234 (13%)

Query: 85  VVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQG 144
           ++S+ +  A   +  N S E+++++EY + G L D++ ++   +L E E +    Q+ +G
Sbjct: 170 LISHANVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLIHRDIKIENVLISANN-EYKLCDFGSVCGIIRPPRNSQELSYVQQDILK 203
           V+  H+    + HRD+K EN+L+   N + K+ DFG +  +  P +           +LK
Sbjct: 227 VSFCHSFN--ICHRDLKPENLLLDKKNRKIKIADFG-MAALELPNK-----------LLK 272

Query: 204 NTTA--QYRSPEMI--DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAIL 255
            +     Y SPE++    + G P    SD+W+ GI L+ L     PF     K   L + 
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 SGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDI 309
           SGK++ P+  N S + + LI  ILV +P  R    ++L    I +    PIN +
Sbjct: 329 SGKYQMPM--NLSAEARDLISKILVINPEKRITTQEILNHPLIKKYDNLPINKM 380

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 104/219 (47%), Gaps = 32/219 (14%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY    E++V+MEYC  G L   +      ++ E  I  IM ++   +A MH  +  +I
Sbjct: 83  GSYLNNTELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHKDGVI 137

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+ +   KLCDFG    + +     Q ++          T  + +PE+I 
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEVI- 187

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG-----KFEFPLYPN--YSE 269
              G+  D K DIW+LGI  Y++     P+    D+  L       K + P      +S 
Sbjct: 188 -MEGVYYDTKVDIWSLGITAYEIATGNPPY---CDVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 270 QLKGLIRDILVQDPRHRPNVYQLLKR--ISIMQNVPCPI 306
            LK  I   L +DP+ RP+  +LLK   I + +NV   I
Sbjct: 244 ALKEFIALCLDEDPKERPSAEELLKTKFIRLHKNVSASI 282

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 99/218 (45%), Gaps = 27/218 (12%)

Query: 84   YVVSYIDSHAAKAM------LHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQI 137
            Y++S  ++H    +        +  Y    L  + E G +  F    L+  + EFE   I
Sbjct: 850  YIMSKFNAHPHDNITQIMDFFEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLI 909

Query: 138  MSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYV 197
              Q+  G+  +H     ++HRDIK ENV++ +N   KL DFGS       P       +V
Sbjct: 910  FKQIVSGIKYLH--DQGIVHRDIKDENVIVDSNGFVKLIDFGSAAYTKTGPFE----VFV 963

Query: 198  QQDILKNTTAQYRSPEMI--DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL 255
                    T  Y +PE++  + ++G P     DIWALG+ LY L Y   PF    +  IL
Sbjct: 964  G-------TIDYAAPEILGGNPYKGKP----QDIWALGVLLYTLIYKENPFYNVDE--IL 1010

Query: 256  SGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
             G+  F    N ++    LIR IL +    RP++ +++
Sbjct: 1011 EGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 141/326 (43%), Gaps = 35/326 (10%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA L    +  + +   L +E+   + +K+   VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKHQN-VV 142

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    N   K+ DFG    +     N +E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 242

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFE 260
             Y +PE ++    G   +   DIW++G+ LY L     PF+   D+      I    F 
Sbjct: 243 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFS 299

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLN 320
           FP   + S + K LI+D+L  DP  RP++ +++  +      P  I    + + P+    
Sbjct: 300 FPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKT 359

Query: 321 LTELHQLSATQNILSLNSPTTMENTM 346
           LT  HQ S       L     +E++M
Sbjct: 360 LT--HQESIINFRKCLEKSGLIEDSM 383

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 99/208 (47%), Gaps = 49/208 (23%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L +++   +Q+R+   E  ++ +Q+   V   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISANNEYKLCDFG------------SVCGIIRPPRNSQELSYVQQDILKNTTAQYRS 211
           N+L+      K+ DFG            +VCG                      T  Y +
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMID--TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKF--EFPLYPN- 266
           PE+I+  ++ G  I    DIW+LG+ LY + + T PF++  D      K   E P Y + 
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDE-EDETKTKWKIINEEPFYNDD 250

Query: 267 -YSEQLKGLIRDILVQDPRHRPNVYQLL 293
             S+  K LI  +L +DP  RP + Q+L
Sbjct: 251 VVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 105/229 (45%), Gaps = 31/229 (13%)

Query: 66   LNTLRAEVDAMRLLK--NNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMN- 122
            L T+ +E+  M  L   +N+ ++S +D         +  Y  +V      + G ID  + 
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILD------FFEDDDY-YYVEQPVHGKTGCIDLFDL 1101

Query: 123  TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVC 182
               +  + EFE   I  Q+  G++ +H  +  ++HRDIK ENV++ A    KL DFGS  
Sbjct: 1102 IEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAA 1159

Query: 183  GIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRGLPIDEKSDIWALGIFLYKLC 240
             +   P           D+   T   Y SPE++  + + G P     DIWALGI LY + 
Sbjct: 1160 YVKNGPF----------DVFVGTI-DYASPEVLRGEKYEGKP----QDIWALGILLYTIV 1204

Query: 241  YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNV 289
            +   PF    +  IL G  +FP   N S     LI+ IL +    RP++
Sbjct: 1205 FKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSI 1251

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 142/314 (45%), Gaps = 32/314 (10%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA   ++ +  + +   L +E+   + +++   +V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-IV 139

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFIDCF-------EDDTNVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEF 261
             Y +PE++ T +      + DIW+ G+ +Y L     PF+   ++ I+      G + F
Sbjct: 240 PNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYVF 297

Query: 262 PLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLNL 321
           P     S++   LIRDIL  DP  RP++ +++  +      P P  D  V+ +  S+ NL
Sbjct: 298 PRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFP-PRIDASVLSSAPSYENL 356

Query: 322 TELHQLSATQNILS 335
                L+  +N ++
Sbjct: 357 DAAQSLANFKNCMA 370

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 98/198 (49%), Gaps = 27/198 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           ++F+++EY + G L D++ ++   +L E+E +    Q+ +GVA  H+    + HRD+K E
Sbjct: 189 DLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSYN--ICHRDLKPE 244

Query: 164 NVLISANNEY-KLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRG 220
           N+L+   N+  K+ DFG     +  P    E S          +  Y SPE++    + G
Sbjct: 245 NLLLDKKNKIIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 294

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGD----LAILSGKFEFPLYPNYSEQLKGLIR 276
            P    SD+W+ GI L+ L     PF         L + SG+F  P   N S + + LI 
Sbjct: 295 GP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFRLPR--NISLEAQDLIA 348

Query: 277 DILVQDPRHRPNVYQLLK 294
            ILV +PR R  +  +LK
Sbjct: 349 KILVVNPRQRIKISDILK 366

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 85/177 (48%), Gaps = 22/177 (12%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
            G ID  +   L+N + E E+  I  Q+  G+  +H     +IHRDIK ENV++ A    K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRGLPIDEKSDIWAL 232
            L DFGS   +   P           D+   T   Y +PE++  D + G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGPF----------DVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNV 289
            GI LY + +   PF    +  IL G+  F    + S + K LI  IL ++ + RP +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 140/313 (44%), Gaps = 58/313 (18%)

Query: 6   IGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALINPPDPHS-----NSSVACLKRVI 59
           +G + +G  L  GS  +V + K + +G  A +    I P + HS     +S    L    
Sbjct: 70  VGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIK---IVPKNFHSKKKRQDSPAKSLSSS- 125

Query: 60  VPDKPSLNTLRAEVDAMRLLKNNRY------VVSYIDSHAAKAMLHN---GSYEVFVLME 110
            PDKP   T   E +      NN Y      V+  + SH     L+       E+++++E
Sbjct: 126 -PDKP-YTTHSNETNP----SNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLE 179

Query: 111 YCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISAN 170
           Y + G L D++ +R   +L E E +    Q+ QGVA  HA    + HRD+K EN+L+   
Sbjct: 180 YVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPENLLLDKK 235

Query: 171 NE-YKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMI--DTFRGLPID 224
           N+  K+ DFG             E+S    D L +T+     Y SPE++   ++ G P  
Sbjct: 236 NKIIKIADFGMAA---------LEVS----DKLLSTSCGSPHYASPEIVMGKSYHGSP-- 280

Query: 225 EKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGLIRDILV 280
             +D+W+ GI L+ L     PF     K   L + SG +  P   + S   K LI  ILV
Sbjct: 281 --TDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMP--SDLSPDAKDLISKILV 336

Query: 281 QDPRHRPNVYQLL 293
            DP  R    ++L
Sbjct: 337 VDPDKRLTTTEIL 349

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 135/305 (44%), Gaps = 55/305 (18%)

Query: 2   NQPQIGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALINPPD--PHSNSSVACLKRV 58
           N+  +G + +G  L  GS  +V + K + SG  A +    I P     H+   V  L   
Sbjct: 54  NRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIK---IVPKRNVRHNQKQVTALPYG 110

Query: 59  IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLI 118
           I            E+  M+L+ +   +  Y        +  N S E+++++EY E G L 
Sbjct: 111 I----------EREIIIMKLITHPNIMALY-------EVWENKS-ELYLVLEYVEGGELF 152

Query: 119 DFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNE-YKLCD 177
           D++  R   +L E E +    Q+ QGV+  H     + HRD+K EN+L+   N+  K+ D
Sbjct: 153 DYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIAD 208

Query: 178 FGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTFRGLPIDEKSDIWALG 233
           FG              L    + +L+ +     Y SPE++    + G P    SD+W+ G
Sbjct: 209 FGMAA-----------LETTNR-LLETSCGSPHYASPEIVMGQKYHGSP----SDVWSCG 252

Query: 234 IFLYKLCYYTTPFEKGGD----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNV 289
           I L+ L     PF         L +  G+++ P   N S++ K LI  ILV DP  R  V
Sbjct: 253 IILFALLTGHLPFNDDNVRKLLLKVQHGRYQMP--SNVSKEAKDLISKILVVDPEKRITV 310

Query: 290 YQLLK 294
            ++L+
Sbjct: 311 DKILE 315

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 147/334 (44%), Gaps = 46/334 (13%)

Query: 6   IGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVY---SALINPPDPHSNSSVACLKRVIVP 61
           IG + +G  L +GS  +V++ +  ++G  A V     A+ N  +    S V        P
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVSGTSIVGS----NTP 71

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  M+LL N+  V+   D       +   + ++++++EY E+G L + +
Sbjct: 72  DALPYGIER-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLL 122

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
             R    L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 123 VER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA 178

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMIDTFRGLPIDE-KSDIWALGIFLYK 238
                           +  +L+ +     Y +PE++    G+P     SD+W+ G+ L+ 
Sbjct: 179 A------------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 LCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           L     PF E+ G+     L +  G+FE P     S + + LI  IL  DP  R     +
Sbjct: 224 LLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDI 283

Query: 293 LKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQ 326
           LK   ++Q  P   +   +   P     LT L +
Sbjct: 284 LKH-PLLQKYPSIRDSKSIRDLPREDTYLTPLSE 316

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 143/311 (45%), Gaps = 45/311 (14%)

Query: 5   QIGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDK 63
           Q+G + +G  L +GS  +V++    T+G  A +   +I+    ++NS+ +    +  PD 
Sbjct: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAI--KVISKSVFNNNSAQSS--SLTTPDA 69

Query: 64  PSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNT 123
                 R E+  M+LL N+  V+   D     + L       ++++EY E+G L + +  
Sbjct: 70  LPYGIER-EIIIMKLL-NHPNVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVE 120

Query: 124 RLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCG 183
           +    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG    
Sbjct: 121 K--GPLQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA- 175

Query: 184 IIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIFLYKL 239
                          +D L  T+     Y +PE++    G+P     SD+W+ G+ L+ L
Sbjct: 176 ------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFAL 220

Query: 240 CYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
                PF E+ G+     L + SG+FE P     S + + L+  IL  DP  R     +L
Sbjct: 221 LTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDIL 280

Query: 294 KRISIMQNVPC 304
           K   ++Q  P 
Sbjct: 281 KH-PLLQKYPS 290

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 98/204 (48%), Gaps = 23/204 (11%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
            V+++MEY   G L   +  R     ++    + + Q+   +  +H  +  +IHRD+K E
Sbjct: 226 RVYLIMEYLVYGELYKLL--RSHGPFNDIIASRFVYQIADALNHLH--EKGIIHRDLKPE 281

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPI 223
           N+LI  NN  KL DFG    II P         V++  L  T   Y SPEMI   R    
Sbjct: 282 NILIGFNNVLKLTDFG--WSIINP-------KGVKRKTLCGTI-DYLSPEMI---RSREY 328

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEKGGD----LAILSGKFEFPLYPNYSEQLKGLIRDIL 279
           D+  D+WALG+  Y+L     PFE+         IL G+  FP     S+ ++ LI  +L
Sbjct: 329 DDTVDVWALGVLTYELVAGDPPFEEDSKELTYKRILKGEIRFP--GTVSQDVRDLISRLL 386

Query: 280 VQDPRHRPNVYQLLKRISIMQNVP 303
             DP+ R  + +++    IM+N P
Sbjct: 387 KNDPKERILLKEVMVHPWIMRNKP 410

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 101/206 (49%), Gaps = 31/206 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ +R   RL E E +    Q+ QGV+  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 164 NVLISA-NNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTF 218
           N+L+   N+  K+ DFG                 V   +L+ +     Y SPE++    +
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGKQY 293

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGL 274
            G P    SD+W+ GI L+ L     PF     K   L + SGK++ P   N S++ + L
Sbjct: 294 HGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMP--QNLSKEAQDL 347

Query: 275 IRDILVQDPRHRPNVYQLLKRISIMQ 300
           I  IL  +P  R    ++L+   I++
Sbjct: 348 IAKILTVNPAKRLTTEEILRHPLIVK 373

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 123/270 (45%), Gaps = 22/270 (8%)

Query: 28  LTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVS 87
           L  G ++ V   L    D     +V  L +  +  +  +  +  E +A++ + N++ +V 
Sbjct: 185 LGDGAYSTV--MLATSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAA 147
              +   ++ L       + L+EYC  G  +  M  +    L+E       +QV   +  
Sbjct: 243 LFFTFQDESSL-------YFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 148 MHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA 207
           +H     +IHRDIK EN+L+    + KL DFG+   +     N  +L    +  +   TA
Sbjct: 294 LHT--NGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GTA 349

Query: 208 QYRSPEMI-DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFPLY 264
           +Y +PE++ D+F    +D + D+WA G  LY++     PF+   +        K ++   
Sbjct: 350 EYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFT 405

Query: 265 PNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
             +   ++ L++ ILV+D   RP++ Q+ K
Sbjct: 406 AGFPLIIRDLVKKILVKDLNQRPSISQIEK 435

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 100/447 (22%), Positives = 186/447 (41%), Gaps = 56/447 (12%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +          +  +VA   ++ +  + +   L +E+   + +K++  +V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHSN-IV 155

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID     A        V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 156 QFIDCFEDDA-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            +H+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----NDRERKYTVCG-----T 255

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILS-----GKFE 260
             Y +PE ++    G   +   DIW++G+ +Y L     PF+   D+ ++       K+ 
Sbjct: 256 PNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQ-AKDVNVIYERIKLCKYG 312

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLN 320
           +P     S++ + LI DIL  +P  RP +  ++  +      P  I+   +   P+    
Sbjct: 313 YPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVWFRGVFPARISPDVMDTVPNYEEE 372

Query: 321 LTELHQLSATQNIL---------------SLNSPTTMENTMPNATFQISMADNTTTAQMH 365
           LT        +N +               S N  +++     N T  I    N ++++  
Sbjct: 373 LTLEESFINFKNCMANCGLIESGNKRRTSSSNKISSVTGNDDNGT-NIEGTSNVSSSKTE 431

Query: 366 PNRKPSQIAYDASFSNSAKGSQPLFDKSQNMYHALDPPLVEPLASSVSNNDNELKANSAT 425
            N  PS     A+ +N+A  S   FD    + HAL P   +     V + + + K N+  
Sbjct: 432 SNNGPS-----ANATNTASSSNKPFDYRTILPHALSPGGTKNKYKEVIDLEAQRKLNNLA 486

Query: 426 KLKQAIVSEAHTFRQNNSIDFPLQNII 452
             ++A +  A      NS+   L N+I
Sbjct: 487 --REARIRRAQQSNMKNSLQPMLSNVI 511

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/280 (28%), Positives = 130/280 (46%), Gaps = 30/280 (10%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           +H   + + +  G F  VY A+    D  +N  VA     +      L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRAI----DRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           LK+  Y+++YI +     +L + S  ++++MEYC  G   D +     N L E ++  I 
Sbjct: 75  LKSP-YIINYITT-----LLEDAS--MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
            ++ +G+  +H  +   IHRDIK  N+L++     KL DFG V G ++        S ++
Sbjct: 127 REILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSGQLK--------STLR 175

Query: 199 QDILKNTTAQYRSPEMID-TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGD---LAI 254
           +  +   T  + +PE+      G   DEK DIW+LGI +++L     P  K      LA 
Sbjct: 176 RGTIVG-TPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLAN 232

Query: 255 LSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
           LS K    L   YS+  K  +   L+++P  RP    LLK
Sbjct: 233 LSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 108/241 (44%), Gaps = 37/241 (15%)

Query: 69  LRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128
           +R E+  +  LK    +  Y  S+     L       +V+MEYC  G L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDTKL-------WVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPP 188
           + E  I  IM ++   + ++H  +  +IHRDIK  N+LI+ N   KLCDFG    +    
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAAQL---- 162

Query: 189 RNSQELSYVQQDILKNTTAQ----YRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTT 244
                     Q +LK  T      + +PE+I    G+  D K DIW+LGI  Y++     
Sbjct: 163 ---------SQSMLKRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNP 211

Query: 245 PF---EKGGDLAILSGKFEFPLYPN--YSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299
           P+   E    + +++ K + P      YS+ LK  I   L +DP+ RP   +L K   I 
Sbjct: 212 PYCHMEAIRAMQMIT-KSKPPRLEGREYSQPLKEFIALCLDEDPKERPYAEELFKSKLIK 270

Query: 300 Q 300
           Q
Sbjct: 271 Q 271

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 145/334 (43%), Gaps = 46/334 (13%)

Query: 6   IGTYNVGTQLTVGS-HQVEIIKYLTSGGFAQVY---SALINPPDPHSNSSVACLKRVIVP 61
           IG + +G  L +GS  +V++ +  ++G  A V      + N  +    S V        P
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSGTSIVGS----TTP 71

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           D       R E+  M+LL N+  V+   D     A       ++++++EY E+G L + +
Sbjct: 72  DALPYGIER-EIIIMKLL-NHPNVLRLYDVWETNA-------DLYLVLEYAEKGELFNLL 122

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
             R    L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+      K+ DFG  
Sbjct: 123 VER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA 178

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMIDTFRGLPIDE-KSDIWALGIFLYK 238
                           +  +L+ +     Y +PE++    G+P     SD+W+ G+ L+ 
Sbjct: 179 A------------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 LCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           L     PF E+ G+     L +  G+FE P     S + + LI  IL  DP  R     +
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDI 283

Query: 293 LKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQ 326
           LK   ++Q  P   +   +   P     LT L +
Sbjct: 284 LKH-PLLQKYPSIKDSKSIRGLPREDTYLTPLSE 316

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 93/213 (43%), Gaps = 59/213 (27%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D + ++  +RL   E  ++ +Q+T  V   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISANNEYKLCDFG------------SVCGIIRPPRNSQELSYVQQDILKNTTAQYRS 211
           NVL+  N   KL DFG            +VCG                      T  Y +
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMIDTFRGLPIDE-KSDIWALGIFLYKLCYYTTPFEKGGDL----------AILSGKFE 260
           PEMI   +  P D  K DIW+LG+ LY L     PF++  DL           ++  +  
Sbjct: 201 PEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERIT 257

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
            P       + + LI  +L +DP  RPN   +L
Sbjct: 258 IP-------EAQNLIEQLLSKDPTERPNTSAIL 283

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 141/321 (43%), Gaps = 42/321 (13%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +          +  +VA   ++ +  + +   L +E+   + +++   VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-VV 151

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID              V++L+E C  G L++ +  R    + E E+   M+Q+   + 
Sbjct: 152 QFIDCFEDDT-------NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    N   K+ DFG    +     N +E  Y         T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 251

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGK-----FE 260
             Y +PE ++    G   +   DIW++G+ +Y L     PF+   D+ ++  +     F 
Sbjct: 252 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQ-SKDVNMIYERIKNRDFA 308

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVP-CPINDI--------QV 311
           FP     S + K LI DIL  DP  RP++ +++  +      P C ++ +        Q+
Sbjct: 309 FPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSCTLSTVMSEDPNYEQI 368

Query: 312 VQAPSSHLNLTELHQLSATQN 332
           + A  S++N     + S   N
Sbjct: 369 ISAEESYINFQNCLERSGLLN 389

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 133/301 (44%), Gaps = 44/301 (14%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRY-- 84
           +L  GGFA+ +    +     +  +VA   ++ +  + + N L +E+   ++ KN R+  
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEI---QIHKNMRHQN 156

Query: 85  VVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQG 144
           +V +ID              V++L+E C  G L+D +  R    L E E+    +Q+   
Sbjct: 157 IVHFIDCFE-------DDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGA 207

Query: 145 VAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKN 204
           +  MH+    +IHRD+K+ N+    +   K+ DFG +  II    N  E  Y        
Sbjct: 208 LDHMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIIN---NENERKYTIC----- 256

Query: 205 TTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILS----GKFE 260
            T  Y +PE+I   + +    + DIW+LG+ ++ +     PF+      I        + 
Sbjct: 257 GTPNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYS 316

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKR------------ISIMQNVPCPIND 308
           FP     S+ +K LI+DIL  +P  RP + ++L              I +M ++P    D
Sbjct: 317 FPTDKYVSKDVKKLIQDILSMNPMERPTIQEILNYNWFKGNFPPCMPIDVMNDIPIYFMD 376

Query: 309 I 309
           I
Sbjct: 377 I 377

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 134/302 (44%), Gaps = 30/302 (9%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA   ++ +  + +   L +E+   + +K+   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 133

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            + D              V++L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFEDDT-------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYTI-----CGT 233

Query: 207 AQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILS----GKFEFP 262
             Y +PE++ T +      + DIW++G+ +Y L     PF+      I        F FP
Sbjct: 234 PNYIAPEVL-TGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFP 292

Query: 263 LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSH-LNL 321
                S + K LI+DIL  DP  RP++ ++++ +      P  IN   +   P  H L+L
Sbjct: 293 KDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFPARINGDILNFVPEFHDLDL 352

Query: 322 TE 323
            E
Sbjct: 353 QE 354

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 98/197 (49%), Gaps = 27/197 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+F+++EY + G L D++ +R   +L E E +    Q+ +GV+  H+    + HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPE 248

Query: 164 NVLISAN-NEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRG 220
           N+L+    N  K+ DFG +  +  P +           +    +  Y SPE++   ++ G
Sbjct: 249 NLLLDKKINTIKIADFG-MAALELPNK---------LLVTSCGSPHYASPEIVMGKSYHG 298

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGLIR 276
            P    SD+W+ GI L+ L     PF     K   L + SGKF+ P   N S + + LI 
Sbjct: 299 SP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMP--QNISLEAEDLIS 352

Query: 277 DILVQDPRHRPNVYQLL 293
            ILV DP  R  +  +L
Sbjct: 353 RILVVDPEKRIQINDIL 369

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 136/298 (45%), Gaps = 48/298 (16%)

Query: 14  QLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRA-- 71
           Q+T G +   I   L  G F +V       P  +   S     ++I  DK   N+ +   
Sbjct: 38  QITFGPYY--IGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKIVKNSEKEIK 95

Query: 72  ---EVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128
              E++A++ L +   V         + +L N  Y + +++EY   G    ++  + + R
Sbjct: 96  IFREINALKHLTHPNIV-------KLEEVLQNSKY-IGIVLEYASGGEFYRYI--QRKRR 145

Query: 129 LHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPP 188
           L E    ++ +Q+  GV  MH+    L+HRD+K+EN+L+  +    + DFG V   ++  
Sbjct: 146 LKETAGCRLFTQLVSGVNYMHS--KGLVHRDLKLENLLLDKHENLVITDFGFVNEFLK-- 201

Query: 189 RNSQELSYVQQDILKNTTAQ--YRSPEMIDTFRGLPID-EKSDIWALGIFLYKLCYYTTP 245
                      D++K +     Y +PE++ + +  P +  K+DIW+ GI LY +     P
Sbjct: 202 ---------DNDLMKTSCGSPCYAAPELVISTK--PYEARKADIWSCGIILYAMLAGYLP 250

Query: 246 FE------KGGDLA-----ILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           ++      +G D+A     I     +FP Y   S   + L+R +LV DPR R N+ Q+
Sbjct: 251 WDDDPQNPEGDDIARLYYFITRTSLKFPEY--ISPIPRDLLRRLLVSDPRKRLNIRQI 306

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 103/201 (51%), Gaps = 33/201 (16%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D++   +  R+   E  ++ +Q+   V   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRGL 221
           N+L+      KL DF    G  R      +L  +        T  Y +PE++  DT+ G 
Sbjct: 158 NILLDMQGNAKLADF----GFTRECATKNQLETIC------GTTVYMAPELLRRDTYDGF 207

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLY---PNYSEQLKG----- 273
            I    DIW+LG+ LY L   + PF++  +      + E+ +    P+Y+E++       
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDET-----RTEWKIINEEPDYNEKIFNANSIE 258

Query: 274 LIRDILVQDPRHRPNVYQLLK 294
           LI+ +L++DP+ RP++ ++LK
Sbjct: 259 LIKSLLIKDPKKRPSMTEILK 279

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 101/200 (50%), Gaps = 32/200 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   V+  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHALG--IVHRDLKPEN 157

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQD--ILKNTTA--QYRSPEMIDTFRG 220
           +L+ ++   K+ DFG              ++ +Q D  +L+ +     Y +PE++    G
Sbjct: 158 LLLDSDYNIKVADFG--------------MAALQTDAALLETSCGSPHYAAPEIVS---G 200

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF-EKGGDLAIL-----SGKFEFPLYPNYSEQLKG 273
           LP +   SD+W+ G+ L+ L     PF E+ G++  L      G+FE P     S+  + 
Sbjct: 201 LPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQD 260

Query: 274 LIRDILVQDPRHRPNVYQLL 293
           LI  ILV DP  R  +  +L
Sbjct: 261 LISKILVVDPAQRIKIRDIL 280

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 100/196 (51%), Gaps = 24/196 (12%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEM----IDTFRG 220
           +L++     KL DFG V G IR        S +++D     T  + +PE+    +D +  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFP-LYPNYSEQLKGLIRD 277
              +EK+DIW+LGI  Y+L     P  K   + +++   K + P L  ++SE  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAG 246

Query: 278 ILVQDPRHRPNVYQLL 293
            LV+ P  RP+ Y LL
Sbjct: 247 CLVKAPADRPSAYDLL 262

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 97/213 (45%), Gaps = 24/213 (11%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +  +I
Sbjct: 99  GSYLKNTSLWIIMEYCGGGSLRSLLR---PGKIDEKYIGVIMREILIALKYIH--KDNVI 153

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+ +   KLCDFG    + +     Q ++          T  + +PE+I 
Sbjct: 154 HRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTMA---------GTPYWMAPEVI- 203

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAI--LSGKFEFPLYP--NYSEQLK 272
              G+  D K+DIW+ GI  Y++     P+     L    L  K + P     NYS  +K
Sbjct: 204 -MEGVYYDTKADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIK 262

Query: 273 GLIRDILVQDPRHRPNVYQLLKRISIMQNVPCP 305
             I   L +DP  RP   +LLK   I    P P
Sbjct: 263 EFIATCLDEDPSERPTADELLKTAFIKTYKPLP 295

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 115/253 (45%), Gaps = 44/253 (17%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY E G L D++ ++   +L E E +    Q+ Q VA  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 164 NVLISANNE-YKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMI--DT 217
           N+L+       K+ DFG                    D L  T+     Y SPE++    
Sbjct: 204 NLLLDKKKRSIKIADFGMAA-------------LETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 218 FRGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKG 273
           + G P    SD+W+ GI L+ L     PF     K   L + SGK++ P +   S + K 
Sbjct: 251 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKD 304

Query: 274 LIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQLSATQNI 333
           LI  ILV DP  R  + Q      I+Q+      D +     +S LNL     L+ T NI
Sbjct: 305 LISRILVVDPNRRITIDQ------ILQHELLTKYDQKSRSKSNSDLNL-----LNRTPNI 353

Query: 334 LSLNSPTTMENTM 346
           +S +S   ++ T+
Sbjct: 354 VSFSSERDIDETI 366

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 95/199 (47%), Gaps = 33/199 (16%)

Query: 101  GSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDI 160
            GS ++F ++E+              ++ + EFE   I  Q+  G+  +H     ++HRDI
Sbjct: 1038 GSVDLFDIIEF--------------KSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDI 1081

Query: 161  KIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRG 220
            K ENV++ +    KL DFGS   +   P           D+   T   Y +PE++    G
Sbjct: 1082 KDENVIVDSKGFVKLIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVLG---G 1127

Query: 221  LPIDEKS-DIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDIL 279
             P + KS DIWA+GI LY L Y   PF    +  IL G+  F    + S++ K LI  IL
Sbjct: 1128 NPYEGKSQDIWAIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKIL 1185

Query: 280  VQDPRHRPNVYQLLKRISI 298
             +  R RP + ++ + + +
Sbjct: 1186 NRCVRKRPTIDEICQDVWL 1204

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 96/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ +R   +L E E +    Q+ QGV+  H+    + HRD+K E
Sbjct: 216 ELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--ICHRDLKPE 271

Query: 164 NVLISANNE-YKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTF 218
           N+L+   N+  K+ DFG                 V   +L+ +     Y SPE++    +
Sbjct: 272 NLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGRPY 319

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGL 274
            G P    SD+W+ GI L+ L     PF     K   L + SGKF  P   N S + K L
Sbjct: 320 HGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQ--NLSAEAKDL 373

Query: 275 IRDILVQDPRHRPNVYQLL 293
           +  ILV +P  R    ++L
Sbjct: 374 MSKILVVNPFKRIATEEIL 392

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 141/323 (43%), Gaps = 49/323 (15%)

Query: 5   QIGTYNVGTQLTVGSHQVEIIKYLTS----GGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           +IG + +G  L +GS     + Y  S         +  A+ N      +SSVA       
Sbjct: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAA----ST 71

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PD       R E+  M+LL N+  V+   D     + L       ++++EY ++G L + 
Sbjct: 72  PDSLPYGIER-EIIIMKLL-NHPNVLRLYDVWETNSNL-------YMVLEYAQKGELFNL 122

Query: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180
           +  R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG 
Sbjct: 123 LVER--GPLPEKEAIRFFRQIVIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGM 178

Query: 181 VCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIFL 236
                             +D L  T+     Y +PE++    G+P     SD+W+ G+ L
Sbjct: 179 AA-------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVIL 222

Query: 237 YKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVY 290
           + L     PF ++ G+     L + SG++E P     S   + LI  IL  DP  R    
Sbjct: 223 FALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKAR 282

Query: 291 QLLKRISIMQNVPCPINDIQVVQ 313
            +LK   ++Q  P  IND + ++
Sbjct: 283 DILKH-PLLQKYPS-INDSKSIR 303

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 95/198 (47%), Gaps = 28/198 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +       L E E +    Q+  G++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVD--HGPLPEREAINCFRQIIIGISYCHALG--IVHRDLKPEN 157

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMIDTFRGLP 222
           +L+ +    K+ DFG                    D+L+ +     Y +PE++    GLP
Sbjct: 158 LLLDSFYNIKIADFGMAA------------LQTDADLLETSCGSPHYAAPEIVS---GLP 202

Query: 223 IDE-KSDIWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLI 275
            +   SD+W+ G+ L+ L     PF E+ G+     L +  G+FE P     S   + LI
Sbjct: 203 YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLI 262

Query: 276 RDILVQDPRHRPNVYQLL 293
             ILV DPR R  +  +L
Sbjct: 263 GKILVVDPRQRIKIRDIL 280

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 118/239 (49%), Gaps = 17/239 (7%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N + E ++  I SQV +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAAN 143

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPID 224
           +L++     KL DFG V G IR     +  ++V        T  + +PE++        D
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRA--TLKRGTFV-------GTPYWMAPEVVSK-ENDGYD 192

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFP-LYPNYSEQLKGLIRDILVQ 281
           EK+DIW+LGI +Y+L     P  K   + ++    K + P L+ +YS   K  +   LV+
Sbjct: 193 EKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCLVK 252

Query: 282 DPRHRPNVYQLLKRISIMQ-NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNSP 339
           +P  R + Y++++   + Q  VP    D++ ++   S+ N +   + S    +   ++P
Sbjct: 253 NPVGRASAYEMVEHNFVNQLAVPNLKEDVEYLKIKKSNDNYSRSPKYSLENRLYDGSAP 311

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 137/312 (43%), Gaps = 46/312 (14%)

Query: 6   IGTYNVGTQLTVGSH---QVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPD 62
           IG + +G  L +GS    Q+   +        ++ S  I    P+SN +         PD
Sbjct: 19  IGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVAN---TPD 75

Query: 63  KPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMN 122
                  R E+  M+LL++   V+S  D     + L       ++++EY E+G L + + 
Sbjct: 76  SLPYGIER-EIIIMKLLRHAN-VLSLYDVWETNSNL-------YMILEYAEKGELFNLLV 126

Query: 123 TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVC 182
            +    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+      K+ DFG   
Sbjct: 127 EK--GPLPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA 182

Query: 183 GIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIFLYK 238
                           +D L  T+     Y +PE++    G+P    +SD+W+ G+ L+ 
Sbjct: 183 -------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFA 226

Query: 239 LCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           L     PF E+ G+     L + SG+FE P     S   + LI  IL  DP  R    ++
Sbjct: 227 LLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREI 286

Query: 293 LKRISIMQNVPC 304
           LK   ++Q  P 
Sbjct: 287 LKH-PLLQKYPS 297

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 133/294 (45%), Gaps = 31/294 (10%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA   ++ +  + +   L +E+   + +K+   +V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 137

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 138 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH  +  +IHRD+K+ N+   +N   K+ DFG    +     N +E  Y         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 237

Query: 207 AQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEF 261
             Y +PE++   +      + DIW++G+ +Y L     PF+   ++ I+     SG + F
Sbjct: 238 PNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYIF 295

Query: 262 PLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315
           P     S+++  LI+DIL  DP  RP++ +++  +      P  IN   +   P
Sbjct: 296 PREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVP 349

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 140/336 (41%), Gaps = 66/336 (19%)

Query: 15  LTVGSHQVEIIKYLTSGGFAQVY-----SALINPPDPHSNSSVACLKRVIVP--DKPSLN 67
           L++   +  I K L    F+ +Y      ++     P +N  +  LKR+  P  +  S++
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTN--LYALKRIRCPFGNIESIS 83

Query: 68  TLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQN 127
               EVD  +  ++  Y++  +DS  A+    +GS  V++L+ Y   G L D  +  L N
Sbjct: 84  GAMKEVDNYKRFQSP-YIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLN 140

Query: 128 R--LHEFEILQIMSQVTQGVAAMH--------ALQ---------------------PPL- 155
              + E E ++I+  + +G+  +H        A Q                      PL 
Sbjct: 141 GTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLE 200

Query: 156 ---------------IHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQD 200
                           HRDIK  N+L S++    + + GS            +L+ +Q  
Sbjct: 201 LDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAW 260

Query: 201 ILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-----GGDL--A 253
           +  + T  Y +PE++       +D K DIW+LG   Y + +  +PFE+     G  L  A
Sbjct: 261 VSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYA 320

Query: 254 ILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNV 289
           I +G F FP    YSE L  LI   L  +P  RP++
Sbjct: 321 IGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 82.8 bits (203), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 84/321 (26%), Positives = 143/321 (44%), Gaps = 45/321 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEM----IDTFRG 220
           +L++     KL DFG V G IR        S  ++D     T  + +PE+    +D +  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG-------KFEFPLYPNYSEQLKG 273
              +EK+DIW+LGI  Y+L     P  K   + +++        K + P    +SE  K 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSEAAKE 247

Query: 274 LIRDILVQDPRHRPNVYQLLKRISIMQNVPCP--INDIQVVQAPSSHLNLTELHQLSATQ 331
            +   LV+ P  RP+ Y LL     ++N+      +D+++++        T++ +    Q
Sbjct: 248 FVAGCLVKTPADRPSAYDLLS-FEFIKNITVTNLKSDVELIKKKKGQERYTKVPKY-PLQ 305

Query: 332 NILSLNSPTTMENTMPN------ATFQISMADNTTTAQMHPNRKPSQIAYDASFSNSAKG 385
           N L  NS T       N      +T QIS  + +   Q  P    S +  ++ +    + 
Sbjct: 306 NRLYKNSNTVRGKEFWNFESARLSTTQISKKELSPITQDSPT---SSLNMESPYMLHGQT 362

Query: 386 SQPLFDKSQNMYHALDPPLVE 406
             P+ + S + +     P+ E
Sbjct: 363 VTPITNPSSSSFRKCTQPVFE 383

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 98/203 (48%), Gaps = 23/203 (11%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++LMEY   G L   +  R     ++    + + Q+   +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPID 224
           +LI  NN  KL DFG    II P         V++  L  T   Y SPEMI   R    D
Sbjct: 220 ILIGFNNVIKLTDFG--WSIINP-------RGVKRKTLCGTI-DYLSPEMI---RSREYD 266

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGD----LAILSGKFEFPLYPNYSEQLKGLIRDILV 280
           +K D+WALG+  Y+L   + PFE+         IL    +FP     S  +K LI  +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFP--ETVSHDVKDLISKLLK 324

Query: 281 QDPRHRPNVYQLLKRISIMQNVP 303
            +P  R ++  ++K   I++N P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 130/295 (44%), Gaps = 33/295 (11%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +  D  +  +VA   +  +  + +   L +E+   + + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID     +        V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+   +N   K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFE 260
             Y +PE ++    G   +   DIW+LG+ LY L     PF+   D+      I    F 
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315
           FP     S++ K LIRDIL  DP  RP++ +++  +      P  I    + + P
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEVP 354

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 122/265 (46%), Gaps = 46/265 (17%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  R   RL E    ++ SQ+  GV  +H+    L+
Sbjct: 118 VLQNSRY-IGIVLEYACGGEFYRYIQKR--RRLKEINACRLFSQLISGVHYIHSKG--LV 172

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V                + +++K +     Y +PE+
Sbjct: 173 HRDLKLENLLLDKNENLVITDFGFVNEFC-----------SRNELMKTSCGSPCYAAPEL 221

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLAILSGKFEF-PL-YP 265
           +      P +  K+DIW+ G+ LY +     P++      +G D+  L       PL +P
Sbjct: 222 V--ISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYNYISLTPLKFP 279

Query: 266 NYSEQL-KGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLNLT-- 322
           +Y   + + L+R ILV DP+ R N+ Q+ K               + ++   S L++T  
Sbjct: 280 DYILPIPRDLLRRILVSDPKRRINLKQIKKH--------------EWLKPHFSFLSITPD 325

Query: 323 ELHQLSATQNILSLNSPTTMENTMP 347
           E  +L  TQ+I  L  PT    + P
Sbjct: 326 EWDKLQNTQSIFRLAKPTRRYGSRP 350

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 131/295 (44%), Gaps = 33/295 (11%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +  +  +  +VA   +  +  + +   L +E+   + + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSHPN-IV 142

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID     +        V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+   +N   K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFE 260
             Y +PE ++    G   +   DIW+LG+ LY L     PF+   D+      I    F 
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315
           FP     S++ K LIRDIL  DP  RP++ +++  +      P  I    + +AP
Sbjct: 300 FPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAP 354

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 82.4 bits (202), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 126/270 (46%), Gaps = 36/270 (13%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G F  VY A     +  S   VA     +      +N L  E+  +  LK+  Y+ +YI 
Sbjct: 26  GNFGDVYKAC----EKVSGKVVAVKVVNLEHTDEDINLLAQEIFFLAELKSP-YITNYIT 80

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           +      +       +++MEYC  G   D +       L E +   I  +V +G+  +H 
Sbjct: 81  TMTEDVSM-------WIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHE 133

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
            +   IHRDIK  N+L++   + KL DFG V G IR     +  ++V        T  + 
Sbjct: 134 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TLKRGTFV-------GTPFWM 181

Query: 211 SPEMI----DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFP-L 263
           +PE++    D +     DEK+DIW+LGI +Y+L   + P  K   + ++    K + P L
Sbjct: 182 APEVVSKDSDGY-----DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVL 236

Query: 264 YPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
           + +YS   K  +   LV++P++RP+  +LL
Sbjct: 237 HGHYSSAAKHFVASCLVKNPKNRPSAVELL 266

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 134/302 (44%), Gaps = 30/302 (9%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA   ++ +  + +   L +E+   + +++   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHPN-IV 133

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            + D              V++L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFEDDT-------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYTI-----CGT 233

Query: 207 AQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILS----GKFEFP 262
             Y +PE++ T +      + D+W++G+ +Y L     PF+      I        F FP
Sbjct: 234 PNYIAPEVL-TGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFNFP 292

Query: 263 LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSH-LNL 321
                S + K LI+DIL  DP  RP++ ++++ +      P  IN   +   P  H L+L
Sbjct: 293 RDKPISSEAKVLIKDILSLDPLERPSLTEIMEYVWFRNVFPMRINGDVLNFVPEYHDLDL 352

Query: 322 TE 323
            E
Sbjct: 353 QE 354

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 100/200 (50%), Gaps = 32/200 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   ++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GPLPEREAIKCFKQIIIAISYCHALG--IVHRDLKPEN 157

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQD--ILKNTTA--QYRSPEMIDTFRG 220
           +L+  +   K+ DFG              ++ +Q D  +L+ +     Y +PE++    G
Sbjct: 158 LLLDNSYNIKIADFG--------------MAALQTDAGMLETSCGSPHYAAPEIVS---G 200

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKG 273
           LP +   SD+W+ G+ L+ L     PF E+ G+     L +  G+FE P     S   + 
Sbjct: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260

Query: 274 LIRDILVQDPRHRPNVYQLL 293
           LIR ILV DP  R  +  +L
Sbjct: 261 LIRRILVVDPTQRIKIRDIL 280

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 95/202 (47%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +  +I
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKVIH--KDNVI 134

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+   + KLCDFG    + +     Q ++          T  + +PE+I 
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI- 184

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLA----ILSGKFEFPLYPNYSEQLK 272
              G+  D K DIW+LGI  Y++     P+     L     I+  K       NY+ QLK
Sbjct: 185 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLK 243

Query: 273 GLIRDILVQDPRHRPNVYQLLK 294
             I   L +DP+ R +  +LLK
Sbjct: 244 EFIALCLDEDPQERLSAEELLK 265

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 129/269 (47%), Gaps = 30/269 (11%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G F  VY A+    D  +   VA     +      +  +  E+  +  LK+  Y+ +YI 
Sbjct: 30  GNFGDVYKAI----DKLTGEIVAIKVVNLESSDEDIELIAQEIFFLAELKS-PYITNYIT 84

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           +     ML + S  ++++MEYC  G   D +       LHE ++  I   V +G+  +H 
Sbjct: 85  T-----MLEDVS--MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE 137

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
            +   IHRD+K  NVL++ +   KL DFG V G +R    ++  ++V        T  + 
Sbjct: 138 QRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLRS--TAKRNTFV-------GTPYWM 185

Query: 211 SPEMI-DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK---GGDLAILSGKFEFPLYPN 266
           +PE+I ++  G   +EK+DIW+LGI +Y+L     P+ K   G  +  +  K       +
Sbjct: 186 APEIISNSSHGY--NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVS 243

Query: 267 YSEQLKGLIRDILVQDPRHRPNVYQLLKR 295
           +S+  K  I   L++DP  RP   +LL++
Sbjct: 244 FSDAAKLFISACLIKDPDERPTATELLQQ 272

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 96/351 (27%), Positives = 156/351 (44%), Gaps = 59/351 (16%)

Query: 5   QIGTYNVGTQLTVGS-HQVEI-IKYLT--SGGFAQVYSALINPPDPHSNSSVACLKRVIV 60
           ++G + +G  L  GS  +V++    +T  S    ++  A+ +      NSS+A       
Sbjct: 16  KVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAPGNSSIAA----ST 71

Query: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120
           PD P    +  E+  M+LL N+  V+   D       L       ++++EY E+G L + 
Sbjct: 72  PD-PLPYGIEREIIIMKLL-NHPNVLRLYDVWETNPSL-------YMVLEYAEKGELFNL 122

Query: 121 MNTRLQNR-LHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179
           +   ++N  L E E +    Q+  GV+  HAL   ++HRD+K EN+L+  +   K+ DFG
Sbjct: 123 L---VENGPLPENEAVCFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHDLNIKIADFG 177

Query: 180 SVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE-KSDIWALGIF 235
                              +D L  T+     Y +PE++    G+P     SDIW+ G+ 
Sbjct: 178 MAA-------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDIWSCGVI 221

Query: 236 LYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNV 289
            + L     PF E+ G+     L + SGKFE P     S + + L+  IL  DP  R   
Sbjct: 222 FFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKP 281

Query: 290 YQLLKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQLSAT------QNIL 334
            ++LK   ++Q  P   ++  +   P      T LH LS +      QNIL
Sbjct: 282 REILKH-PLLQKYPNVSDNKSIRNLPRED---TYLHPLSDSGSSEVDQNIL 328

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 85/180 (47%), Gaps = 20/180 (11%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
            G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y +PE++    G P + K  DIWALG
Sbjct: 1301 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVL---SGEPYEGKPQDIWALG 1346

Query: 234  IFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
            I LY + +   PF    +  IL G  +F      +E    LI+ +L++  R+RP + ++ 
Sbjct: 1347 ILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIF 1404

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 95/199 (47%), Gaps = 31/199 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+F+++EY + G L D++ +R   RL E E +    Q+ +G A  H+    + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPE 186

Query: 164 NVLISANNE-YKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTF 218
           N+L+   N+  K+ DFG                     +L+ +     Y SPE++   T+
Sbjct: 187 NLLLDKKNKRIKIADFGMAA------------LQTSNKLLETSCGSPHYASPEIVMGKTY 234

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGL 274
            G P    SD+W+ GI L+ L     PF     K   L + +GK++ P     S + + L
Sbjct: 235 NGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQA--ISLEAQDL 288

Query: 275 IRDILVQDPRHRPNVYQLL 293
           I  ILV DP  R  +  +L
Sbjct: 289 ISRILVVDPNKRITINDIL 307

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 96/386 (24%), Positives = 165/386 (42%), Gaps = 64/386 (16%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINP-------PDPHSNSSVAC--LK 56
           IGT +    +T G + V     L  G F +V      P       P   +   VA   ++
Sbjct: 36  IGTRSRKRNVTFGPYIVG--STLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIR 93

Query: 57  R-VIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERG 115
           R  IV +      +  E++A++ L +   +V        + +L N  Y + +++EY   G
Sbjct: 94  RDTIVRNSDKETKIYREINALKHLTHPNIIV-------LEEILQNSKY-IGIVLEYASGG 145

Query: 116 GLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKL 175
               ++  + + RL E    ++ SQ+  GV  MH+    L+HRD+K+EN+L+  N    +
Sbjct: 146 EFYKYI--QRKRRLKEVNASRLFSQLVSGVHYMHSKG--LVHRDLKLENLLLDKNENLMI 201

Query: 176 CDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ---YRSPEMIDTFRGLPIDEKSDIWAL 232
            DFG V              +  +++L  T+     Y +PE++   R   +  K DIW+ 
Sbjct: 202 TDFGFVN------------EFSNENVLMKTSCGSPCYAAPELV-VSREAYVGVKVDIWSC 248

Query: 233 GIFLYKLCYYTTPFE------KGGDLAIL-SGKFEFPL-YPNYSEQL-KGLIRDILVQDP 283
           G+ LY +     P++       G D++ L S     PL +P+Y   L + L+R ILV DP
Sbjct: 249 GVILYAMLAGYLPWDDDPSNPNGDDISKLYSYITATPLKFPDYVNPLPRDLLRRILVADP 308

Query: 284 RHR------PNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLN 337
           R R       N   LL R   +   P   ++I  ++   S L            + ++ +
Sbjct: 309 RRRYTLGHIENHEWLLPRREFLSVSPSDWDNIMKLKNDKSALE---------RNSPVTGS 359

Query: 338 SPTTMENTMPNATFQISMADNTTTAQ 363
            P++M    P   F  +++ N T  Q
Sbjct: 360 RPSSMVRIDPGKPFPRNLSSNGTARQ 385

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 139/314 (44%), Gaps = 31/314 (9%)

Query: 26  KYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYV 85
           ++L  GGFA+ +          +  +VA   ++ +  + +   L +E+   + +K+   +
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKHQN-I 201

Query: 86  VSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGV 145
           V ++D              V++L+  C  G L++ +  R    L E E+     Q+   +
Sbjct: 202 VQFVDCFEDHI-------NVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT 205
             MH+ +  +IHRD+K+ N+    N   K+ DFG    +     N +E  Y         
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVLA----NDRERKYTVCG----- 301

Query: 206 TAQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILS----GKFE 260
           T  Y +PE ++    G   +   DIW++G+ ++ L     PF+      I S     ++ 
Sbjct: 302 TPNYIAPEVLLGKHSGHSYE--VDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYT 359

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLN 320
           FP+  + S++ K LI+DIL+ DP  RP++ ++++ +      P   ++    + P     
Sbjct: 360 FPINKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQF 419

Query: 321 LTELHQLSATQNIL 334
           LT    L+  +N +
Sbjct: 420 LTPNESLNNFRNCM 433

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/275 (27%), Positives = 131/275 (47%), Gaps = 35/275 (12%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G    VY+A     +  +N+SVA +K++ +  +P    +  E+  M+  K+ R +V++ID
Sbjct: 664 GASGGVYTAY----ELGTNASVA-IKQMNLEKQPKKELIINEIMVMKGSKH-RNIVNFID 717

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           S+  K        +++V+MEY E G L D +   +   L E +I  +  +   G+  +H+
Sbjct: 718 SYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFLHS 767

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
               +IHRDIK +N+L+S   E KL DFG  C  I       E++  +  ++   T  + 
Sbjct: 768 KG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYWM 816

Query: 211 SPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEFPLYP 265
           +PE++      P   K DIW+LGI + ++     P+     L  L     +G  +     
Sbjct: 817 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPD 873

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
           N  E+L+  +   L  +P  R +  QLLK   + Q
Sbjct: 874 NLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQ 908

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 134/278 (48%), Gaps = 30/278 (10%)

Query: 21  QVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPS-LNTLRAEVDAMRLL 79
           Q EI++ +  G F  VY A        + + +  +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKARY-----LATNEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  KNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMS 139
           ++  Y+ +Y       A L + S  ++++MEYC  G   + +    +++L E +   I+S
Sbjct: 74  RSP-YITNY-----KTAFLVDVS--MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVS 125

Query: 140 QVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQ 199
           +V  G+  +H+ +   IHRDIK  N+L++ N   KL DFG V G        Q +   ++
Sbjct: 126 EVLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSG--------QMMVTRKR 174

Query: 200 DILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG-- 257
           D    T   + +PE+ID  +    +E +DIW+LGI + +L     P +K   +  L    
Sbjct: 175 DTFVGTPF-WMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 258 KFEFP-LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
           K + P L   +S   K  +   L++DP  RP   +LLK
Sbjct: 233 KRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 147/311 (47%), Gaps = 47/311 (15%)

Query: 6   IGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPS 65
            G Y VG+  T+G  +   +K     G+++  S+ ++ P      ++  ++R  +P    
Sbjct: 37  FGPYIVGS--TLGEGEFGKVKM----GWSKTSSSSMDVPK---QVAIKLIRRDTIPKNSE 87

Query: 66  LNT-LRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTR 124
               +  E++A++ L N+  +V        + +L N  Y + +++EY   G    ++  +
Sbjct: 88  KEVKIYREINALKHL-NHPNIVRL------EEVLQNSKY-IGIVLEYASGGEFYKYIQKK 139

Query: 125 LQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGI 184
              RL E    ++ +Q+  GV  MH+    L+HRD+K+EN+L+  N    + DFG V   
Sbjct: 140 --RRLKESAACRLFAQLISGVYYMHSKG--LVHRDLKLENLLLDKNENLLITDFGFVNEF 195

Query: 185 IRPPRNSQELSYVQQDILKNTTAQ--YRSPEMIDTFRGLPID-EKSDIWALGIFLYKLCY 241
           +  P N         +++K +     Y +PE++ T R  P +  K+DIW+ G+ +Y +  
Sbjct: 196 L--PEN---------ELMKTSCGSPCYAAPELVVTAR--PYEARKADIWSCGVIMYAMLA 242

Query: 242 YTTPFE------KGGDLAILSGKF-EFPL-YPNYSEQL-KGLIRDILVQDPRHRPNVYQL 292
              P++       G D+  L       PL +P+Y   + + L+R ILV DP+ R  + Q 
Sbjct: 243 GYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDYIAPVPRDLLRAILVADPKKRITIAQT 302

Query: 293 LKRISIMQNVP 303
           L    +  ++P
Sbjct: 303 LHHQWLQPHLP 313

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 96/196 (48%), Gaps = 17/196 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E       SQ+   V ++H++   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELS-----YVQQDILKNTTAQYRSPEMI-DTF 218
           +L+  + + KL DFG+   +   P N+ +       Y +       TA+Y SPE++ D++
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVG-TAEYVSPELLNDSY 313

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFPLYPNYSEQLKGLIR 276
                D + DIWA G  LY++     PF+   +        K ++     + + +K L++
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVK 369

Query: 277 DILVQDPRHRPNVYQL 292
            +LV+DP  R  + Q+
Sbjct: 370 KLLVRDPNDRLAIEQI 385

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 99/200 (49%), Gaps = 30/200 (15%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  +    L E E ++   Q+  G++  HAL   ++HRD+K EN
Sbjct: 118 LYMVLEYAEKGELFNLLVEK--GPLAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPEN 173

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGL 221
           +L+   +  K+ DFG                   +D L  T+     Y +PE++    GL
Sbjct: 174 ILLDHKSNIKIADFGMAA-------------LETEDKLLETSCGSPHYAAPEIVS---GL 217

Query: 222 PIDE-KSDIWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGL 274
           P +  ++DIW+ G+ L+ L     PF E+ G+     L +  G+FE P     S + + L
Sbjct: 218 PYNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDL 277

Query: 275 IRDILVQDPRHRPNVYQLLK 294
           I  IL  +P+ R    ++LK
Sbjct: 278 IGKILTVNPKQRIKTREILK 297

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 109/219 (49%), Gaps = 30/219 (13%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  +   RL E    ++ +Q+  GV  MH+    L+
Sbjct: 113 VLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEGPACRLFAQLISGVYYMHSKG--LV 167

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V   +  P N         +++K +     Y +PE+
Sbjct: 168 HRDLKLENLLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPEL 216

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLAILSGKF-EFPL-YP 265
           + T R  P +  K+D+W+ G+ LY +     P++       G D+  L       PL +P
Sbjct: 217 VVTAR--PYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFP 274

Query: 266 NYSEQL-KGLIRDILVQDPRHRPNVYQLLKRISIMQNVP 303
           +Y   + + L+R+IL+ DP+ R  + + LK   +  ++P
Sbjct: 275 DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPHMP 313

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 136/278 (48%), Gaps = 30/278 (10%)

Query: 21  QVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPS-LNTLRAEVDAMRLL 79
           Q EI++ +  G F  VY A     D  SN  VA +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKA----RDLTSNEIVA-IKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  KNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMS 139
           ++  Y+ +Y       A L + S  ++++MEYC  G   + +    ++++ E +   I+S
Sbjct: 74  RSP-YITNY-----KTAFLVDVS--MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVS 125

Query: 140 QVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQ 199
           +V  G+  +H+ +   IHRDIK  N+L++ N   KL DFG V G        Q +   ++
Sbjct: 126 EVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSG--------QMMVTRKR 174

Query: 200 DILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG-- 257
           D    T   + +PE+ID  +    +E +DIW+LGI + +L     P +K   +  L    
Sbjct: 175 DTFVGTPF-WMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 258 KFEFP-LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
           K + P L   +S   +  +   L++DP  RP   +LLK
Sbjct: 233 KRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 113/232 (48%), Gaps = 32/232 (13%)

Query: 85  VVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQG 144
           ++S+ +  A   +  N S E+++++EY + G L D++ ++   +L E E +    Q+ QG
Sbjct: 192 LISHPNVMALYEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQG 248

Query: 145 VAAMHALQPPLIHRDIKIENVLISANNE-YKLCDFGSVCGIIRPPRNSQELSYVQQDILK 203
           V+  H+    + HRD+K EN+L+   N+  K+ DFG +  +  P +           +L+
Sbjct: 249 VSYCHSFN--ICHRDLKPENLLLDKKNKSIKIADFG-MAALELPNK-----------LLQ 294

Query: 204 NTTA--QYRSPEMI--DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAIL 255
            +     Y SPE++   ++ G P    SD+W+ GI L+ L     PF     K   L + 
Sbjct: 295 TSCGSPHYASPEIVMGKSYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQ 350

Query: 256 SGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPIN 307
           +GKF  P     S + + LI  ILV DP  R    ++L    I++  P   N
Sbjct: 351 AGKFRMP--STLSPEAQDLISRILVIDPSKRITTDRILNHPLILKYEPAGKN 400

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 94/196 (47%), Gaps = 17/196 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E       SQ+   V ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELS-----YVQQDILKNTTAQYRSPEMI-DTF 218
           +L+  N + KL DFG+   +   P N+ +       Y +       TA+Y SPE++ D +
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG-TAEYVSPELLNDNY 313

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFPLYPNYSEQLKGLIR 276
                D + DIWA G  LY++     PF+   +        K ++     + + +K L++
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVK 369

Query: 277 DILVQDPRHRPNVYQL 292
            +LV+DP  R  + Q+
Sbjct: 370 KLLVRDPNDRLTIKQI 385

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 97/193 (50%), Gaps = 16/193 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +    +  L E +   I  +V +G+  +H  +   IHRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPID 224
           +L++ +   KL DFG V G I+        + +++D    T   + +PE++        +
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIK--------ATLKKDTFVGT-PYWMAPEVVKKDES-GYN 192

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFP-LYPNYSEQLKGLIRDILVQ 281
           EK+DIW+LGI +Y+L     P  K   + ++    K   P L+ +YSE  K  I   L++
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLIK 252

Query: 282 DPRHRPNVYQLLK 294
           DP  RPN   L K
Sbjct: 253 DPNARPNAKTLSK 265

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 98/200 (49%), Gaps = 32/200 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ +VT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEM----IDTFRG 220
           +L++     KL DFG V G IR        S +++D     T  + +PE+    +D +  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG-------KFEFPLYPNYSEQLKG 273
              +EK+DIW+LGI  Y+L     P  K   + +++        K + P    +S+  K 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKD 247

Query: 274 LIRDILVQDPRHRPNVYQLL 293
            +   LV+ P  RP+ Y LL
Sbjct: 248 FVAGCLVKTPADRPSAYNLL 267

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 86/180 (47%), Gaps = 19/180 (10%)

Query: 111  YCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISAN 170
            + E G +  F    L+  + EFE   I  QV  G+  +H  +  ++HRDIK ENV++ + 
Sbjct: 1065 HGETGSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSK 1122

Query: 171  NEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEK-SDI 229
               KL DFGS   +   P           D+   T   Y +PE++    G P + K  DI
Sbjct: 1123 GFVKLIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVLG---GEPYEGKPQDI 1168

Query: 230  WALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNV 289
            WA+GI LY + +   PF    +  I+ G  +F +    SE+   LI+ IL ++   RP +
Sbjct: 1169 WAVGILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTI 1226

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 129/271 (47%), Gaps = 38/271 (14%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRV-IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYI 89
           G F  VY A+       +   +  +K V +      +  L  E+  +  LK+   + +YI
Sbjct: 22  GNFGDVYKAM-----DRTTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSP-LITNYI 75

Query: 90  DSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMH 149
            +     ML + S  ++++MEYC  G   D +     N L E ++  I+ QVT G+  +H
Sbjct: 76  TT-----MLEDVS--MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLH 128

Query: 150 ALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQY 209
             +   IHRDIK  N+L++     KL DFG V G +R        S +++D     T  +
Sbjct: 129 EQRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYW 176

Query: 210 RSPEM----IDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFP- 262
            +PE+    +D +     +EK+DIW+LGI  Y+L     P  K   + +++   K + P 
Sbjct: 177 MAPEVVCCEVDGY-----NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPK 231

Query: 263 LYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
           L  ++S+  K  +   LV+ P  RP+ Y LL
Sbjct: 232 LQGSFSDAAKEFVAGCLVKVPADRPSAYDLL 262

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 102/196 (52%), Gaps = 17/196 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G L+  +  +      E   +   +Q+   +  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT-----TAQYRSPEMI-DTF 218
           +L++ + + KL DFG+   I+ P + SQ  S    ++L+ +     TA+Y SPE++ D++
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFPLYPNYSEQLKGLIR 276
                D + DIWA G  L++L     PF+   +        K ++     +   L+ LI+
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIK 504

Query: 277 DILVQDPRHRPNVYQL 292
            IL+++P +R  ++Q+
Sbjct: 505 KILIKNPNNRLTIHQI 520

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 129/295 (43%), Gaps = 33/295 (11%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA   ++ +  + +   L +E+   + +K+   +V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHVN-IV 155

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 156 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+        K+ DFG    +     N +E  Y         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLA----NDRERKYTVCG-----T 255

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFE 260
             Y +PE ++    G   +   DIW++G+ +Y L     PF+   D+      I    F 
Sbjct: 256 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALIIGRPPFQ-SKDVNTIYERIKCRDFS 312

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315
           FP     S + K LI+DIL  DP  RP+V +++  I      P    +  +V+ P
Sbjct: 313 FPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKESVMVEVP 367

>Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 105/215 (48%), Gaps = 21/215 (9%)

Query: 102 SYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ------IMSQVTQGVAAMHALQPPL 155
           S +V++++EYC RG +      +L+ +     IL       I+S V  G+  +H+    +
Sbjct: 128 SAKVYLVLEYCSRGPVKWCPENQLEIKAVGPPILSFQQARNIVSDVVSGLEYLHSQG--I 185

Query: 156 IHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT---TAQYRSP 212
           IHRDIK  N+LIS+N   K+ DFG     I     S  +    + ILK+    T  + +P
Sbjct: 186 IHRDIKPSNLLISSNGTVKISDFGVS---ILTAAESTNIQSSHEPILKSKTFGTPAFFAP 242

Query: 213 EMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPL-YPNYSEQL 271
           E+  T          DIW+LG+ LY L + T PF     L +       PL +P+Y E L
Sbjct: 243 ELCSTETYCCRSSAIDIWSLGVTLYCLLFGTLPFNANSGLELFDNIINKPLDFPSYEEIL 302

Query: 272 KGLIRDILVQDPRHRPN-VYQLL-----KRISIMQ 300
           K    ++ +++ R   + +Y+LL     +RIS+ +
Sbjct: 303 KHDSSNVTIEEYRDAKDLLYKLLEKNPSRRISLAE 337

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 128/304 (42%), Gaps = 67/304 (22%)

Query: 6   IGTYNVGTQLTVGSH-QVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKP 64
           IG + +G  L  GS  +V + K + +G  A +                      IVP   
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIK---------------------IVPKTK 93

Query: 65  SLNT------LRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLI 118
           S  T      +  E+  M+L+ +   +  Y         +     E+F+++EY + G L 
Sbjct: 94  SSRTGSLPYGIEREIIIMKLISHPNVMGLY--------EVWENKLELFLVLEYVDGGELF 145

Query: 119 DFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNE-YKLCD 177
           D++ +R   RL E E +    Q+ +G A  H     + HRD+K EN+L+   N+  K+ D
Sbjct: 146 DYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPENLLLDKKNKRIKIAD 201

Query: 178 FGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTFRGLPIDEKSDIWALG 233
           FG                     +L+ +     Y SPE++    + G P    SD+W+ G
Sbjct: 202 FGMAA------------LQTSNKLLETSCGSPHYASPEIVMGKNYNGGP----SDVWSCG 245

Query: 234 IFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNV 289
           I L+ L     PF     K   L + +GK++ P   + S   + LI  ILV DP  R ++
Sbjct: 246 IILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--SVSSGAQDLISRILVVDPDKRISI 303

Query: 290 YQLL 293
            ++L
Sbjct: 304 NEIL 307

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 107/219 (48%), Gaps = 32/219 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  +    L E E ++   Q+  G++  HAL   ++HRD+K EN
Sbjct: 104 LYMVLEYAEKGELFNLLVEK--GPLPENEAIRFFRQIIIGMSYCHALG--IVHRDLKPEN 159

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGL 221
           +L+      K+ DFG                   +D L  T+     Y +PE++    GL
Sbjct: 160 ILLDHKLNIKIADFGMAA-------------LETEDKLLETSCGSPHYAAPEIVS---GL 203

Query: 222 PIDE-KSDIWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGL 274
           P    ++D+W+ G+ L+ L     PF E+ G+     L +  G+FE P     S++ + L
Sbjct: 204 PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDL 263

Query: 275 IRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQ 313
           +  ILV DP  R    ++LK   ++Q  P  I D + ++
Sbjct: 264 LYKILVVDPEKRIKSREILKH-PLLQKYPS-IKDSKTIR 300

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 132/294 (44%), Gaps = 64/294 (21%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY AL  P          CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRPTHRK-----VCLK---TSDKNDPNIVR------ 81

Query: 77  RLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ 136
            +  + ++   YI       +  +   +V++ +EYC    L D + +   +R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYDHLLS--LHRISLLECGE 136

Query: 137 IMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSY 196
           + +Q++  V   H++    +HRD+K+EN+L+  N   KL DFG                +
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------F 178

Query: 197 VQQDILKNT------TAQYRSPEMID--TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            ++ + K T      T  Y +PE+I   T+ G  I    D W+LG+ LY L   + PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDD 234

Query: 249 GGDLAILSGKFEFPLY---PNYSEQL-----KGLIRDILVQDPRHRPNVYQLLK 294
             +      K ++ +    P Y  +L     K LI  +L ++P  RP++ Q+L+
Sbjct: 235 DDE-----AKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVLR 283

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 103/207 (49%), Gaps = 45/207 (21%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L D + +   +R+   E +Q+ +Q+  GV   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT------TAQYRSPEMID- 216
           N+L+  + + KL DFG                + ++ + K T      T  Y +PE+I+ 
Sbjct: 159 NILLDKSGDAKLTDFG----------------FTRECMTKTTLETICGTTVYMAPELIER 202

Query: 217 -TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLY---PNYSEQL- 271
            ++ G  I    DIW+LG+ LY +   + PF++  +      K E+ +    P  +E + 
Sbjct: 203 KSYDGFKI----DIWSLGVILYTMINGSMPFDEDDET-----KTEWKIVHQTPQLNENIV 253

Query: 272 ----KGLIRDILVQDPRHRPNVYQLLK 294
               K LI  +L ++P  RP V Q+LK
Sbjct: 254 TADAKDLILRLLAKNPNDRPTVEQILK 280

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 130/295 (44%), Gaps = 33/295 (11%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +  +  +  +VA   +  +  + +   L +E+   + + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSHPN-IV 142

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID     +        V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+   +N   K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFE 260
             Y +PE ++    G   +   DIW+LG+ LY L     PF+   D+      I    F 
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315
           FP     S++ K LIRDIL  DP  RP++ +++  +      P  I    + + P
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPATVMSEVP 354

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 143/326 (43%), Gaps = 64/326 (19%)

Query: 1   MNQPQIGTYNVGTQLTVGS-HQVEI-----------IKYLTSGGFAQVYSALINPPDPHS 48
           M    IG + +G  L +GS  +VE+           IK ++   F+Q     +      S
Sbjct: 10  MKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQ---GTVGESSMVS 66

Query: 49  NSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVL 108
           NSS         PD       R E+  M+LL++   V+S  D     + L       +++
Sbjct: 67  NSS---------PDALPYGIER-EIIIMKLLRHPN-VLSLYDVWETNSKL-------YMI 108

Query: 109 MEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLIS 168
           +EY E+G L + +  R    L E E ++   Q+  G++  HAL   ++HRD+K EN+L+ 
Sbjct: 109 LEYAEKGELFNLLVER--GPLPEKEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLD 164

Query: 169 ANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRGLPIDE 225
                K+ DFG                   +D +  T+     Y +PE++    G+P   
Sbjct: 165 HKLNIKIADFGMAA-------------LETKDKMLETSCGSPHYAAPEIVS---GVPYHG 208

Query: 226 -KSDIWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKGLIRDI 278
            +SD+W+ G+ L+ L     PF E+ G+     L + SG++E P     S++ + LI  I
Sbjct: 209 FQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRI 268

Query: 279 LVQDPRHRPNVYQLLKRISIMQNVPC 304
           L  DP  R     +LK   ++Q  P 
Sbjct: 269 LTVDPEQRIKTRDILKH-PLLQKYPS 293

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 98/200 (49%), Gaps = 31/200 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L E E ++   Q+ +GV   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 164 NVLISANNEY-KLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTF 218
           N+L+    +  K+ DFG                 V   +LK +     Y SPE++   T+
Sbjct: 290 NLLLDKKRKLIKIADFGMAA------------LQVSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL----SGKFEFPLYPNYSEQLKGL 274
            G P    SD+W+ GI L+ L     PF       +L    +G+++ P Y   S+  K L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDL 391

Query: 275 IRDILVQDPRHRPNVYQLLK 294
           I  IL+ +P+ R    Q+L+
Sbjct: 392 ISRILLVNPKARLTTEQILE 411

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 96/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ ++   +L E E +    Q+  G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLISANNEY-KLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA--QYRSPEMI--DTF 218
           N+L+       K+ DFG                 V   +L+ +     Y SPE++    +
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGL 274
            G P    SDIW+ GI L+ L     PF     K   + + +G+++ P Y   S++ K L
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 275 IRDILVQDPRHRPNVYQLL 293
           I  ILV DP  R +  Q+L
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 131/294 (44%), Gaps = 31/294 (10%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA   ++ +  + +   L +E+   + +++   +V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHTN-IV 139

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            ++D              V++L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFVDCFEDDT-------NVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEF 261
             Y +PE++ T +      + DIW+ G+ +Y L     PF+   ++ I+      G F F
Sbjct: 240 PNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDFVF 297

Query: 262 PLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315
           P     S +   LI+DIL  DP  RP++ +++  +      P  I+   +  AP
Sbjct: 298 PKDKFISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 127/286 (44%), Gaps = 33/286 (11%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +  +  +  +VA   +  +  + +   L +E+   + + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            ++D     +        V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFVDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+   +N   K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFE 260
             Y +PE ++    G   +   DIW+LG+ LY L     PF+   D+      I    F 
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFS 299

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPI 306
           FP     S++ K LIRDIL  DP  RP++ +++  +      P  I
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSI 345

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 90/188 (47%), Gaps = 18/188 (9%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ ++EY   G L+  +  R    L         +Q+   + A+H++   +IHRDIK EN
Sbjct: 219 LYFVLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSVG--VIHRDIKPEN 274

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKN--TTAQYRSPEMIDTFRGLP 222
           VL+ ++   KL DFG+   +   P+    L  V + +  +   TA+Y  PE++       
Sbjct: 275 VLLDSHYRAKLTDFGTAALL---PQTHSNLEQVSRHVTTSFVGTAEYVPPELLAAGHA-- 329

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGDLA----ILSGKFEFPLYPNYSEQLKGLIRDI 278
            D   D+WA    +++L     PF+   +      +++ ++ +P  P +   LK L+R +
Sbjct: 330 -DGTCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRRV 386

Query: 279 LVQDPRHR 286
           L  +PR R
Sbjct: 387 LRHEPRQR 394

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 103/211 (48%), Gaps = 31/211 (14%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           ++++++EY E+G L + +  R    L E E ++   Q+  G++  H+L   ++HRD+K E
Sbjct: 103 DLYLVLEYAEKGELFNMLVER--GPLPENEAVRAFRQIIIGISYCHSLG--VVHRDLKPE 158

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTA---QYRSPEMIDTFRG 220
           N+L+      K+ DFG                   +D L  T+     Y +PE+I    G
Sbjct: 159 NLLLDNKLNIKIADFGMAA-------------LESEDKLLETSCGSPHYAAPEIIS---G 202

Query: 221 LPIDE-KSDIWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLKG 273
           LP +   SD+W+ G+ L+ L     PF E+ G+     L +  G+FE P     +++ + 
Sbjct: 203 LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQD 262

Query: 274 LIRDILVQDPRHRPNVYQLLKRISIMQNVPC 304
           L+  +L  DP  R  + ++LK   ++Q  P 
Sbjct: 263 LLARLLTVDPSKRITIREILKH-PLLQKYPS 292

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 96/195 (49%), Gaps = 12/195 (6%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  M  +    L+E       +Q+  G+  +H  +  +IHRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHRDIKPEN 333

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI-DTFRGLPI 223
           +L+  + + KL DFG+   ++     ++E     +      TA+Y SPE++ D++    +
Sbjct: 334 ILLDKSMKVKLTDFGT-AKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPELLNDSW----V 388

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFPLYPNYSEQLKGLIRDILVQ 281
           D K DIWA G  L+++     PF+   +        K ++     +   ++ L++ ILV+
Sbjct: 389 DHKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMVVRDLVKQILVK 448

Query: 282 DPRHRPNVYQLLKRI 296
            P HR  + Q+ K +
Sbjct: 449 KPEHRLTIPQIEKHL 463

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 124/273 (45%), Gaps = 23/273 (8%)

Query: 18  GSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMR 77
           G    +  + L  G ++ V  A  N  D     +V  L +  +  +  +  +  E  A++
Sbjct: 170 GIKDFKFGEMLGDGAYSTVMLATSN--DSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQ 227

Query: 78  LLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQI 137
            L N+R ++    +   +A L       + L+EY   G L+  M  +    L+E      
Sbjct: 228 RLNNSRSIIRLFFTFQDEASL-------YFLLEYAPNGDLLSLM--KKFGSLNEECCCYY 278

Query: 138 MSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGII-RPPRNSQELSY 196
            +Q+   +  MH+    +IHRDIK EN+L+  + + K+ DFG+   +  +PP  S +L  
Sbjct: 279 GAQIIDAIKFMHS--KGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLT 336

Query: 197 VQQDILKNTTAQYRSPEMI-DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL 255
             +  +   TA+Y SPE++ D +     D +SDIWA G  ++++     PF+   +    
Sbjct: 337 RSKSFV--GTAEYVSPELLNDNY----TDARSDIWAFGCIVFQMIAGKPPFKATNEYLTF 390

Query: 256 SG--KFEFPLYPNYSEQLKGLIRDILVQDPRHR 286
               K ++     +   ++ L++ IL++ P  R
Sbjct: 391 QKVMKVQYAFTAGFPTVVRDLVKRILIKAPEQR 423

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 98/215 (45%), Gaps = 29/215 (13%)

Query: 93  AAKAMLHN-----GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQ 143
           A+   +HN     GSY     ++++MEYC  G L   +      ++ E  I  IM +V  
Sbjct: 74  ASLKQIHNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLV 130

Query: 144 GVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILK 203
            +  +H     +IHRDIK  NVLI+     KLCDFG    +        + S  +Q +  
Sbjct: 131 ALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFGVAAQV-------NQTSLRRQTMAG 181

Query: 204 NTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLA----ILSGKF 259
             T  + +PE+I    G+  D K DIW+LGI  Y++     P+ +   L     I+  K 
Sbjct: 182 --TPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKP 237

Query: 260 EFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
                 +YS  LK  I   L +DP+ R +   LLK
Sbjct: 238 PRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLK 272

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 130/268 (48%), Gaps = 35/268 (13%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G    VY+A     +  +N+SVA +K++ +  +P    +  E+  M+  K++  +V++ID
Sbjct: 338 GASGGVYTAY----ELGTNASVA-IKQMNLEKQPKKELIINEILVMKGSKHSN-IVNFID 391

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           S+  K        +++V+MEY E G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 392 SYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLKGLQFLHS 441

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
               +IHRDIK +N+L+S N + KL DFG  C  I       E++  +  ++   T  + 
Sbjct: 442 KG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN------EVNLKRTTMVG--TPYWM 490

Query: 211 SPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEFPLYP 265
           +PE++      P   K DIW+LGI + ++     P+     L  L     +G  +     
Sbjct: 491 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDPE 547

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLL 293
           N S+ LK  +   L  DP  R N  +LL
Sbjct: 548 NLSDTLKEFLGWCLKVDPEDRANAAELL 575

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 94/198 (47%), Gaps = 28/198 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ ++E+   G L+  +  R   RL E    +I SQ+   V  MHA    +IHRD+K EN
Sbjct: 87  LYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHAKG--VIHRDLKPEN 142

Query: 165 VLISANNEYKLCDFGSVC----GIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRG 220
           VL+S      + DFG+ C    G   P    +  S+V        TA+Y SPE++   + 
Sbjct: 143 VLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFV-------GTAEYVSPELLLHSQ- 194

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQ------LKGL 274
                 SD+WALG  +Y+L     PF   GD  + S  FE  +  +Y         +  L
Sbjct: 195 --CSFGSDVWALGCIIYQLTQGAPPFR--GDTELQS--FEKIVALDYRWVYAAPPLIVAL 248

Query: 275 IRDILVQDPRHRPNVYQL 292
           ++ ILV DP  RP+  QL
Sbjct: 249 VQSILVLDPLQRPSAKQL 266

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 105/210 (50%), Gaps = 34/210 (16%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  +   RL E    ++ +Q+  GV  MH+    L+
Sbjct: 116 VLQNSKY-IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LV 170

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V           E ++ + +++K +     Y +PE+
Sbjct: 171 HRDLKLENLLLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPEL 219

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLA-----ILSGKFEFP 262
           + T +  P +  K+DIW+ G+ +Y +     P++      +G D+A     I     +FP
Sbjct: 220 VVTTK--PYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFP 277

Query: 263 LYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
            Y N     + L+R ILV +P+ R N+ Q+
Sbjct: 278 EYIN--PVPRDLLRRILVSNPKKRLNLRQV 305

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 128/268 (47%), Gaps = 35/268 (13%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G    VY+A     +  +N+SVA +K++ +  +P    +  E+  M+  K+   +V++ID
Sbjct: 675 GASGGVYTAY----EVGTNASVA-IKQMNLEKQPKKELIINEILVMKASKHAN-IVNFID 728

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           S+  +        +++V+MEY E G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 729 SYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 778

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
               +IHRDIK +N+L+S   E KL DFG  C  I       E++  +  ++   T  + 
Sbjct: 779 KG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQI------NEINLKRTTMV--GTPYWM 827

Query: 211 SPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEFPLYP 265
           +PE++      P   K DIW+LGI + ++     P+     L  L     +G  E     
Sbjct: 828 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDAD 884

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLL 293
           + S+ LKG +   L  DP  R    +LL
Sbjct: 885 SLSDDLKGFLGWCLHVDPDERATASELL 912

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 128/271 (47%), Gaps = 41/271 (15%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           GG A VY+A     +  +N SVA +K++ +  +P    +  E+  M+  ++   +V++ID
Sbjct: 622 GGSALVYTAY----EVGTNLSVA-IKQINLEKQPRKQLILNEIIVMKKSQHPN-IVNFID 675

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           S+     L       +V+MEY E G L D +   +   L E +I  +  +V +G+  +H+
Sbjct: 676 SYLVDGKL-------WVIMEYMEAGSLTDVVTRCI---LREGQIGAVCREVLKGLVFLHS 725

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT---TA 207
               +IHRDIK +NVL+S + + KL DFG  C          +L+ +   + +NT   T 
Sbjct: 726 --KGVIHRDIKSDNVLLSMDGDIKLTDFG-FCA---------QLNDIH--LKRNTMVGTP 771

Query: 208 QYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC-----YYTTPFEKGGDLAILSGKFEFP 262
            + +PE+++     P   K DIW+LG+ + ++      Y   P  +   L   +G  +  
Sbjct: 772 YWMAPEIVEKKHYCP---KVDIWSLGVMIIEMIEGEPPYLNEPPLRALYLIATNGTPKLK 828

Query: 263 LYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
                SE L   I   L  DP  R    +LL
Sbjct: 829 DPEKLSETLSEFINCCLFVDPELRKTAAELL 859

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 122/265 (46%), Gaps = 46/265 (17%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  +   RL E    ++ SQ+  GV  +H+    L+
Sbjct: 118 VLQNSRY-IGIVLEYACGGEFYKYIQKK--RRLKETNACRLFSQLVSGVYYIHSKG--LV 172

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V                + +++K +     Y +PE+
Sbjct: 173 HRDLKLENLLLDKNENLVITDFGFVNEFCS-----------RNELMKTSCGSPCYAAPEL 221

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLAILSGKF-EFPL-YP 265
           +      P +  K+DIW+ G+ LY +     P++      +G D+  L       PL +P
Sbjct: 222 V--ISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRLYNYINSTPLKFP 279

Query: 266 NYSEQL-KGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLNLT-- 322
           +Y   + + L+R ILV DP+ R N+ Q+ K               + + +  S L++T  
Sbjct: 280 DYILPIPRDLLRRILVPDPKKRMNLKQIKKH--------------EWLNSHFSFLSITPD 325

Query: 323 ELHQLSATQNILSLNSPTTMENTMP 347
           E  +L  TQ++  L  P T   + P
Sbjct: 326 EWDKLHNTQSVFRLGKPRTRYGSRP 350

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 132/302 (43%), Gaps = 33/302 (10%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA L    +  + +   L +E+   + +++   +V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRHAN-IV 161

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID    +         V++L+E C  G L++ +  R    L E E+    +Q+  G+ 
Sbjct: 162 QFIDCFEDET-------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    N   K+ DFG    +     N +E  Y         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 261

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFE 260
             Y +PE ++    G   +   DIW++G+ +Y L     PF+   D+      I    F 
Sbjct: 262 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKCCDFV 318

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLN 320
           FP     S + + L++D+L  DP  RP++ ++L  +      P  I    + + P     
Sbjct: 319 FPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVPDYEKK 378

Query: 321 LT 322
           +T
Sbjct: 379 IT 380

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 132/283 (46%), Gaps = 28/283 (9%)

Query: 28  LTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVS 87
           L  G ++QV+ A  +  D     +V  L +  +  +  +  +  E  A++ LK+   V++
Sbjct: 124 LGDGSYSQVFLA-TSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSVTGVIN 182

Query: 88  YIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAA 147
              +   +A L       + L+EY   G  +  +  +    L+E   +   +Q+   + +
Sbjct: 183 LSFTFQDEANL-------YFLLEYAPNGDFLSLI--KKFGTLNEECTIYYSAQIIDAIGS 233

Query: 148 MHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT-- 205
           MH+    +IHRDIK EN+L+  N + KL DFG+   + +    + +  Y   ++L  +  
Sbjct: 234 MHSHG--IIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHY---NLLTRSSS 288

Query: 206 ---TAQYRSPEMI-DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KF 259
              TA+Y SPE++ D +     D K DIWA G  +Y++     PF+   +        K 
Sbjct: 289 FVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKV 344

Query: 260 EFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNV 302
           +F     +   ++ L+++ILV+ P  R  + Q +K   + +N+
Sbjct: 345 QFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQ-IKEHCLFENI 386

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 123/265 (46%), Gaps = 46/265 (17%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  +   RL E    ++ SQ+  GV  +H+    L+
Sbjct: 118 VLQNSRY-IGIVLEYACGGEFYKYIQKK--RRLKEMNACRLFSQLISGVHYIHSKG--LV 172

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V                + +++K +     Y +PE+
Sbjct: 173 HRDLKLENLLLDKNENLVITDFGFVNEFC-----------SRNELMKTSCGSPCYAAPEL 221

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLAILSGKF-EFPL-YP 265
           +      P +  K+DIW+ G+ LY +     P++      +G D+  L       PL +P
Sbjct: 222 V--ISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFP 279

Query: 266 NYSEQL-KGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSHLNLT-- 322
           +Y   + + L+R +LV DP+ R N+ Q+ K               + ++  SS L++T  
Sbjct: 280 DYILPIPRDLLRRMLVSDPKKRINLKQIKKH--------------EWLKPHSSFLSITPD 325

Query: 323 ELHQLSATQNILSLNSPTTMENTMP 347
           E  +L+ TQ++  L  P     + P
Sbjct: 326 EWDKLNNTQSVFRLAKPRRRYGSRP 350

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 133/275 (48%), Gaps = 35/275 (12%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G    VY+A     +  +N+SVA +K++ +  +P    +  E+  M+  K+ + +V++ID
Sbjct: 632 GASGGVYTAY----EVGTNASVA-IKQMNLEKQPKKELIINEILVMKGSKH-QNIVNFID 685

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           S+  K        +++V+MEY E G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 686 SYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFLHS 735

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
               +IHRDIK +N+L+S N E KL DFG  C  I       E++  +  ++   T  + 
Sbjct: 736 KG--VIHRDIKSDNILLSMNGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYWM 784

Query: 211 SPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEFPLYP 265
           +PE++      P   K DIW+LGI + ++     P+     L  L     +G  +     
Sbjct: 785 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPE 841

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
             S +LK  +   L  +P  R +  +LL+ + I Q
Sbjct: 842 VLSPELKSFLAWCLNVNPDTRASATELLRDVFITQ 876

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 97/201 (48%), Gaps = 34/201 (16%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           +++++EY E+G L + +  R    L E E ++   Q+   ++  HAL   ++HRD+K EN
Sbjct: 94  LYLILEYAEKGELFNLLVDR--GPLPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPEN 149

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQD--ILKNTTA--QYRSPEMIDT--F 218
           +L+  +   K+ DFG              ++ +Q D  +L+ +     Y +PE++    +
Sbjct: 150 LLLDNDYNIKIADFG--------------MAALQTDARLLETSCGSPHYAAPEIVSGLPY 195

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPF-EKGGD-----LAILSGKFEFPLYPNYSEQLK 272
           RG      SD+W+ G+ L+ L     PF E  G+     L +  G+FE P     S+  +
Sbjct: 196 RGFA----SDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQ 251

Query: 273 GLIRDILVQDPRHRPNVYQLL 293
            LI  ILV DP  R     +L
Sbjct: 252 NLISRILVVDPTQRMKTRDIL 272

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 133/305 (43%), Gaps = 43/305 (14%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA L    +  + +   L +E+   + +KN   +V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKNVN-IV 143

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 144 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N +E  Y         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 243

Query: 207 AQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFEF 261
             Y +PE++   +      + DIW++G+ LY L     PF+   D+      I    F F
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFTF 301

Query: 262 PLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRI------------SIMQNVPCPINDI 309
           P     S + K LI+D+L  DP  RP+V +++  +             +M N+P   N +
Sbjct: 302 PKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL 361

Query: 310 QVVQA 314
            + Q+
Sbjct: 362 TMEQS 366

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 129/321 (40%), Gaps = 62/321 (19%)

Query: 8   TYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLN 67
            Y  G+++  GSH V             VY          S   +   K+V  P+K +  
Sbjct: 41  VYYRGSEINRGSHSV-------------VYKVF------DSEDRIFAGKKVHCPNKENKR 81

Query: 68  TLRAEVDAMRLL--KNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRL 125
            +  E++  +++   ++ ++V+  D     A        ++++++YC    L   +  R 
Sbjct: 82  KIIKELEIYKVICRSHHNHIVALRD-----AFQWGKESCIYMILDYCSNNSLQSILQYR- 135

Query: 126 QNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGII 185
              L+E E  ++M Q+  G+  +H     +IH D+K+ N+L     + K+CDFGS     
Sbjct: 136 -GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQLKICDFGSSFIAT 192

Query: 186 RPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRG--------LPIDEKSDIWALGIFLY 237
             PR   E+           T  Y +PE + T +         L I    DIW++GI LY
Sbjct: 193 SSPRGPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISFPIDIWSMGIVLY 243

Query: 238 KLCYYTTPFEKGGD-----------LAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHR 286
            L Y   PF K  D             I SG  EFP         + LI  +L Q+P  R
Sbjct: 244 SLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKMLSQNPLER 303

Query: 287 PNVYQLLK----RISIMQNVP 303
             + +++     R +   N P
Sbjct: 304 ITLVEIVCDPWIRFAFTNNAP 324

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 100/229 (43%), Gaps = 45/229 (19%)

Query: 83  RYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVT 142
           RY  SY+   +           ++++MEYC  G +   +      ++ E  I  IM ++ 
Sbjct: 103 RYYASYLKDTS-----------LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELL 148

Query: 143 QGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDIL 202
             +  +H  +  +IHRDIK  N+LI+     KLCDFG    + +     Q ++       
Sbjct: 149 VALHYIH--KDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNTMRRQTMA------- 199

Query: 203 KNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL---------- 252
              T  + +PE+I    G+  D K+DIW++GI  Y++     PF +   L          
Sbjct: 200 --GTPYWMAPEVI--MEGISYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSK 255

Query: 253 -AILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300
            A L GK   PL       LK  I   L +DP+ RP   +LL   + ++
Sbjct: 256 PARLEGKNHDPL-------LKEFIAMCLDEDPQERPTADKLLHESAFIK 297

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 122/271 (45%), Gaps = 58/271 (21%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  +   RL E    ++ SQ+  GV  +H+    L+
Sbjct: 118 VLQNSRY-IGIVLEYACGGEFYKYIQKK--RRLKETNACRLFSQLISGVHYIHSKG--LV 172

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V                + +++K +     Y +PE+
Sbjct: 173 HRDLKLENLLLDKNENLVITDFGFVNEFC-----------SRNELMKTSCGSPCYAAPEL 221

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLA-----ILSGKFEFP 262
           + + +  P +  K+DIW+ G+ LY +     P++      +G D+      I S   +FP
Sbjct: 222 VVSTK--PYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYNYICSTPLKFP 279

Query: 263 LY----PNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAPSSH 318
            Y    P      + L+R ILV DP+ R N+ Q+ K                 +++ SS 
Sbjct: 280 DYILPIP------RDLLRRILVSDPKRRINLKQIEKH--------------GWLKSHSSF 319

Query: 319 LNLT--ELHQLSATQNILSLNSPTTMENTMP 347
           L++T  E  +L  T ++  L  P     + P
Sbjct: 320 LSITPDEWDKLHNTHSVFRLEKPRARYGSRP 350

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 129/290 (44%), Gaps = 56/290 (19%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY AL  P          CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRPTHRK-----VCLK---TSDKNDPNIVR------ 81

Query: 77  RLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ 136
            +  + ++   YI       +  +   +V++ +EYC    L D  +     R+   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYD--HLLSLRRISLLECGE 136

Query: 137 IMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSY 196
           + +Q++  V   H++    +HRD+K+EN+L+  N   KL DFG                +
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------F 178

Query: 197 VQQDILKNT------TAQYRSPEMID--TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            ++ + K T      T  Y +PE+I+  T+ G  I    DIW+LG+ LY L     PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDD 234

Query: 249 GGDLAILSGKF--EFPLYPN--YSEQLKGLIRDILVQDPRHRPNVYQLLK 294
             D A    K   E P Y      +  + LI  +L ++P  RP++ Q+L+
Sbjct: 235 -DDEAKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVLR 283

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 126/281 (44%), Gaps = 35/281 (12%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S   +I + +  G F  VY A+    D  +   VA     +   +  ++ L  E+  +  
Sbjct: 33  SQLYDIKECVGKGSFGDVYRAI----DKETGEMVAVKIINLEETQDDIDVLAQEIYFLSE 88

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           L+   +V +Y  ++     +       +++ME+C  G   D +    ++RL E ++  I+
Sbjct: 89  LRAP-FVTTYYKTYVEDVSM-------WIVMEFCGGGSCADLLKHLPEHRLPENKVAYII 140

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
            +V  G+  +H+ +   IHRD+K  N+L++   E KL DFG V G        Q ++ ++
Sbjct: 141 REVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSG--------QIMATLK 189

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGK 258
           ++     T  + +PE+I    G   DEK+DIW+LGI   +L     P+ K   + +L   
Sbjct: 190 RNTFVG-TPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYDPMKVL--- 243

Query: 259 FEFPLY--PNYSEQLKGLIRDI----LVQDPRHRPNVYQLL 293
              PL   P    +     RD     L +DP  RP    LL
Sbjct: 244 MNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 90/201 (44%), Gaps = 19/201 (9%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++LMEY   G +   +  RL    ++      + Q+   +  MH     +IHRDIK EN
Sbjct: 177 VYLLMEYLVNGEMYKLL--RLHGPFNDILASDYIYQIANALDYMHKKN--IIHRDIKPEN 232

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPID 224
           +LI  NN  KL DFG    II PP N ++            T  Y SPEM+++      D
Sbjct: 233 ILIGFNNVIKLTDFG--WSIINPPENRRKTVC--------GTIDYLSPEMVESRE---YD 279

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDLAILS--GKFEFPLYPNYSEQLKGLIRDILVQD 282
              D WALG+  ++L     PFE+             +  +  N S+  + LI  +L  D
Sbjct: 280 HTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYD 339

Query: 283 PRHRPNVYQLLKRISIMQNVP 303
           P+ R  +  +     I++N P
Sbjct: 340 PKDRMRLGDVKMHPWILRNKP 360

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 122/289 (42%), Gaps = 41/289 (14%)

Query: 23  EIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDK----PSLNTLRAEVDAMRL 78
           E+ + L  G F +VY         H  S   C  + I  ++      L  L+ EVD    
Sbjct: 101 EVGRKLGKGKFGKVYCV------RHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLG 154

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           + +   +  Y   H  K         V++LME+   G L  + + +     ++      +
Sbjct: 155 MDHPNIIKLYAHFHDEK--------RVYLLMEHSINGEL--YKSLKNNGPFNDVLASHYI 204

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
            Q+   +  MH  +  +IHRD+K ENVLI  +N  KL DFG     I  P  S+  +   
Sbjct: 205 YQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFGWS---ILNPEGSKRKTLC- 258

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGD----LAI 254
                  T  Y SPEMI T R    DE+ D+WALG+  Y+L     PFE+         I
Sbjct: 259 ------GTIDYLSPEMI-TPR--EYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRI 309

Query: 255 LSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVP 303
           L     FP   + S+  K LI  +LV D   R ++  +     I++N P
Sbjct: 310 LKCDLNFP--ESISKDAKDLISKLLVTDTTQRLSLTGVKTHPWILKNKP 356

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 110/229 (48%), Gaps = 28/229 (12%)

Query: 72  EVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E + ++ LKN + ++S   +   ++ L       + L+EY   G L+  M  R    ++E
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDESSL-------YFLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 132 FEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNS 191
                  +Q+   +  MH     +IHRD+K EN+L+  + + KL DFG+   +     +S
Sbjct: 254 KCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTARLL-----DS 306

Query: 192 QELSYVQQDILKNT-----TAQYRSPEMI-DTFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
                ++ D+L  +     TA+Y SPE++ D +    +D + DIWA G  L+++     P
Sbjct: 307 TSEDDLKYDLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPP 362

Query: 246 FEKGGDLAILSG--KFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           F+   +        K +F     +   ++ L+++IL+++P  R  + Q+
Sbjct: 363 FKANNEYLTFQKVMKVQFAFTAGFPMTVRDLVKNILIKNPERRLLINQI 411

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 130/291 (44%), Gaps = 48/291 (16%)

Query: 27   YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTL----RAEVDAMRLLKNN 82
            ++  G F QVYSA+        N  +  +K + + D  ++  +    + E+  + +L + 
Sbjct: 1039 FIGGGTFGQVYSAI-----NLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHP 1093

Query: 83   RYVVSY-IDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMS-Q 140
              V  Y ++ H  K         V + MEYCE G L   ++     R+ +  + Q+ + +
Sbjct: 1094 NIVQYYGVEVHRDK---------VNIFMEYCEGGSLASLLD---HGRIEDEMVTQVYTFE 1141

Query: 141  VTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGII----RPPRNSQELSY 196
            + +G+A +H  Q  ++HRDIK EN+L+  N   K  DFG+   ++    R  RN+    +
Sbjct: 1142 LLEGLAYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDF 1199

Query: 197  -VQQDILKNT--TAQYRSPEMIDTFRGLPIDEK---SDIWALGIFLYKLCYYTTPFEK-G 249
             V+   L     T  Y +PE   T  G  +  K    D+WALG  + ++     P+    
Sbjct: 1200 GVETKSLNEMMGTPMYMAPE---TISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLD 1256

Query: 250  GDLAIL----SGKFEFPLYPNYSEQL---KGLIRDILVQDPRHRPNVYQLL 293
             + AI+    +G+   P  PN  E     +  +   LVQDP  R    +LL
Sbjct: 1257 NEWAIMYHVAAGR--IPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELL 1305

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 96/197 (48%), Gaps = 27/197 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           E+++++EY + G L D++ +R   +L E E +    Q+ QGV+  H+    + HRD+K E
Sbjct: 226 ELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--ICHRDLKPE 281

Query: 164 NVLISANNEYKL-CDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRG 220
           N+LI    +     DFG     +  P+   + S          +  Y SPE++   ++ G
Sbjct: 282 NLLIDKKKKSIKIADFG--MAALELPKKLLQTSC--------GSPHYASPEIVMGKSYHG 331

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFE----KGGDLAILSGKFEFPLYPNYSEQLKGLIR 276
            P    SD+W+ GI L+ L     PF     K   L + +GK++ P   N S++ K LI 
Sbjct: 332 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMP--KNLSDEAKDLIS 385

Query: 277 DILVQDPRHRPNVYQLL 293
            ILV  P  R    ++L
Sbjct: 386 RILVVSPSKRLTTVEIL 402

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/273 (28%), Positives = 123/273 (45%), Gaps = 46/273 (16%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY    +++++MEYC  G L   +      ++ E  I  IM ++   VA ++  +  +I
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELL--VALLYIHKDNVI 144

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+ +   KLCDFG    + +        S V++  +   T  + +PE+I 
Sbjct: 145 HRDIKAANVLITNDGRVKLCDFGVAAQLTQ--------SNVRRQTMAG-TPYWMAPEVI- 194

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG-----KFEFPLYPN--YSE 269
              G+  D K DIW+LGI  Y++     P+    D+  L       K + P      YS 
Sbjct: 195 -MEGVYYDTKVDIWSLGITTYEITTGNPPY---CDVEALRAMQLITKSKPPRLEGRQYSP 250

Query: 270 QLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQV------------VQAPSS 317
            LK  I   L +DP+ R     LLK   I  +   P + ++             +   S+
Sbjct: 251 LLKEFIALCLDEDPKERLAAEDLLKTRFIKTHKSSPTSILKELITRYLLHRDKNINRESA 310

Query: 318 HLNLTELHQLSATQNILSLNSPTTMENTMPNAT 350
             NL +  Q+  TQN    +S T+ +N+ P  T
Sbjct: 311 MANLEDDEQIKGTQN----SSETSTDNSSPVET 339

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 100/198 (50%), Gaps = 29/198 (14%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++  EYC    L D +   LQ R+     +++ +Q+   V   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRGL 221
           N+L+  N   KL DFG            + ++    + +  TT  Y +PE+I  +++ G 
Sbjct: 159 NILLDKNGNAKLTDFGFT---------RECMTKTSLETICGTTV-YMAPELIKRESYDGF 208

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPF----EKGGDLAILSGKFEFPLYPN--YSEQLKGLI 275
            I    DIW+LG+ LY +   + PF    E   +  I++   E P++ +   SE  K L+
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMN---EMPVFNDTILSEDAKDLL 261

Query: 276 RDILVQDPRHRPNVYQLL 293
             +L +DP  RP++ ++L
Sbjct: 262 IKLLSKDPNERPSMQEIL 279

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 109/228 (47%), Gaps = 31/228 (13%)

Query: 73  VDAMRLLKNNRY--VVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLH 130
           ++ + ++K +R+  +V++IDS+  K        +++V+MEY E G L D +   +   L 
Sbjct: 721 INEIIVMKGSRHENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 770

Query: 131 EFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRN 190
           E +I  +  +   G+A +H+    +IHRDIK +N+L+S N + KL DFG  C  I     
Sbjct: 771 EGQIGTVCKETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQI----- 822

Query: 191 SQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
             E+   +  ++   T  + +PE++      P   K DIW+LGI + ++     P+    
Sbjct: 823 -NEVHLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 876

Query: 251 DLAIL-----SGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
            L  L     +G  +     N  E LK  +   L  +P  R    +LL
Sbjct: 877 PLRALYLIATNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 131/294 (44%), Gaps = 64/294 (21%)

Query: 17  VGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAM 76
           VG+++  I+K +  G F +VY AL  P          CLK     DK   N +R      
Sbjct: 38  VGNYK--ILKQIGEGSFGKVYLALHRP-----THRKVCLK---TSDKNDPNIVR------ 81

Query: 77  RLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQ 136
            +  + ++   YI       +  +   +V++ +EYC    L D  +     RL   E  +
Sbjct: 82  EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYD--HLLSLRRLSLLECGE 136

Query: 137 IMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSY 196
           + +Q++  V   H++    +HRD+K+EN+L+  N   KL DFG                +
Sbjct: 137 LFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFG----------------F 178

Query: 197 VQQDILKNT------TAQYRSPEMID--TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248
            ++ + K T      T  Y +PE+I+  T+ G  I    DIW+LG+ LY L     PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDD 234

Query: 249 GGDLAILSGKFEFPLY---PNYSEQL-----KGLIRDILVQDPRHRPNVYQLLK 294
             ++     K ++ +    P Y  +      K LI  +L ++P  RP++ Q+L+
Sbjct: 235 DDEV-----KTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVLR 283

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 85/180 (47%), Gaps = 20/180 (11%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
            G ID  +    +  + EFE   I  Q+  G+  +H     ++HRDIK ENV++ +    K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVK 1271

Query: 175  LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y +PE++    G P + K  DIWA+G
Sbjct: 1272 IIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVL---SGEPYEGKPQDIWAIG 1317

Query: 234  IFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
            I LY + +   PF    +  IL G+ +F    + SE    LI+ IL++    RP + ++ 
Sbjct: 1318 ILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIF 1375

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 99/206 (48%), Gaps = 32/206 (15%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  + + RL E    ++ +Q+  GV  MH+    L+
Sbjct: 121 VLQNSKY-IGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LV 175

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  N    + DFG V   +  P N         + +K +     Y +PE+
Sbjct: 176 HRDLKLENLLLDKNENLVITDFGFVNEFL--PDN---------EYMKTSCGSPCYAAPEL 224

Query: 215 IDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFE------KGGDLA-----ILSGKFEFPL 263
           + + R   +  K+D+W+ GI LY +     P++      +G D+      I     +FP 
Sbjct: 225 VISTRPY-VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPE 283

Query: 264 YPNYSEQLKGLIRDILVQDPRHRPNV 289
           Y   +   + L+R ILV DP  R N+
Sbjct: 284 Y--ITPIPRDLLRKILVPDPNKRVNM 307

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
            G ID  +   L+  + E+E   I  QV   +  +H+    ++HRDIK ENV++ +    K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEK-SDIWALG 233
            L DFGS   +   P           D+   T   Y +PE++    G P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGPF----------DVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 234  IFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
            + LY + +   PF    +  IL    +F      SE+   LI+ IL ++P  RP + ++
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 129/288 (44%), Gaps = 33/288 (11%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +          +  +VA   ++ +  + +   L +E+   + +K+   +V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKHPN-IV 152

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            ++D              V++L+E C  G L+D M  R    L E E+    +Q+   V 
Sbjct: 153 HFVDCFEDDT-------NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    +   K+ DFG    +     N++E  Y         T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----NNRERKYTVCG-----T 252

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFE 260
             Y +PE ++    G   +   DIW++G+ +Y L     PF+   D+ ++     + ++ 
Sbjct: 253 PNYIAPEVLMGKHAGHSFE--VDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKACQYG 309

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPIND 308
           +P     S + K LI DIL  DP  RP++ +++  +      P  I +
Sbjct: 310 YPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDVWFRGIFPPKITE 357

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 102/212 (48%), Gaps = 34/212 (16%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  + + RL E     + SQ+  GV  MH     L+
Sbjct: 145 VLQNSKY-IGIVLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHCKG--LV 199

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+       + DFG V           E S   + ++K +     Y +PE+
Sbjct: 200 HRDLKLENLLLDKYGNLIITDFGFV----------NEFSKFSE-LMKTSCGSPCYAAPEL 248

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLA-----ILSGKFEFP 262
           + + R  P +  K+DIW+ GI L+ +     P++       G D+A     I +   +FP
Sbjct: 249 VISTR--PYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFP 306

Query: 263 LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
            Y   S   + L+R+IL+  P+ R  + Q+LK
Sbjct: 307 EY--ISPMARDLLRNILIPYPQKRATLKQILK 336

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 94/196 (47%), Gaps = 17/196 (8%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++ L+EY   G  +  +  +    L+E       SQ+   V ++HA+   +IHRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELS-----YVQQDILKNTTAQYRSPEMI-DTF 218
           +L+  + + KL DFG+   +   P N+ +       Y +       TA+Y SPE++ D++
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVG-TAEYVSPELLNDSY 313

Query: 219 RGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFPLYPNYSEQLKGLIR 276
                D + DIWA G  LY++     PF+   +        K ++     +    K L++
Sbjct: 314 ----TDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIAKDLVK 369

Query: 277 DILVQDPRHRPNVYQL 292
            +LV++P  R  V Q+
Sbjct: 370 KLLVREPNDRLTVEQI 385

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 86/184 (46%), Gaps = 21/184 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISAN 170
            + E G +  F     +  + E E   +  QV   +  +H     ++HRDIK ENV++ ++
Sbjct: 929  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHG--QGIVHRDIKDENVIVDSH 986

Query: 171  NEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRGLPIDEKSD 228
               KL DFGS   I   P           D+    T  Y +PE++   +++G P     D
Sbjct: 987  GFVKLIDFGSAAYIKSGPF----------DVFVG-TMDYAAPEVLGGSSYKGKP----QD 1031

Query: 229  IWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPN 288
            IWALG+ LY + Y   P+    +  IL G+  F      SE+  GLI+ IL ++   RP 
Sbjct: 1032 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPT 1089

Query: 289  VYQL 292
            + ++
Sbjct: 1090 IDEI 1093

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 94/202 (46%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  I  I  ++   +  +H  +  +I
Sbjct: 106 GSYLKDTSLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVITREILIALKYIH--KDNII 160

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+     KLCDFG    + +  +  Q ++          T  + +PE+I 
Sbjct: 161 HRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKRRQTMA---------GTPYWMAPEVI- 210

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILS--GKFEFPLYP--NYSEQLK 272
              G+  D K DIW+LGI  Y++     P+ +   L  +    K + P     NYS  LK
Sbjct: 211 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSKPPRLEGRNYSPLLK 269

Query: 273 GLIRDILVQDPRHRPNVYQLLK 294
             +   L +DP+ R +   LLK
Sbjct: 270 EFVALCLDEDPKERMSAEDLLK 291

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 91/202 (45%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY     +++LMEYC  G L   +      ++ E  I  IM ++   +  +H     +I
Sbjct: 87  GSYLKDTSLWILMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIHKDN--VI 141

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+     KLCDFG    + +     Q ++          T  + +PE+I 
Sbjct: 142 HRDIKAANVLITNEGSVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI- 191

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLA----ILSGKFEFPLYPNYSEQLK 272
              G+  D K DIW+LGI  Y++     P+     L     I+  K       +YS  LK
Sbjct: 192 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLK 250

Query: 273 GLIRDILVQDPRHRPNVYQLLK 294
             I   L +DP+ R +   LL+
Sbjct: 251 EFIALCLDEDPKERLSADDLLR 272

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 102/212 (48%), Gaps = 34/212 (16%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++EY   G    ++  + + RL E    ++ +Q+  GV  +H+    L+
Sbjct: 146 VLQNSRY-IGIVLEYASGGEFYRYI--QRKKRLKETAACRLFAQLINGVHYIHSKG--LV 200

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  +    + DFG V              Y   +++K +     Y +PE+
Sbjct: 201 HRDLKLENLLLDKHENLVITDFGFVNEF-----------YSHNELMKTSCGSPCYAAPEL 249

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLA-----ILSGKFEFP 262
           + + +  P +  K+DIW+ GI LY +     P++       G D++     I     +FP
Sbjct: 250 VISTK--PYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDISRLYYYITKTPLKFP 307

Query: 263 LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
            Y N     + L+R ILV DPR R  + Q+ K
Sbjct: 308 DYIN--PIPRDLLRKILVSDPRRRITMKQIEK 337

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 96/195 (49%), Gaps = 22/195 (11%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G   D +    ++RL E ++  I+ +V  G+  +H+ +   IHRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPID 224
           +L++ + E KL DFG    I+   + +  +           T  + +PE+I   +    +
Sbjct: 168 ILLTDDGEVKLGDFGVSGQIMATLKRTTFVG----------TPYWMAPEIIAK-KDNGYN 216

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLY--PNYSEQLKGLIRDI---- 278
           EK+DIW+LGI   +L     P+ K   + +L      PL   P    +  G  RD     
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVL---VNIPLRKPPKLQGRFTGSARDFIALC 273

Query: 279 LVQDPRHRPNVYQLL 293
           L++DP  RP+  +LL
Sbjct: 274 LIKDPDLRPSAAELL 288

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 123/289 (42%), Gaps = 41/289 (14%)

Query: 23  EIIKYLTSGGFAQVYSALINPPDPHSNSSVAC-LKRVIVPDKPSLNT---LRAEVDAMRL 78
           EI K L  G F +VY         H  S   C LK +   D    N     R EV+    
Sbjct: 110 EIGKVLGKGKFGRVYCVR------HIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSS 163

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           L++      Y   H  K         V++LMEY   G L   +  R  +  ++      +
Sbjct: 164 LRHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR--SHFNDVVASYYV 213

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
            Q+   +  MH  +  ++HRDIK EN++I  NN  KL DFG     +  P+ S+  +   
Sbjct: 214 YQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFGWS---VITPKGSKRKTLC- 267

Query: 199 QDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPF-EKGGDLA---I 254
                  T  Y SPE+I   R    +EK D+WALG+  Y+L   + PF E+  +L    I
Sbjct: 268 ------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRI 318

Query: 255 LSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVP 303
           L     FP   +   + + LI  +L  DP  R  + ++ K   I +N P
Sbjct: 319 LKRNLIFP--DHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEKNKP 365

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 98/200 (49%), Gaps = 33/200 (16%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           +V++ +EYC    L + +   + +R+   E  ++ +Q+   V   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRGL 221
           N+L+  N   KL DFG     +         S    + +  TT  Y +PE+I    + G 
Sbjct: 158 NILLDKNGNAKLTDFGFTRECV---------SKSSLETICGTTV-YMAPELIQRQAYDGF 207

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPL---YPNY-----SEQLKG 273
            I    DIW+LG+ LY +   T PF++  +      K ++ +   +PN+     S + K 
Sbjct: 208 KI----DIWSLGVILYTMINGTMPFDEDDET-----KTKWKIVNDFPNFNDNFVSHEAKD 258

Query: 274 LIRDILVQDPRHRPNVYQLL 293
           LI+ +L + P  RP + Q+L
Sbjct: 259 LIKRLLAKCPSERPTMEQIL 278

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 130/283 (45%), Gaps = 36/283 (12%)

Query: 19  SHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRL 78
           S   E+ + +  G F  VY A+    D  + ++VA     +      ++ L  E+  +  
Sbjct: 31  SELYEVQECVGKGNFGDVYKAI----DKSTGNTVAIKVVNLEETDDEIDLLAQEIYFLAE 86

Query: 79  LKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIM 138
           L ++ Y+ +Y  +      +       +++MEYC  G   D +    +  L E ++  I 
Sbjct: 87  L-HSPYITNYFSTFVEDVSM-------WIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFIT 138

Query: 139 SQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQ 198
            ++ +G+  +H+ +   IHRDIK  N+L++ + + KL DFG          + Q ++  +
Sbjct: 139 REILRGLEYLHSQRK--IHRDIKAANILLTDDGKVKLGDFGV---------SGQMMATRR 187

Query: 199 QDILKNTTAQYRSPEMI-DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG 257
           +D    T   + +PE+I  + +G   +EK+DIW+LGI +++L     P  +   + +L  
Sbjct: 188 RDTFVGTPF-WMAPEVIARSEQGY--NEKADIWSLGITVFELLKGQPPLSQHDPMKVL-- 242

Query: 258 KFEFP------LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
               P      L   YS  ++  +   L +DP  RP   +LLK
Sbjct: 243 -MSIPSRRPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 94/209 (44%), Gaps = 38/209 (18%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +   +   + E  I  IM ++   +  +H  +  +I
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--KDNVI 162

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+   + KLCDFG    + +     Q ++          T  + +PE+I 
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI- 212

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----------AILSGKFEFPLYP 265
              G+  D K DIW+LGI  Y++     P+ +   L           A L G+       
Sbjct: 213 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGR------- 264

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
            YS  LK  I   L +DP+ R +  +L K
Sbjct: 265 QYSSGLKEFIALCLDEDPKERLSAEELQK 293

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 101/207 (48%), Gaps = 31/207 (14%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEY  +G L   + +      ++      + Q+   +  +H  Q  +IHRDIK EN
Sbjct: 175 IYIVMEYLIQGELYKLLQS--HGPFNDVLASNYVYQIADALDYLH--QKHIIHRDIKPEN 230

Query: 165 VLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT---TAQYRSPEMIDTFRGL 221
           +LI  NN  KL DFG    II P           + I + T   T  Y SPE+I +    
Sbjct: 231 ILIGFNNTVKLTDFG--WSIINP-----------KGIRRKTLCGTIDYLSPEIITSKE-- 275

Query: 222 PIDEKSDIWALGIFLYKLCYYTTPFEKGGD----LAILSGKFEFPLY-PNYSEQLKGLIR 276
             D   DIWALG+  Y+L   +  FE+         I+ G+ +FP + PN    ++ LI+
Sbjct: 276 -YDHTVDIWALGVLAYELVVGSPAFEEETKEMTYKRIVKGELKFPEHLPNI---VRDLIQ 331

Query: 277 DILVQDPRHRPNVYQLLKRISIMQNVP 303
            ILV +P  R ++ ++ +   I++N P
Sbjct: 332 RILVIEPSKRMSLKEIKRHPWILKNKP 358

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 111/229 (48%), Gaps = 28/229 (12%)

Query: 72  EVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E +A++ L N+R +V    +   ++ L       + L+EY   G  +  M  +    L+E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESSL-------YFLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 132 FEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNS 191
                  +Q+   +  +H+    ++HRDIK EN+L+  + + KL DFG+   I+ P  N+
Sbjct: 266 DCACYYSAQIIDAIDFLHSKG--IVHRDIKPENILLDKDFKVKLTDFGT-AKILEPKPNT 322

Query: 192 QELSYVQQDILKNT-----TAQYRSPEMI-DTFRGLPIDEKSDIWALGIFLYKLCYYTTP 245
            + SY   D+L  +     TA+Y SPE++ D +    +D + DIWA G  L+++     P
Sbjct: 323 TD-SY---DLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPP 374

Query: 246 FEKGGDLAILSG--KFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           F+   +        K ++     +   ++ L++ IL++ P  R  + Q+
Sbjct: 375 FKATNEYLTFQKVMKVQYAFTAGFPLVVRDLVKGILIKQPAQRLTIPQI 423

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 128/268 (47%), Gaps = 35/268 (13%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G    VY+A     +  +N+SVA +K++ +  +P    +  E+  M+  K+   +V++ID
Sbjct: 676 GASGGVYTAY----EVGTNASVA-IKQMNLEKQPKKELIINEILVMKASKHAN-IVNFID 729

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           S+  +        +++V+MEY E G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 730 SYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 779

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
               +IHRDIK +NVL+S + E KL DFG  C  I       E++  +  ++   T  + 
Sbjct: 780 KG--VIHRDIKSDNVLLSMSGEIKLTDFG-FCAQI------NEINLKRTTMV--GTPYWM 828

Query: 211 SPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEFPLYP 265
           +PE++      P   K DIW+LGI + ++     P+     L  L     +G  E     
Sbjct: 829 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDAD 885

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLL 293
           + S+ LK  +   L  +P  R    QLL
Sbjct: 886 SLSDDLKSFLGWCLHVNPDERATASQLL 913

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 133/277 (48%), Gaps = 36/277 (12%)

Query: 22  VEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKN 81
           V +IK +  G    VY+A     D ++ +SVA +K++    +P    +  E+  M+  ++
Sbjct: 566 VNLIK-IGQGASGGVYTAT----DVNTEASVA-IKKMNFEKQPKKELIVNEILVMKASRH 619

Query: 82  NRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQV 141
              +V++IDS+       NG+  ++V+MEY + G L D +   +   L E +I  +  + 
Sbjct: 620 EN-IVNFIDSY-----FLNGN--LWVIMEYMKGGSLTDVVTHCI---LTEQQISTVTRET 668

Query: 142 TQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDI 201
             G+  +H+    +IHRDIK +NVL+S + + KL DFG  C  I       E++  +  +
Sbjct: 669 LNGLRFLHSKG--VIHRDIKSDNVLLSLSGDIKLTDFG-FCAQI------NEINLKRTTM 719

Query: 202 LKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----S 256
           +   T  + +PE++      P   K DIW+LGI + ++     P+     L  L     +
Sbjct: 720 VG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 774

Query: 257 GKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
           G  E     + SE LK  +   L  DP  R +  +LL
Sbjct: 775 GTPELKDPDSLSECLKAFLDWCLKVDPHERASATELL 811

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 102/212 (48%), Gaps = 34/212 (16%)

Query: 97  MLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           +L N  Y + +++E+   G    ++  +   RL E    ++ +Q+  GV  MH+    L+
Sbjct: 112 VLQNSKY-IGIVLEFASGGEFYKYIQKK--RRLKETPACRLFAQLVSGVHYMHS--KGLV 166

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQ--YRSPEM 214
           HRD+K+EN+L+  +    + DFG V           E S  + +++K +     Y +PE+
Sbjct: 167 HRDLKLENLLLDKHENLIITDFGFV----------NEFSQ-RNELMKTSCGSPCYAAPEL 215

Query: 215 IDTFRGLPID-EKSDIWALGIFLYKLCYYTTPFE------KGGDLA-----ILSGKFEFP 262
           + T    P +  K+D+W+ GI LY +     P++       G D+A     I     +FP
Sbjct: 216 VVTTE--PYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLYITKTALKFP 273

Query: 263 LYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
            Y N  +  + L+R ILV DP  R N+  + K
Sbjct: 274 EYINPIQ--RDLLRKILVSDPTKRLNIRNIEK 303

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 130/286 (45%), Gaps = 43/286 (15%)

Query: 27   YLTSGGFAQVYSAL-INPPDPHSNSSVACLKRVIVPDKPSLN----TLRAEVDAMRLLKN 81
            ++ SG F  VYSA+ ++  D      +  +K + + D  S+     +L+ E+  M +L N
Sbjct: 1264 FIGSGSFGTVYSAVNLDTGD------ILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-N 1316

Query: 82   NRYVVSY--IDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMS 139
            +  +V Y  ++ H  K         V + ME+CE   L   +      R+ +  + Q+ +
Sbjct: 1317 HPNIVQYYGVEVHRDK---------VNIFMEFCEGSSLASLLE---HGRIEDEMVTQVYT 1364

Query: 140  -QVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV-----CGIIRPPRNSQE 193
             Q+ +G+A +H  Q  ++HRDIK EN+L+  N   K  DFG+       G  R   ++  
Sbjct: 1365 LQLLEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANN 1422

Query: 194  LSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK-GGDL 252
             S   +D++   T  Y +PE + T +G       DIW+LG  + ++     P+     + 
Sbjct: 1423 KSTGGKDMIG--TPMYMAPETV-TGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEW 1479

Query: 253  AIL----SGKF-EFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
            AI+    +G   +FP     S   +  I   L+QD   R    +LL
Sbjct: 1480 AIMYHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELL 1525

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 39/203 (19%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC    L +++  +    L E    ++ SQ+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISANNEYKLCDFG-----SVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDT-- 217
           +L+      KL DFG     +  GI+              + +  TT  Y +PE+I+   
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGIL--------------ETICGTTV-YMAPELIERKP 203

Query: 218 FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLY-PNYSEQL----- 271
           + G  I    D W+LGI LY + + T PF++  ++     K++   Y P Y         
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGTMPFDEVDEVKT---KYKIVHYNPTYDNDYIDSNG 256

Query: 272 KGLIRDILVQDPRHRPNVYQLLK 294
           K LI  +L +DP  RP++ Q+L+
Sbjct: 257 KELISQLLEKDPNQRPSLTQVLQ 279

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 127/274 (46%), Gaps = 34/274 (12%)

Query: 28  LTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVS 87
           L  G ++ VY A+       + +   C K+ I+ +K  +  +  E D + +L        
Sbjct: 16  LGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREK-KVKYVTIEKDLLNMLAKG----- 69

Query: 88  YIDSHAAKAMLHNGSYEV---FVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQG 144
               H     L    +++   + ++EY   G L+  +  RL  RL E     I +Q+   
Sbjct: 70  ---GHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDT 124

Query: 145 VAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGII-RPPRNSQE-LSYVQQDIL 202
           V  MH+    +IHRD+K ENVL+S      + DFG+ C    R   N++   S+V     
Sbjct: 125 VDYMHS--KGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFV----- 177

Query: 203 KNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL----AILSGK 258
              TA+Y SPE++   +       SDIWALG  +Y+L     PF    +L     I++  
Sbjct: 178 --GTAEYVSPELLLHSQ---CGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALD 232

Query: 259 FEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
           +++ L+ N S Q+  +++ ILV DP  RP+  QL
Sbjct: 233 YKW-LFSN-SPQVVSIVQSILVTDPLKRPSAAQL 264

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 99/198 (50%), Gaps = 27/198 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQ-NRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKI 162
           +V++ +EYC    L D +   LQ  R+   E +Q+ SQ+   V   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDT--FRG 220
           EN+L+  +   KL DFG            + +  V  + +  TT  Y +PE+ +   + G
Sbjct: 166 ENILLDKDGNAKLTDFGFT---------RECMEKVNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 LPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKF--EFPLYPNYSEQLKG--LIR 276
             I    DIW+LG+ LY +   + PF++  D A    K   E P Y +     +G  L+R
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDE-DDEAKTKWKIINEEPEYNSKFMTAEGEDLVR 270

Query: 277 DILVQDPRHRPNVYQLLK 294
            +L +D   RP+V ++L+
Sbjct: 271 KLLQKDSNLRPSVREILQ 288

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 109/228 (47%), Gaps = 31/228 (13%)

Query: 73  VDAMRLLKNNRY--VVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLH 130
           ++ + ++K +R+  +V++IDS+  K        +++V+MEY E G L D +   +   L 
Sbjct: 665 INEILVMKGSRHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 714

Query: 131 EFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRN 190
           E +I  +  +   G+  +H+    ++HRDIK +N+L+S   + KL DFG  C  I     
Sbjct: 715 EGQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 766

Query: 191 SQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
             EL+  +  ++   T  + +PE++      P   K DIW+LGI + ++     P+    
Sbjct: 767 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 820

Query: 251 DLAIL-----SGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLL 293
            L  L     +G  +     N S  LK  +   L  +P  R +  +LL
Sbjct: 821 PLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELL 868

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 129/269 (47%), Gaps = 35/269 (13%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G    VY+A     +  +N+SVA +K++ +  +P    +  E+  M+  K+N  +V++ID
Sbjct: 707 GASGGVYTAY----ELGTNASVA-IKQMNLEKQPKKELIVNEILVMKGSKHNN-IVNFID 760

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           S+  +        +++V+MEY E G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 761 SYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 810

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
               +IHRDIK +N+L+S N + KL DFG  C  I       E++  +  ++   T  + 
Sbjct: 811 KG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQI------NEVNLKRTTMVG--TPYWM 859

Query: 211 SPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEFPLYP 265
           +PE++      P   K DIW+LGI + ++     P+     L  L     +G  +     
Sbjct: 860 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDPG 916

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
           N S ++   +   L+ DP  R     LL+
Sbjct: 917 NLSHKMAMFLNWCLMVDPEDRGTAADLLE 945

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 130/295 (44%), Gaps = 33/295 (11%)

Query: 27  YLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVV 86
           +L  GGFA+ +    +     +  +VA L    +  + +   L +E+   + +K+   +V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKHQN-IV 205

Query: 87  SYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVA 146
            +ID              V++L+E C  G L++ +  R Q  L E E+    +Q+   + 
Sbjct: 206 QFIDCFEDDT-------NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
            MH+ +  +IHRD+K+ N+    N   K+ DFG +  ++   R        ++      T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDR--------ERKFTVCGT 305

Query: 207 AQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDL-----AILSGKFE 260
             Y +PE ++    G   +   D+W++G+ +Y L     PF+   D+      I    F 
Sbjct: 306 PNYIAPEVLMGKHSGHSYE--VDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKCCDFI 362

Query: 261 FPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPINDIQVVQAP 315
           FP     S + K L++D+L  DP  RP++ +++  +      P  I    + + P
Sbjct: 363 FPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVP 417

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 134/301 (44%), Gaps = 34/301 (11%)

Query: 26  KYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYV 85
           ++L  GGFA+ +    +     +  +VA   ++ +  + +   L +E+   + + +   +
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHTN-I 140

Query: 86  VSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGV 145
           V +ID              V++L+E C  G L++ +  R    + E E+   M+Q+  G+
Sbjct: 141 VQFIDCFEDNV-------NVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNT 205
             MH+ +  +IHRD+K+ N+    +   K+ DFG +  ++   R        ++      
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVLANDR--------ERKFTICG 240

Query: 206 TAQYRSPE-MIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGK-----F 259
           T  Y +PE ++    G   +   DIW++G+ LY L     PF+   D+  +  +     F
Sbjct: 241 TPNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIKQRNF 297

Query: 260 EFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNV-PCPINDIQVVQAPSSH 318
            +P     S+  K LI DIL  +P  RP++ +++  +       P  +N +       SH
Sbjct: 298 AYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFRGTFPPYTLNSVMTTVPDYSH 357

Query: 319 L 319
           +
Sbjct: 358 I 358

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 136/334 (40%), Gaps = 69/334 (20%)

Query: 4   PQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----------LINPPDPHSNSSVA 53
           P+     +   +T+G     I K +  G FA V+ A          L +PP    N ++ 
Sbjct: 19  PKKSRKGIERSITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPP---LNFAIK 75

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCE 113
            + R  + +K  L  L  E+  ++ + N+ ++V  ID           + + +++MEYC 
Sbjct: 76  IVSRSKLKNKKLLENLEIEIAILKKI-NHPHIVKLIDCERT-------TTDFYLIMEYCA 127

Query: 114 RGGLIDFMNTRLQ----------------------NRLHEFEILQIMSQVTQGVAAMHAL 151
            G L   +  R +                      N LH   IL  + Q+   +  + + 
Sbjct: 128 LGDLTFLIKKRHELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRS- 186

Query: 152 QPPLIHRDIKIENVL-----ISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTT 206
              L+HRDIK +N+L     I+ N+       G +     P     +  + +   L NT+
Sbjct: 187 -KNLVHRDIKPQNLLLLTPLINYNDSKAFKKLGFIGIYELPILKIADFGFAR--FLPNTS 243

Query: 207 AQ--------YRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL--- 255
                     Y +PE+++  +    + K+D+W++G  LY++CY T PF+    L +    
Sbjct: 244 MAETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKI 300

Query: 256 ---SGKFEFPLYPNYSEQLKGLIRDILVQDPRHR 286
              + K  FP Y      +K LI  +L  DP+ R
Sbjct: 301 KRSNNKINFPNYIQIQNDMKILISKLLTFDPQRR 334

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 91/202 (45%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLI 156
           GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H     +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIHKDN--VI 141

Query: 157 HRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMID 216
           HRDIK  NVLI+     KLCDFG    + +     Q ++          T  + +PE+I 
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI- 191

Query: 217 TFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLA----ILSGKFEFPLYPNYSEQLK 272
              G+  D K DIW+LGI  Y++     P+     L     I+  K       +YS  LK
Sbjct: 192 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLK 250

Query: 273 GLIRDILVQDPRHRPNVYQLLK 294
             I   L +DP+ R +   LL+
Sbjct: 251 EFIALCLDEDPKERLSADDLLR 272

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 98/204 (48%), Gaps = 23/204 (11%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
            V++LMEY   G L   +  R +  L +      + Q+   +  MH  Q  +IHRD+K E
Sbjct: 181 RVYLLMEYLVNGELYKLL--RAKGPLDDIFASHYVYQMADALDYMH--QRNIIHRDVKPE 236

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPI 223
           N+LI  +N  KL DFG    II  PR ++  +          T  Y SPE+I +      
Sbjct: 237 NILIGFDNTVKLTDFG--WSIIN-PRGTKRKTMC-------GTLDYLSPELIAS---KEY 283

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEKGG----DLAILSGKFEFPLYPNYSEQLKGLIRDIL 279
           D+K D+WALG+  ++L   + PFE+         I+ G  +FP   + S   + LI  +L
Sbjct: 284 DDKVDVWALGVLTFELVVNSPPFEEDSKELTSKRIVRGDLKFP--NHISSDAQDLITKLL 341

Query: 280 VQDPRHRPNVYQLLKRISIMQNVP 303
             + + R ++ ++ +   I +N P
Sbjct: 342 RHNSKDRISLREVKQHPWITKNRP 365

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 108/239 (45%), Gaps = 45/239 (18%)

Query: 72  EVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHE 131
           E++A++LL +   V         + +L N  Y + +++E+   G    ++  + + RL E
Sbjct: 103 EINALKLLTHPNIV-------RLEEVLQNSKY-IGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 FEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNS 191
               Q+ +Q+  GV  MH+    L+HRD+K+EN+L+  N    + DFG V          
Sbjct: 153 PHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFVNEF------- 203

Query: 192 QELSYVQQDILKNTTAQ--YRSPEMI---DTFRGLPIDEKSDIWALGIFLYKLCYYTTPF 246
               +   +++K +     Y +PE++   + +R      K DIW+ GI LY +     P+
Sbjct: 204 ----FGSNELMKRSCGSPCYAAPELVLSTEPYRA----RKVDIWSCGIILYAMLAGYLPW 255

Query: 247 E------KGGDLA-----ILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
           +       G D+      I     +FP Y   S   + LIR IL  +P  R ++  + K
Sbjct: 256 DDDSQNPNGDDIGKLYQYITKTALKFPAY--ISPLARDLIRKILTANPSRRISISYICK 312

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 91/197 (46%), Gaps = 26/197 (13%)

Query: 104 EVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           +++V+MEYC  G L   +      ++ E  +  I+  +   VA ++  +  +IHRDIK  
Sbjct: 94  KLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRNLL--VALLYIHKDNVIHRDIKAA 148

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPI 223
           NVLI+     KLCDFG    +       Q ++          T  + +PE+I    G+  
Sbjct: 149 NVLITNGGHVKLCDFGVAAQLTTANHKRQTMA---------GTPYWMAPEVI--MEGVYY 197

Query: 224 DEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG-----KFEFPLYP--NYSEQLKGLIR 276
           + K+DIW+LGI  Y++     P+    D+  L       K + P     NYS  LK  I 
Sbjct: 198 NTKADIWSLGITTYEIATGNPPY---CDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIA 254

Query: 277 DILVQDPRHRPNVYQLL 293
             L +DP  RP   +LL
Sbjct: 255 LCLDEDPEARPTAEELL 271

>Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054W
           (REAL)
          Length = 398

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 105/231 (45%), Gaps = 14/231 (6%)

Query: 23  EIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNN 82
           EII++L  G +  V S       P +  +V  +  +   +      +R E+  M   K +
Sbjct: 47  EIIQFLGKGAYGTVCSVKFKGQTPPAKIAVKKISNIFNKEILLKRAIR-ELKFMNFFKGH 105

Query: 83  RYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVT 142
           + +V+ ID     +  ++G Y    L++Y     L   +++ +Q  L EF I   + Q+ 
Sbjct: 106 KNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQIL 159

Query: 143 QGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDIL 202
            G+  +H+    +IHRD+K  N+L + N   K+CDFG   GI       Q  +   Q  +
Sbjct: 160 CGLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGLARGIHTEFFQCQTTNSAVQPHI 217

Query: 203 KNTTA--QYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGD 251
            N  A   YR+PE++      P D+  DIWA+G  L +  Y   P   G D
Sbjct: 218 TNYVATRWYRAPELL--LSNQPYDKAIDIWAVGCILAEF-YARKPVFMGRD 265

>KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {ON}
           Anc_3.60 YNL298W
          Length = 883

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 118/255 (46%), Gaps = 35/255 (13%)

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCE 113
            +K++I+  +P    +  E+  M+  K+ + +V++I+S+           +++V+MEY E
Sbjct: 633 AIKQMILSKQPRKELIVNEIHVMKDSKH-KNIVNFIESYL------KTEDDLWVVMEYME 685

Query: 114 RGGLIDFM-----NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLIS 168
            G L D +     N    + L E +I  I+ +  QG+  +H     +IHRDIK +NVL+ 
Sbjct: 686 GGSLTDIIENSPTNGSTHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLD 743

Query: 169 ANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSD 228
            +   K+ DFG  C  +   RN +             T  + +PE++   +    DEK D
Sbjct: 744 THARVKITDFG-FCAKLTDQRNKRATMV--------GTPYWMAPEVV---KQREYDEKVD 791

Query: 229 IWALGIFLYKLCYYTTPFEKGGDLAIL-------SGKFEFPLYPNYSEQLKGLIRDILVQ 281
           +W+LGI   ++     P+     L  L       + K ++P     S ++K  +   L  
Sbjct: 792 VWSLGIMAIEMLESEPPYLNEDPLKALYLIATNGTPKLKYP--ETLSLEIKRFLSVCLCV 849

Query: 282 DPRHRPNVYQLLKRI 296
           D R+R +  +LL  +
Sbjct: 850 DVRYRASTEELLHHV 864

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 125/268 (46%), Gaps = 35/268 (13%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G    VY+A     +  +N SVA +K++ +  +P    +  E+  M+  K+   +V++ID
Sbjct: 608 GASGGVYTAY----EIGTNVSVA-IKQMNLEKQPKKELIINEILVMKGSKHPN-IVNFID 661

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           S+  K        +++V+MEY E G L D +   +   L E +I  +  +   G+  +H+
Sbjct: 662 SYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLKFLHS 711

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYR 210
               ++HRDIK +N+L+S   + KL DFG  C  I       EL+  +  ++   T  + 
Sbjct: 712 KG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI------NELNLKRTTMVG--TPYWM 760

Query: 211 SPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAIL-----SGKFEFPLYP 265
           +PE++      P   K DIW+LGI + ++     P+     L  L     +G  +     
Sbjct: 761 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPE 817

Query: 266 NYSEQLKGLIRDILVQDPRHRPNVYQLL 293
           N S  LK  +   L  +P  R +  +LL
Sbjct: 818 NLSSSLKKFLDWCLCVEPEERASATELL 845

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 95/210 (45%), Gaps = 53/210 (25%)

Query: 105 VFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC    L +++   ++ R+   E   + SQ+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLISANNEYKLCDFG------------SVCGIIRPPRNSQELSYVQQDILKNTTAQYRSP 212
           +L+    + KL DFG            +VCG                      T  Y +P
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG----------------------TTVYMAP 196

Query: 213 EMIDT--FRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSGKFEF----PLYPN 266
           E+I+   + G  I    D W+LGI LY + +   PF++  D+     K+      P Y +
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGAMPFDEEDDIKT---KYRIVNNEPFYDD 249

Query: 267 --YSEQLKGLIRDILVQDPRHRPNVYQLLK 294
                  K LI  +L +DP  RP++ Q+L+
Sbjct: 250 NFIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 98/194 (50%), Gaps = 14/194 (7%)

Query: 105 VFVLMEYCERGGLIDFMNT-RLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIE 163
           ++ L+EY   G   DF++  +    L++   +   +Q+   +  +H  Q  +IHRDIK E
Sbjct: 237 LYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHRDIKPE 291

Query: 164 NVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI-DTFRGLP 222
           N+L+  + + KL DFG+   ++     +Q  + +++      TA+Y SPE++ D +    
Sbjct: 292 NILLDKDMKVKLTDFGT-AKLVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDNY---- 346

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFPLYPNYSEQLKGLIRDILV 280
           +D K DIWA G  L+++     PF+   +        K ++     +   ++ LI+ ILV
Sbjct: 347 VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLIKQILV 406

Query: 281 QDPRHRPNVYQLLK 294
           ++P  R +  Q+ K
Sbjct: 407 KNPEQRLDTLQVKK 420

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 126/300 (42%), Gaps = 39/300 (13%)

Query: 7    GTYNVGTQLTVGSHQ-------VEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVI 59
             TY +  ++ +GS +         I++ +  G + +V   + N         +   +R++
Sbjct: 819  ATYLITPEINIGSQKRIKRFSDFTILQVMGEGAYGKVNLCIHNKMHYIVVIKMIFKERIL 878

Query: 60   VPD---KPSLNTLRAEVDAMRLLKNN--RYVVSYIDSHAAKAMLHNGSYEVFVLMEYCER 114
            V        L T+ +E+  M  L  N  + ++  +D         +  Y       + E 
Sbjct: 879  VDTWVRDRKLGTIPSEIQIMATLNKNSQKNILKLLD------FFEDDDYYYIETPVHGET 932

Query: 115  GGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYK 174
            G +  F     +  + E E   +  QV   +  +H     ++HRDIK ENV++ ++   K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--NQGIVHRDIKDENVIVDSHGFVK 990

Query: 175  LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMI--DTFRGLPIDEKSDIWAL 232
            L DFGS   +   P           D+    T  Y +PE++   +++G P     DIWAL
Sbjct: 991  LIDFGSAAYVKSGPF----------DVFVG-TMDYAAPEVLGGSSYKGKP----QDIWAL 1035

Query: 233  GIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQL 292
            G+ LY + Y   P+    +  IL G+  F      SE   GLI+ IL ++   RP + ++
Sbjct: 1036 GVLLYTIIYKENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTIDEI 1093

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 104/240 (43%), Gaps = 33/240 (13%)

Query: 62  DKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFM 121
           D+  +  ++ EV  +  +K    +  Y  S+     L       ++++EYC  G L   +
Sbjct: 65  DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRTLL 117

Query: 122 NTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSV 181
                 ++ E  I  IM +V   +  +H     +IHRDIK  NVLI+     KLCDFG  
Sbjct: 118 R---PGKIDEKYIGIIMREVLIALKYIHKDN--VIHRDIKAANVLITNEGHVKLCDFGVA 172

Query: 182 CGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCY 241
             + +     Q ++          T  + +PE+I    G+  D K DIW+LGI  Y++  
Sbjct: 173 AQLNQSSLKRQTMA---------GTPYWMAPEVI--MEGVSYDTKVDIWSLGITTYEIAT 221

Query: 242 YTTPFEKGGDLAILSG-----KFEFPLYP--NYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
              P+    D+  L       K + P     +YS  LK  I   L +DP+ R +   LLK
Sbjct: 222 GNPPY---CDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKERLSADDLLK 278

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 123/270 (45%), Gaps = 24/270 (8%)

Query: 31  GGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYID 90
           G ++ V   L    D     +V  L +  +  +  +  +  E +A++ L N+R +V    
Sbjct: 191 GAYSTV--MLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFF 248

Query: 91  SHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHA 150
           +   ++ L       + L+EY   G  +  M  +    L E       +Q+  G+  +H+
Sbjct: 249 TFQDESSL-------YFLLEYAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS 299

Query: 151 LQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQ---ELSYVQQDILKNTTA 207
               +IHRDIK EN+L+  + + K+ DFG+   I+ P    +   E + + +      TA
Sbjct: 300 --KGIIHRDIKPENILLDKDMKVKITDFGT-AKILEPKNEDEDNPEFNLLTRSKSFVGTA 356

Query: 208 QYRSPEMI-DTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEKGGDLAILSG--KFEFPLY 264
           +Y SPE++ D++    +D + DIWA G  ++++     PF+   +        K ++   
Sbjct: 357 EYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFT 412

Query: 265 PNYSEQLKGLIRDILVQDPRHRPNVYQLLK 294
             +   ++ L++ IL++ P  R  + Q+ K
Sbjct: 413 AGFPVVVRDLVKRILLKVPEQRLTIPQIEK 442

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,729,618
Number of extensions: 2988508
Number of successful extensions: 14592
Number of sequences better than 10.0: 2037
Number of HSP's gapped: 13552
Number of HSP's successfully gapped: 2075
Length of query: 638
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 522
Effective length of database: 40,180,143
Effective search space: 20974034646
Effective search space used: 20974034646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)