Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YNL019CsingletonON28428413980.0
YNL033Wna 1ON28428413910.0
Smik_35.3singletonON28428411491e-159
Skud_31.1na 1ON28428410911e-151
Suva_70.1na 1ON2042047761e-104
Suva_77.1singletonOFF71711494e-12
YPR027Cna 2ON2772381535e-11
Suva_16.355na 2ON2772291473e-10
Skud_16.313na 2ON2772181421e-09
Smik_16.269na 2ON2772381146e-06
TPHA0D00720singletonON330112870.018
SAKL0B06138gna 3ON346162860.024
TDEL0F02740na 4ON294138780.24
NDAI0D00460singletonON278211657.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL019C
         (284 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL019C Chr14 complement(598376..599230) [855 bp, 284 aa] {ON} P...   543   0.0  
YNL033W Chr14 (572999..573853) [855 bp, 284 aa] {ON} Putative pr...   540   0.0  
Smik_35.3 Chr35 (3104..3958) [855 bp, 284 aa] {ON} YNL033W (REAL)     447   e-159
Skud_31.1 Chr31 complement(216..1070) [855 bp, 284 aa] {ON}  YNL...   424   e-151
Suva_70.1 Chr70 complement(179..793) [615 bp, 204 aa] {ON}  YNL0...   303   e-104
Suva_77.1 Chr77 complement(3..215) [213 bp, 71 aa] {OFF} YNL033W...    62   4e-12
YPR027C Chr16 complement(620425..621258) [834 bp, 277 aa] {ON} P...    64   5e-11
Suva_16.355 Chr16 complement(626441..627274) [834 bp, 277 aa] {O...    61   3e-10
Skud_16.313 Chr16 complement(585315..586148) [834 bp, 277 aa] {O...    59   1e-09
Smik_16.269 Chr16 complement(496858..497691) [834 bp, 277 aa] {O...    49   6e-06
TPHA0D00720 Chr4 (146495..147487) [993 bp, 330 aa] {ON}                38   0.018
SAKL0B06138g Chr2 (521967..523007) [1041 bp, 346 aa] {ON} no sim...    38   0.024
TDEL0F02740 Chr6 complement(503081..503965) [885 bp, 294 aa] {ON}      35   0.24 
NDAI0D00460 Chr4 complement(91649..92485) [837 bp, 278 aa] {ON}        30   7.8  

>YNL019C Chr14 complement(598376..599230) [855 bp, 284 aa] {ON}
           Putative protein of unknown function
          Length = 284

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/284 (93%), Positives = 265/284 (93%)

Query: 1   MLYSRESRTTVLFLALVTSLTVLCHSXXXXXXXXXXXXXXXXXXXAAPQPQNKAETALNT 60
           MLYSRESRTTVLFLALVTSLTVLCHS                   AAPQPQNKAETALNT
Sbjct: 1   MLYSRESRTTVLFLALVTSLTVLCHSVDVTTVFTTSTITEITTVTAAPQPQNKAETALNT 60

Query: 61  ATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEK 120
           ATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEK
Sbjct: 61  ATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEK 120

Query: 121 MVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLS 180
           MVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLS
Sbjct: 121 MVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLS 180

Query: 181 TEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLG 240
           TEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLG
Sbjct: 181 TEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLG 240

Query: 241 GITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL 284
           GITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL
Sbjct: 241 GITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL 284

>YNL033W Chr14 (572999..573853) [855 bp, 284 aa] {ON} Putative
           protein of unknown function
          Length = 284

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/284 (92%), Positives = 264/284 (92%)

Query: 1   MLYSRESRTTVLFLALVTSLTVLCHSXXXXXXXXXXXXXXXXXXXAAPQPQNKAETALNT 60
           MLYSRESRTTVLFLALVTSLTVLCHS                   AAPQPQNKAETALNT
Sbjct: 1   MLYSRESRTTVLFLALVTSLTVLCHSVDVTTVFTTSTITEITTVTAAPQPQNKAETALNT 60

Query: 61  ATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEK 120
           ATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEK
Sbjct: 61  ATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEK 120

Query: 121 MVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLS 180
           MVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDL 
Sbjct: 121 MVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLF 180

Query: 181 TEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLG 240
           TEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLG
Sbjct: 181 TEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLG 240

Query: 241 GITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL 284
           GITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL
Sbjct: 241 GITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL 284

>Smik_35.3 Chr35 (3104..3958) [855 bp, 284 aa] {ON} YNL033W (REAL)
          Length = 284

 Score =  447 bits (1149), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 215/284 (75%), Positives = 238/284 (83%)

Query: 1   MLYSRESRTTVLFLALVTSLTVLCHSXXXXXXXXXXXXXXXXXXXAAPQPQNKAETALNT 60
           M  S+ESRT VL LALV SLTVLCHS                   AAPQPQNKAET LNT
Sbjct: 1   MFCSKESRTVVLLLALVISLTVLCHSHDVTTVLTTSTITEFAVVTAAPQPQNKAETVLNT 60

Query: 61  ATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEK 120
           ATNIIQTMQF+FNCAPFKWKGPLKITSCALNF+VLLLTAWGYLLKYLQ+NKLN+DADME+
Sbjct: 61  ATNIIQTMQFIFNCAPFKWKGPLKITSCALNFMVLLLTAWGYLLKYLQDNKLNTDADMEQ 120

Query: 121 MVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLS 180
           +VGLGFGEMVG+I GKGVGKAFTKMDI+QKLVYPFEGSN QKCL+MTVGE+SIVP+HDLS
Sbjct: 121 VVGLGFGEMVGKIVGKGVGKAFTKMDISQKLVYPFEGSNNQKCLVMTVGESSIVPYHDLS 180

Query: 181 TEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLG 240
           TEICF+ +TLDSLSH +H S+S LD  SVS+LG A+I S+M  VSELYT FGDYT+EVL 
Sbjct: 181 TEICFNCHTLDSLSHRDHDSVSALDTHSVSSLGLANIPSEMSVVSELYTHFGDYTVEVLS 240

Query: 241 GITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL 284
           GI KLAS LN + WQ ERNGF VLSRDRPN+TLLSVHMY+S LL
Sbjct: 241 GIMKLASALNGDSWQRERNGFVVLSRDRPNETLLSVHMYTSGLL 284

>Skud_31.1 Chr31 complement(216..1070) [855 bp, 284 aa] {ON}
           YNL019C (REAL)
          Length = 284

 Score =  424 bits (1091), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 205/284 (72%), Positives = 226/284 (79%)

Query: 1   MLYSRESRTTVLFLALVTSLTVLCHSXXXXXXXXXXXXXXXXXXXAAPQPQNKAETALNT 60
           M  S+ESR  VL  AL+TSLTVL HS                   A+PQP+N AE  LNT
Sbjct: 1   MFCSKESRFVVLLFALMTSLTVLSHSVEVTTVLTTSTITEIAVVTASPQPKNNAEAVLNT 60

Query: 61  ATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEK 120
           ATNIIQTMQF+FNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQ+  L++DADME+
Sbjct: 61  ATNIIQTMQFIFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQDKNLDNDADMEQ 120

Query: 121 MVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLS 180
           MVGLGFGEMVGR  G GVGKAFT+MDITQ+LVYP E S+RQKCL+MTVGE+SIVP HDLS
Sbjct: 121 MVGLGFGEMVGRTIGLGVGKAFTRMDITQRLVYPIEASHRQKCLVMTVGEDSIVPLHDLS 180

Query: 181 TEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLG 240
           TEICFD  T DSLS  NHGS+S LD  SV ALG ADI S M +VSELYT FGDYT+EVL 
Sbjct: 181 TEICFDHNTFDSLSRRNHGSVSALDTVSVGALGLADIPSGMSAVSELYTHFGDYTVEVLS 240

Query: 241 GITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL 284
           GI KLAS +NRE WQ E++GF VLSRDRPN+TLLSVHMYSS LL
Sbjct: 241 GIMKLASIINREGWQNEKSGFVVLSRDRPNETLLSVHMYSSGLL 284

>Suva_70.1 Chr70 complement(179..793) [615 bp, 204 aa] {ON}  YNL019C
           (REAL)
          Length = 204

 Score =  303 bits (776), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 164/204 (80%), Gaps = 2/204 (0%)

Query: 83  LKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEKMVGLGFGEMVGRIFGKGVGKAF 142
           LKITSC LNFIVLLLTAWGYLL YLQ  KL +DADME+MV L FGEMV R+ GKGVGKAF
Sbjct: 1   LKITSCTLNFIVLLLTAWGYLLTYLQYYKLTNDADMERMVRLDFGEMVSRVIGKGVGKAF 60

Query: 143 TKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLSTEICFDQYTLDSLSH--HNHGS 200
           TKMDITQ LVYPFEG+N QKCL+MTVGENS+VPFH LSTEICFD+ TL SLS   H HG 
Sbjct: 61  TKMDITQTLVYPFEGTNSQKCLVMTVGENSMVPFHALSTEICFDRNTLGSLSRRGHGHGR 120

Query: 201 ISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLGGITKLASTLNREDWQGERNG 260
           +  LDA SVS++G  DI S M  VSELY  FGDYT+EVL G  KLAS +NRE WQ E++G
Sbjct: 121 VFALDAASVSSMGLTDIPSGMSMVSELYAHFGDYTVEVLSGAMKLASAINREGWQREKHG 180

Query: 261 FAVLSRDRPNQTLLSVHMYSSSLL 284
           F V SRDRPN+TLLSVHMYS  LL
Sbjct: 181 FVVPSRDRPNETLLSVHMYSPDLL 204

>Suva_77.1 Chr77 complement(3..215) [213 bp, 71 aa] {OFF} YNL033W
          (HSP)
          Length = 71

 Score = 62.0 bits (149), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MLYSRESRTTVLFLALVTSLTVLCHSXXXXXXXXXXXXXXXXXXXAAPQ-PQNKAETALN 59
          M  SRESR  V  +AL+ SLTV+ HS                    AP  P NKAET LN
Sbjct: 1  MFCSRESRIIVFAIALICSLTVVSHSVDVTTVRTIASTTTEVVVVTAPPLPPNKAETVLN 60

Query: 60 TATNIIQTMQF 70
          TATNIIQTMQF
Sbjct: 61 TATNIIQTMQF 71

>YPR027C Chr16 complement(620425..621258) [834 bp, 277 aa] {ON}
           Putative protein of unknown function
          Length = 277

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/238 (19%), Positives = 108/238 (45%), Gaps = 14/238 (5%)

Query: 47  APQP---QNKAETALNTATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYL 103
           AP P   ++ +E  L+     +Q +Q + +C     + P  + SC L  ++L+ +    L
Sbjct: 46  APAPAATKSVSEKKLDDTKLTLQVIQTMVSCFSV-GENPANMISCGLGVVILMFSLIIEL 104

Query: 104 LKYLQENKLNSDADMEKMVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSN-RQK 162
           +  L+ + +N    +  ++   + E+      + +   F  +D+   +     GS   Q 
Sbjct: 105 INKLENDGINEPQRLYDLIKPKYVELPSNYVNEKIKTTFEPLDLYLGVNMNTSGSELNQN 164

Query: 163 CLLMTVGENSIVPFHDLSTEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMP 222
           CL++ +GE + +PF  L+ +IC+ +   +  +++    I     G+++       +    
Sbjct: 165 CLILKLGEKTALPFPGLAQQICYTKGASNEFTNYKLSDIQ----GNLNENSQGIANGVFQ 220

Query: 223 SVSELYTLFGDYTIEVLGGITKLASTLNREDWQGERNGFAVLSRDR-PNQTLLSVHMY 279
            +S +  + G++  ++     +++  +  E+W G   GF    R++ PN++ +SV  Y
Sbjct: 221 KISNIRKISGNFKSQLY----QISEKITDENWDGSAVGFTAHGREKGPNKSQISVSFY 274

>Suva_16.355 Chr16 complement(626441..627274) [834 bp, 277 aa] {ON}
           YPR027C (REAL)
          Length = 277

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 96/229 (41%), Gaps = 30/229 (13%)

Query: 64  IIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEKMVG 123
           +IQTM   F+      + P  + SC L  ++L+ T    L+  L+ + +N    +  ++ 
Sbjct: 69  VIQTMVACFSVG----ENPANMISCGLGVVILMFTIIIDLINKLENDGINEPQKLSDLIK 124

Query: 124 LGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNR-QKCLLMTVGENSIVPFHDLSTE 182
             + E+      K +   F  +DI   +       N+ Q CL + +G +S +PF  L+ +
Sbjct: 125 PKYIELPSNYVNKKIKSTFEPLDIYLGVNSNAVADNQNQNCLTLKLGGDSALPFPGLAQQ 184

Query: 183 IC--------FDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDY 234
           IC        F  Y+L S+ H N   +    A  V    F  ISS      +L + F  Y
Sbjct: 185 ICYTKGASKEFPDYSLSSI-HENFSELRQGIANDV----FQKISSIKKMSRDLKSQF--Y 237

Query: 235 TIEVLGGITKLASTLNREDWQGERNGFAVLSRDR-PNQTLLSVHMYSSS 282
            I         + T+  E W G   GF    R++ P ++ LSV  Y  +
Sbjct: 238 YI---------SETITDESWDGSAIGFNANGREKDPKKSQLSVTFYKDN 277

>Skud_16.313 Chr16 complement(585315..586148) [834 bp, 277 aa] {ON}
           YPR027C (REAL)
          Length = 277

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 97/218 (44%), Gaps = 14/218 (6%)

Query: 64  IIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEKMVG 123
           +IQTM   F+      + P  + SC L  ++L+ +    L+  L+ + +N    +  ++ 
Sbjct: 69  VIQTMVSCFSVG----ENPANMISCGLGVVILMFSLIIELINKLENDGINEPQKLYDLIK 124

Query: 124 LGFGEMVGRIFGKGVGKAFTKMDITQKLVY-PFEGSNRQKCLLMTVGENSIVPFHDLSTE 182
             + E+      + +   F  +DI   + +        Q CL++ +GE S +PF  L+ +
Sbjct: 125 PRYIELPSNYVNEKIKSTFEPLDIYLGVNFNTLAEKQNQNCLILKLGEESALPFPGLAQQ 184

Query: 183 ICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLGGI 242
           +C+ +      + ++  +I   +    +  G  D    +  +S +  + G++  +     
Sbjct: 185 VCYTKGASKEFTDYSLSNIQ--NNLKQTRQGITD--DILQKLSNIKKVSGNFKSQFY--- 237

Query: 243 TKLASTLNREDWQGERNGFAVLSRDR-PNQTLLSVHMY 279
            +++ T+  E+W G   GF    R+R P ++ +SV  Y
Sbjct: 238 -RISETITDENWDGSAIGFTAHGRERNPKKSQISVTFY 274

>Smik_16.269 Chr16 complement(496858..497691) [834 bp, 277 aa] {ON}
           YPR027C (REAL)
          Length = 277

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/238 (17%), Positives = 100/238 (42%), Gaps = 14/238 (5%)

Query: 47  APQP---QNKAETALNTATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYL 103
            P P   ++ +E  L+     +Q +Q + +C     + P  + SC L  ++L+ +    L
Sbjct: 46  VPAPAATKSVSEKKLDDTKLTLQVIQTMVSCFSV-GENPANMISCGLGVVILMFSLIIEL 104

Query: 104 LKYLQENKLNSDADMEKMVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEG-SNRQK 162
           +  L+   ++    +  ++   + E+      + +   F  +DI   +     G    Q 
Sbjct: 105 INKLEHEGISEPQKLYDLIKPRYVELPSNYVNEKIKNTFEPLDIYLGVNLNNLGIDENQN 164

Query: 163 CLLMTVGENSIVPFHDLSTEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMP 222
           CL++ +GE S +PF  L+ ++C+ +      + +   +I     G+++ L     +  + 
Sbjct: 165 CLILKLGEKSALPFPGLAQQVCYTKGASKEFTDYKLSTIQ----GNLNGLRKGITNDVLQ 220

Query: 223 SVSELYTLFGDYTIEVLGGITKLASTLNREDWQGERNGFAVLSRDR-PNQTLLSVHMY 279
            +S +  + G++  +      +++  +  + W G   GF    +     ++ +SV  Y
Sbjct: 221 KISNIRKISGNFKSQFY----QISEKITDDSWDGSAIGFTAHGKQEGQRKSQISVSFY 274

>TPHA0D00720 Chr4 (146495..147487) [993 bp, 330 aa] {ON} 
          Length = 330

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 157 GSNRQKCLLMTVGENSIVPFHDLSTEICFDQYTLDSLSHH------NHGSISILDAGSVS 210
           G+ R  C+    G+NSI    +   E CF ++ ++ ++ H        GS+++  A  +S
Sbjct: 203 GNTRIGCVNFLYGKNSIFTNTNFQMETCFSKHGINEIATHFKERGIVKGSVAVYKA--MS 260

Query: 211 ALGFADISSKMPSVSELYTLFGDYTI----EVLGGITKLASTLNREDWQGER 258
            LG   I+  + +  ELYT F    I    E +  I  L   +N  +W G +
Sbjct: 261 ELG---ITKTIRAPKELYTAFAKAFIGHYKEGVQKINNLIDKINDTEWDGGK 309

>SAKL0B06138g Chr2 (521967..523007) [1041 bp, 346 aa] {ON} no
           similarity
          Length = 346

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 70/162 (43%), Gaps = 22/162 (13%)

Query: 138 VGKAFTKMDITQKL----VYPFEGSNRQKCLLMTVGENSIVPFHDL----STEICFDQYT 189
           V ++FT M+I+       +   +G++R  C       N   P +DL      EICF ++ 
Sbjct: 190 VYQSFTHMEISTDFRVGNITNMQGASRTNCCFYF---NIDYPDNDLLSAFQQEICFTKFA 246

Query: 190 LDSLSHHNH----GSISILDAGSVSALG-FADISSKMPSVSELYTLFGDYTIEVLGGITK 244
           L    ++      G+  +    ++  +G F  +   +     L  LF DYT E +  +T 
Sbjct: 247 LKKFGNNRFVDLPGNAVLKSMRALRNMGWFTPLKDPLEFGRGLNALFSDYTEEFVSKLTS 306

Query: 245 LASTLNREDWQGERNGFAVLSRDRPN---QTLLSVHMYSSSL 283
           +   + +ED  GE   +A    D+ N   + ++SV ++   +
Sbjct: 307 MIERVQKEDRAGE---YAFSISDKFNNVSEQMMSVKLFKRKV 345

>TDEL0F02740 Chr6 complement(503081..503965) [885 bp, 294 aa] {ON} 
          Length = 294

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 55/138 (39%), Gaps = 9/138 (6%)

Query: 152 VYPFEGSNRQKCLLMTVGENSIVPFHDLSTEICFDQYTLDSLSHHNHGSISILDAGSVSA 211
           +Y   G+ R  C    +G  ++      S E+C  +  L  L  +    + +     V+ 
Sbjct: 160 MYVKPGTQRLLCAAFGMGRATVFQHRGFSHEVCVTKEGLRRLGENRLSRLPLETLKKVAK 219

Query: 212 L----GFADISSKMP-SVSELYTLFGDYTIEVLGGITKLASTLNREDWQGERNGFAVLSR 266
                G   +++  P  ++     +G +T EV     ++ + +N+E+W G   GF +   
Sbjct: 220 YLVRGGLLKMANNPPLFLANAVQTYGAFTGEVQQRTHQMVTIMNQENWDGRALGFTI--- 276

Query: 267 DRPNQTLLSVHMYSSSLL 284
               Q LL    YS + L
Sbjct: 277 -EEGQNLLLTFKYSVNKL 293

>NDAI0D00460 Chr4 complement(91649..92485) [837 bp, 278 aa] {ON} 
          Length = 278

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 86/211 (40%), Gaps = 18/211 (8%)

Query: 82  PLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEKMVGLGFGEMVG-RIFGKGVGK 140
           P+  T+C L+ I  ++     +L+ L  ++   D  + K+    F  M+G   F K    
Sbjct: 65  PITATACYLSLIAAMINLLAMVLQGL--DRFEEDMAI-KLSASDFLLMLGIHDFKKFHKF 121

Query: 141 AFTKMDITQKLV-YPFEGSNRQKCLLMTVGENSIVPFHDLSTEICFDQYTLDSLSHHNHG 199
            F   D+   L     +GS    C+      N ++P  D   E+C      + + +  H 
Sbjct: 122 TFGIFDVNFNLYGLDIDGSTHLNCIEFITRSNILLP-KDTDVEVCVSDIGKERVRNLPHK 180

Query: 200 SISILDAGSVSAL----GFADI-SSKMPSVSELYTLFGDYTIEVLGGITKLASTLNREDW 254
                    +  L     F D+  + +     L+ ++G+ TI+ L  + ++ ++L  + W
Sbjct: 181 FTKSELLKKIKKLIENEKFNDVLENPLLFYKLLWGMYGENTIQFLDELYRMVNSLRSDKW 240

Query: 255 QGERNGFAVLSRDRPNQTL-LSVHMYSSSLL 284
           +       + + D   + L  S+H+YS  +L
Sbjct: 241 K------IIHAEDSSAKKLEESIHLYSDPVL 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,169,094
Number of extensions: 957415
Number of successful extensions: 2384
Number of sequences better than 10.0: 19
Number of HSP's gapped: 2433
Number of HSP's successfully gapped: 19
Length of query: 284
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 176
Effective length of database: 41,097,471
Effective search space: 7233154896
Effective search space used: 7233154896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)