Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.3221.399ON30330316270.0
YNL006W (LST8)1.399ON30330316270.0
Suva_14.3421.399ON30330316200.0
Skud_14.3211.399ON30330316180.0
TDEL0B059701.399ON30330315540.0
KAFR0H031401.399ON30330315510.0
ZYRO0E04620g1.399ON30330315500.0
KNAG0H016901.399ON30330315430.0
CAGL0H03729g1.399ON30330315160.0
Kpol_487.71.399ON30330315100.0
SAKL0D08756g1.399ON30330314940.0
NCAS0G036001.399ON32730714870.0
NDAI0C026001.399ON30330314770.0
KLTH0H12122g1.399ON30330314540.0
Kwal_0.2121.399ON30330314500.0
KLLA0D04840g1.399ON30330314480.0
AAL009C1.399ON30330314430.0
Ecym_12931.399ON30330314420.0
TPHA0O007101.399ON30430413790.0
TBLA0D048701.399ON32732712061e-167
YIL046W (MET30)7.231ON6402882391e-21
ADL082C7.231ON5693022353e-21
NCAS0D047806.363ON6212282302e-20
TBLA0F042406.363ON7272862283e-20
KLLA0F27511g7.231ON6233012284e-20
Kpol_1070.117.231ON6662882274e-20
Suva_9.1547.231ON6382912275e-20
Kwal_27.120538.544ON7552792275e-20
KNAG0D016907.231ON6543142266e-20
KLTH0E12606g8.544ON7552792266e-20
Smik_9.1447.231ON6302912231e-19
Smik_2.3388.544ON8002852204e-19
CAGL0E00561g6.363ON8363122195e-19
ZYRO0A12980g8.544ON8243032196e-19
Skud_9.1237.231ON6392972186e-19
CAGL0M05335g8.544ON8062842188e-19
TDEL0H021307.231ON5842902161e-18
KLTH0E10120g8.435ON8262572161e-18
KLTH0A04114g7.231ON6583092161e-18
ZYRO0D16742g7.231ON6082962161e-18
Ecym_25236.363ON6462312142e-18
CAGL0C00737g8.435ON8162502133e-18
Ecym_43437.231ON5833102133e-18
AEL269C7.534ON4552192123e-18
SAKL0H09988g8.544ON7492792133e-18
Skud_2.3248.544ON8022862108e-18
KLLA0F10263g6.363ON6822472108e-18
Kpol_1028.416.340ON5123342081e-17
NCAS0A055206.363ON6713252081e-17
AGL234W6.363ON6292312081e-17
SAKL0F08404g7.231ON6433092082e-17
TPHA0M020006.363ON6993072072e-17
AEL246C8.544ON8152762072e-17
ZYRO0A09636g8.435ON8082592072e-17
YBR198C (TAF5)8.544ON7982842063e-17
TBLA0H036208.544ON8122832063e-17
SAKL0H12760g8.435ON8412662054e-17
CAGL0L00781g7.231ON6733012054e-17
TDEL0B030208.544ON8313102054e-17
KAFR0I018807.231ON5912972044e-17
KLTH0A06380g6.325ON9152212045e-17
Kwal_27.115858.435ON8232542045e-17
KNAG0E023102.431ON3193012005e-17
KAFR0C047406.363ON6652382036e-17
Smik_3.1726.340ON5153362027e-17
TDEL0A077806.363ON6572362027e-17
Ecym_70388.544ON8002752021e-16
Kpol_1028.236.363ON7442352011e-16
Kwal_23.57697.231ON6272992011e-16
Smik_12.1928.324ON9432832011e-16
TPHA0M018306.340ON5153372001e-16
Skud_12.1988.324ON9432772002e-16
KNAG0D002506.363ON6553072002e-16
TPHA0G023802.431ON3182981962e-16
NCAS0B022008.544ON8222862002e-16
NCAS0C027108.435ON8152501992e-16
Suva_4.4528.544ON8002871992e-16
ZYRO0D17292g6.363ON7182371992e-16
TBLA0D041307.231ON5743001983e-16
SAKL0A01276g6.340ON5153361973e-16
KAFR0C038302.663ON3812731963e-16
SAKL0A00660g6.363ON6602371973e-16
KNAG0A037008.544ON8172861983e-16
Smik_12.2798.435ON8172661973e-16
TPHA0C011507.231ON6873011973e-16
Skud_3.1566.363ON7132361974e-16
KLLA0E23453g8.544ON8262761974e-16
YCR084C (TUP1)6.363ON7132361964e-16
CAGL0C03608g6.363ON6433041964e-16
ZYRO0D08206g6.340ON5153351956e-16
Suva_3.1216.363ON7002361957e-16
KLTH0A07282g6.363ON7252361957e-16
NDAI0C054908.544ON8592121957e-16
YCR072C (RSA4)6.340ON5153361948e-16
TBLA0F005206.363ON6632541948e-16
Suva_10.2228.324ON9432771949e-16
KAFR0E031808.544ON8142861941e-15
Kwal_23.64296.363ON7502361931e-15
Suva_3.1096.340ON5153371921e-15
Smik_3.1836.363ON7092361922e-15
KLLA0C08547g6.340ON5153361912e-15
Ecym_24986.340ON5423011912e-15
Kpol_1024.428.544ON8432821922e-15
Kwal_23.62406.325ON9132211922e-15
TPHA0L016908.544ON8322861912e-15
KAFR0H017508.435ON7832741912e-15
CAGL0M04279g8.324ON9402541913e-15
NDAI0E034408.435ON8572761913e-15
Kwal_56.239208.324ON9372761913e-15
TDEL0B020108.435ON8052651903e-15
Suva_10.3168.435ON8182471904e-15
TBLA0F041306.340ON5143321884e-15
Smik_3.1576.325ON9242151895e-15
NCAS0D046106.340ON5153301885e-15
Kpol_1031.498.435ON7602761885e-15
Kpol_297.72.431ON3183011847e-15
Skud_3.1456.340ON5153391877e-15
NDAI0I003506.340ON5153341867e-15
TPHA0C008108.324ON9372561878e-15
YCR057C (PWP2)6.325ON9232151869e-15
CAGL0J03476g6.340ON5173191869e-15
YLR222C (UTP13)8.435ON8172471869e-15
Kpol_1048.598.544ON8502911861e-14
KNAG0A025108.435ON8492651861e-14
TDEL0A074006.325ON9012221861e-14
NCAS0D044806.325ON9152211861e-14
SAKL0A10406g1.534ON7112851851e-14
Ecym_41348.435ON8102711852e-14
NCAS0A134307.231ON6082901842e-14
KAFR0F043506.340ON5153311832e-14
ZYRO0G20152g2.431ON3192981802e-14
KNAG0I028406.340ON5192981822e-14
Skud_12.2858.435ON8172661833e-14
KLTH0A06754g6.340ON5142971823e-14
TBLA0A039508.324ON9362521824e-14
KAFR0A005102.431ON3192991784e-14
NDAI0A026107.231ON7673051814e-14
Suva_13.2952.431ON3192981775e-14
Skud_13.2752.431ON3192981775e-14
Smik_13.3052.431ON3192981775e-14
YMR116C (ASC1)2.431ON3192981775e-14
SAKL0A01738g6.325ON9092211805e-14
TDEL0A075506.340ON5153141796e-14
TDEL0F045008.324ON9382741807e-14
KLLA0F13244g8.435ON8142611798e-14
Kwal_23.63246.340ON5142971789e-14
Kpol_1036.698.324ON9362711771e-13
NDAI0H027102.431ON3182991741e-13
TBLA0I025708.435ON8482701772e-13
KLTH0G12276g8.324ON9372521762e-13
KNAG0I025406.325ON9181901762e-13
TPHA0D038306.325ON9122151762e-13
TPHA0L010808.435ON8352751753e-13
KAFR0J025506.325ON9062151753e-13
TBLA0B091002.431ON3172961713e-13
NCAS0C032608.324ON9832581734e-13
SAKL0H15532g8.324ON9412921726e-13
CAGL0K09284g6.325ON9112351726e-13
ZYRO0F11110g7.322ON12012141719e-13
KNAG0H001802.663ON3892601699e-13
AER263C6.340ON5133331701e-12
KLLA0D16390g8.324ON9362371701e-12
NCAS0A151707.534ON4742121691e-12
TDEL0A020702.431ON3193001671e-12
Suva_3.936.325ON9202151701e-12
Ecym_42558.324ON9372751691e-12
NDAI0G025808.324ON9582331692e-12
CAGL0I03718g7.322ON12012651682e-12
AGR180W8.435ON8062781682e-12
ZYRO0F10406g8.324ON9382871673e-12
Kpol_1028.546.325ON9052201673e-12
AFR199C2.431ON3342991644e-12
TPHA0I018808.544ON10342001664e-12
KNAG0G024508.324ON9422591664e-12
KAFR0H022608.324ON9382531655e-12
AAR057W6.325ON9222171656e-12
YKL021C (MAK11)2.663ON4682861636e-12
Kpol_1054.601.534ON7193001647e-12
Smik_11.2332.663ON4152871628e-12
NCAS0A042702.431ON3182991609e-12
Ecym_24018.672ON4262301629e-12
NDAI0A020907.322ON12002911639e-12
YKL213C (DOA1)1.534ON7152831631e-11
NDAI0I004606.325ON9172221631e-11
SAKL0E03960g2.431ON3202981591e-11
AGL196C8.324ON9352541621e-11
SAKL0F15972g7.534ON4701761601e-11
KAFR0A006002.450ON8943131611e-11
KLTH0A00880g7.534ON4712401602e-11
NCAS0F018502.431ON3182991592e-11
KLTH0D04466g2.431ON3192401582e-11
NCAS0C044503.25ON4612781602e-11
KLLA0C08976g6.325ON9112141612e-11
Suva_16.1598.672ON4511761602e-11
TPHA0P014903.25ON4592771592e-11
AER255C5.429ON4672221592e-11
Ecym_60982.431ON3183061572e-11
TDEL0A061808.672ON4342761574e-11
Kpol_1072.178.672ON4332411574e-11
KAFR0E039005.429ON4392561574e-11
Skud_11.2072.663ON4152891574e-11
Smik_11.101.534ON7172821575e-11
KAFR0L013907.322ON12062921585e-11
NCAS0G043001.534ON7252801575e-11
Ecym_70788.585ON3132031555e-11
TBLA0C018408.672ON4232461565e-11
Suva_11.2052.663ON4152871566e-11
KNAG0F038707.534ON4651811566e-11
TBLA0E007607.534ON3842221556e-11
Ecym_20936.325ON9232421566e-11
SAKL0H06666g8.672ON4412461556e-11
KNAG0A032208.631ON4233151557e-11
NCAS0C016808.672ON4312461557e-11
Smik_13.3442.380ON3472301547e-11
TBLA0F022307.322ON12162831567e-11
Ecym_80901.247ON7162861567e-11
KLTH0D11132g8.672ON4371771548e-11
TBLA0I022806.325ON9272351568e-11
Skud_13.3072.380ON3472321539e-11
Suva_4.997.322ON12012891551e-10
Kpol_2001.657.322ON12062141551e-10
Suva_13.3252.380ON3472301531e-10
TDEL0A057708.631ON4333151531e-10
NCAS0F033405.429ON4482641531e-10
ACR166W2.663ON3892881531e-10
ZYRO0D08558g6.325ON9122351541e-10
ZYRO0F14960g8.585ON3192041511e-10
Smik_4.907.322ON12012141542e-10
CAGL0F06853g2.663ON3882701512e-10
KLLA0E07965g2.663ON3902891512e-10
ZYRO0F07282g8.672ON4271791512e-10
CAGL0M02277g8.672ON4272411512e-10
NDAI0G038303.25ON5102771512e-10
SAKL0F10648g7.322ON12032141523e-10
NCAS0A139407.322ON12052141513e-10
Smik_6.3488.672ON4512401503e-10
KLLA0E12277g2.431ON3263041493e-10
TDEL0A004403.25ON4512771503e-10
YPL151C (PRP46)8.672ON4511761503e-10
Suva_11.71.534ON7192821513e-10
Skud_16.1318.672ON4512401503e-10
TDEL0D013101.247ON7092551503e-10
KNAG0B027207.322ON12042641513e-10
YMR146C (TIF34)2.380ON3472321484e-10
TDEL0B075802.663ON3902881494e-10
TDEL0C022407.322ON12012141504e-10
NDAI0B051901.247ON6682701504e-10
Skud_4.1097.322ON12012141504e-10
YLR129W (DIP2)8.324ON9432821504e-10
TPHA0D045007.322ON12082141504e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL006W
         (303 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...   631   0.0  
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...   631   0.0  
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...   628   0.0  
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...   627   0.0  
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....   603   0.0  
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...   602   0.0  
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...   601   0.0  
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...   598   0.0  
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...   588   0.0  
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...   586   0.0  
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...   580   0.0  
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...   577   0.0  
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}     573   0.0  
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...   564   0.0  
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...   563   0.0  
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...   562   0.0  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...   560   0.0  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...   560   0.0  
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...   535   0.0  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...   469   e-167
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    97   1e-21
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    95   3e-21
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     93   2e-20
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    92   3e-20
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    92   4e-20
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    92   4e-20
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    92   5e-20
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    92   5e-20
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    92   6e-20
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    92   6e-20
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    91   1e-19
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    89   4e-19
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    89   5e-19
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    89   6e-19
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    89   6e-19
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    89   8e-19
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    88   1e-18
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    88   1e-18
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    88   1e-18
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    88   1e-18
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    87   2e-18
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    87   3e-18
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    87   3e-18
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    86   3e-18
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    87   3e-18
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    86   8e-18
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    86   8e-18
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    85   1e-17
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    85   1e-17
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    85   1e-17
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    85   2e-17
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    84   2e-17
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    84   2e-17
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    84   2e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    84   3e-17
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    84   3e-17
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    84   4e-17
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    84   4e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    84   4e-17
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    83   4e-17
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    83   5e-17
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    83   5e-17
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    82   5e-17
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    83   6e-17
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    82   7e-17
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    82   7e-17
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    82   1e-16
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    82   1e-16
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    82   1e-16
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    82   1e-16
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    82   1e-16
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    82   2e-16
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    82   2e-16
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    80   2e-16
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    82   2e-16
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    81   2e-16
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    81   2e-16
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    81   2e-16
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    81   3e-16
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    80   3e-16
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    80   3e-16
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    80   3e-16
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    81   3e-16
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    80   3e-16
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    80   3e-16
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    80   4e-16
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    80   4e-16
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    80   4e-16
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    80   4e-16
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    80   6e-16
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    80   7e-16
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    80   7e-16
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             80   7e-16
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    79   8e-16
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    79   8e-16
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    79   9e-16
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    79   1e-15
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    79   1e-15
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    79   1e-15
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    79   2e-15
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    78   2e-15
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    78   2e-15
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    79   2e-15
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    79   2e-15
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    78   2e-15
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    78   2e-15
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    78   3e-15
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    78   3e-15
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    78   3e-15
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    78   3e-15
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    78   4e-15
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    77   4e-15
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    77   5e-15
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     77   5e-15
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    77   5e-15
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    75   7e-15
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    77   7e-15
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       76   7e-15
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    77   8e-15
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    76   9e-15
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    76   9e-15
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    76   9e-15
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    76   1e-14
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    76   1e-14
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    76   1e-14
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    76   1e-14
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    76   1e-14
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    76   2e-14
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    75   2e-14
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    75   2e-14
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    74   2e-14
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    75   2e-14
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    75   3e-14
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    75   3e-14
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    75   4e-14
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    73   4e-14
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     74   4e-14
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    73   5e-14
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    73   5e-14
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    73   5e-14
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    73   5e-14
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    74   5e-14
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    74   6e-14
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    74   7e-14
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    74   8e-14
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    73   9e-14
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    73   1e-13
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    72   1e-13
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    73   2e-13
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    72   2e-13
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    72   2e-13
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    72   2e-13
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    72   3e-13
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    72   3e-13
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    70   3e-13
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    71   4e-13
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    71   6e-13
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    71   6e-13
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    70   9e-13
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    70   9e-13
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    70   1e-12
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    70   1e-12
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    70   1e-12
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    69   1e-12
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    70   1e-12
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    70   1e-12
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    70   2e-12
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    69   2e-12
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    69   2e-12
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    69   3e-12
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    69   3e-12
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    68   4e-12
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    69   4e-12
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    69   4e-12
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    68   5e-12
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    68   6e-12
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    67   6e-12
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    68   7e-12
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    67   8e-12
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    66   9e-12
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    67   9e-12
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    67   9e-12
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    67   1e-11
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       67   1e-11
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    66   1e-11
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    67   1e-11
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    66   1e-11
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    67   1e-11
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    66   2e-11
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    66   2e-11
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    65   2e-11
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      66   2e-11
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    67   2e-11
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    66   2e-11
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    66   2e-11
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    66   2e-11
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    65   2e-11
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    65   4e-11
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    65   4e-11
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    65   4e-11
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    65   4e-11
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    65   5e-11
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    65   5e-11
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    65   5e-11
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    64   5e-11
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    65   5e-11
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    65   6e-11
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    65   6e-11
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               64   6e-11
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    65   6e-11
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    64   6e-11
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    64   7e-11
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     64   7e-11
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    64   7e-11
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    65   7e-11
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    65   7e-11
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    64   8e-11
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    65   8e-11
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    64   9e-11
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    64   1e-10
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    64   1e-10
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    64   1e-10
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    64   1e-10
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    64   1e-10
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    64   1e-10
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    64   1e-10
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    63   1e-10
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    64   2e-10
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    63   2e-10
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    63   2e-10
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    63   2e-10
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    63   2e-10
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      63   2e-10
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    63   3e-10
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    63   3e-10
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    62   3e-10
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    62   3e-10
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    62   3e-10
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    62   3e-10
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    63   3e-10
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    62   3e-10
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    62   3e-10
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    63   3e-10
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    62   4e-10
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    62   4e-10
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    62   4e-10
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    62   4e-10
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    62   4e-10
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    62   4e-10
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    62   4e-10
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    62   4e-10
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    61   4e-10
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     62   5e-10
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    62   5e-10
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    62   5e-10
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    62   6e-10
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    62   6e-10
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    61   6e-10
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    62   7e-10
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    61   7e-10
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    62   7e-10
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    61   7e-10
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    61   9e-10
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    61   9e-10
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    61   9e-10
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    61   1e-09
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    60   1e-09
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    60   1e-09
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    60   1e-09
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    60   1e-09
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    60   1e-09
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    60   1e-09
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    60   2e-09
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    60   2e-09
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    60   2e-09
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    60   2e-09
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    60   2e-09
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    60   2e-09
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    60   2e-09
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    59   2e-09
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    60   2e-09
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    59   2e-09
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    60   2e-09
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    60   2e-09
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    60   3e-09
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    59   3e-09
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    59   3e-09
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    60   3e-09
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    59   3e-09
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    60   3e-09
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    59   3e-09
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    59   4e-09
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    59   4e-09
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    59   4e-09
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    59   4e-09
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    59   5e-09
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    59   5e-09
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    58   5e-09
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    59   5e-09
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    59   5e-09
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    59   6e-09
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    59   6e-09
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    58   6e-09
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    59   7e-09
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    58   7e-09
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    59   7e-09
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    58   8e-09
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    58   8e-09
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    58   9e-09
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    58   9e-09
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    58   9e-09
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    57   9e-09
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    58   1e-08
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    58   1e-08
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    58   1e-08
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    58   1e-08
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    57   1e-08
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    58   1e-08
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    57   1e-08
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    57   1e-08
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    57   1e-08
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    57   2e-08
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    57   2e-08
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    57   2e-08
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    57   2e-08
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    57   2e-08
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    57   2e-08
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    57   2e-08
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    57   2e-08
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    57   2e-08
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    57   2e-08
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    56   2e-08
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    56   3e-08
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    56   3e-08
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    56   3e-08
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    56   3e-08
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    56   3e-08
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    57   3e-08
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    56   3e-08
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    57   3e-08
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    56   3e-08
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    56   3e-08
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     56   4e-08
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    56   4e-08
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    56   4e-08
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    56   4e-08
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    55   4e-08
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      56   4e-08
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    55   5e-08
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    56   5e-08
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    56   5e-08
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    55   5e-08
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    55   5e-08
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    56   5e-08
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    55   5e-08
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    54   5e-08
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    55   5e-08
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    55   5e-08
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    55   6e-08
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    55   6e-08
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    55   6e-08
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    55   6e-08
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    55   6e-08
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    55   7e-08
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    55   7e-08
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      55   7e-08
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    55   7e-08
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    55   8e-08
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    55   8e-08
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    55   8e-08
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    55   8e-08
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    55   9e-08
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    55   9e-08
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    54   9e-08
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    54   1e-07
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    55   1e-07
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    54   1e-07
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    55   1e-07
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    55   1e-07
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    55   1e-07
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    54   1e-07
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    55   1e-07
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    55   1e-07
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    54   1e-07
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    54   1e-07
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     55   1e-07
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    54   1e-07
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    54   1e-07
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    55   1e-07
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    54   1e-07
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    54   1e-07
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    54   1e-07
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    54   1e-07
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    54   2e-07
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    54   2e-07
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    54   2e-07
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    54   2e-07
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    54   2e-07
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    54   2e-07
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    54   2e-07
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    54   2e-07
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    54   2e-07
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    54   2e-07
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    54   2e-07
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    54   2e-07
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    54   2e-07
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    54   2e-07
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    54   2e-07
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    54   2e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    54   2e-07
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    54   2e-07
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    54   2e-07
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    54   2e-07
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    54   2e-07
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    53   2e-07
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    54   3e-07
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    54   3e-07
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    54   3e-07
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    53   3e-07
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    53   3e-07
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    53   3e-07
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    54   3e-07
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    53   3e-07
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    53   3e-07
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    53   3e-07
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    53   3e-07
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    54   3e-07
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    53   4e-07
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    53   4e-07
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    53   4e-07
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    53   4e-07
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    53   4e-07
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    53   4e-07
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    53   4e-07
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    53   5e-07
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    52   5e-07
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    52   5e-07
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    53   5e-07
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    52   5e-07
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    52   5e-07
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    52   5e-07
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    52   6e-07
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    53   6e-07
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    52   6e-07
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    52   6e-07
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    52   6e-07
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    52   6e-07
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    52   6e-07
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    52   6e-07
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    52   6e-07
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    52   7e-07
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    52   7e-07
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    52   7e-07
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    52   7e-07
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    52   8e-07
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    52   8e-07
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    52   8e-07
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    52   8e-07
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    52   8e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    52   9e-07
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    51   9e-07
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    52   1e-06
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    52   1e-06
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    52   1e-06
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    52   1e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    52   1e-06
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    52   1e-06
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    52   1e-06
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    52   1e-06
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    52   1e-06
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    52   1e-06
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    51   1e-06
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    51   1e-06
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    52   1e-06
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    51   1e-06
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    51   1e-06
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    51   1e-06
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    52   1e-06
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    52   1e-06
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    52   1e-06
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    51   1e-06
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    51   1e-06
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    51   2e-06
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    51   2e-06
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    50   2e-06
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    51   2e-06
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    51   2e-06
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    51   2e-06
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    51   2e-06
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    51   2e-06
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    51   2e-06
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    51   2e-06
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    51   2e-06
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    51   2e-06
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    50   2e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    50   2e-06
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    50   2e-06
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    50   2e-06
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    51   2e-06
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    51   2e-06
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    50   2e-06
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    50   2e-06
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    50   2e-06
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    51   2e-06
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    50   2e-06
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    51   2e-06
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    50   2e-06
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    50   2e-06
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    50   2e-06
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    50   2e-06
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    50   3e-06
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    50   3e-06
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    50   3e-06
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    50   3e-06
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    50   3e-06
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    50   3e-06
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    50   3e-06
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    50   3e-06
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    50   3e-06
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    50   3e-06
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    50   3e-06
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    50   3e-06
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    50   3e-06
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    50   3e-06
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    50   4e-06
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    50   4e-06
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    50   4e-06
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    49   4e-06
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    50   4e-06
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    50   4e-06
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    50   4e-06
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    49   4e-06
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    50   4e-06
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    50   4e-06
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    50   5e-06
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    49   5e-06
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    50   5e-06
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    49   6e-06
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    50   6e-06
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    49   6e-06
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    49   6e-06
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    49   6e-06
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    49   6e-06
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    49   6e-06
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    49   6e-06
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    49   6e-06
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    49   7e-06
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    49   7e-06
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     49   8e-06
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    49   8e-06
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    49   8e-06
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    49   8e-06
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    49   9e-06
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    49   9e-06
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    49   9e-06
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    49   9e-06
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    49   9e-06
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    49   1e-05
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    48   1e-05
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    49   1e-05
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    49   1e-05
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    49   1e-05
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    49   1e-05
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    48   1e-05
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    49   1e-05
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    49   1e-05
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    49   1e-05
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    49   1e-05
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    49   1e-05
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    49   1e-05
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    48   1e-05
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    48   1e-05
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    48   1e-05
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    48   1e-05
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    49   1e-05
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    48   1e-05
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    49   1e-05
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    48   1e-05
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    48   1e-05
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    48   1e-05
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    48   1e-05
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    48   1e-05
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    48   2e-05
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    48   2e-05
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    48   2e-05
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    48   2e-05
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    48   2e-05
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    48   2e-05
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       48   2e-05
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    48   2e-05
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    47   2e-05
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    48   2e-05
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    47   2e-05
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    48   2e-05
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    48   2e-05
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    48   2e-05
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    47   2e-05
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    48   2e-05
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    48   2e-05
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    47   2e-05
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    48   2e-05
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    48   2e-05
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    48   2e-05
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    48   2e-05
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    48   2e-05
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    47   2e-05
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    47   2e-05
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    47   2e-05
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    48   2e-05
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    48   2e-05
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    47   2e-05
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    47   3e-05
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    47   3e-05
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    47   3e-05
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    47   3e-05
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    47   3e-05
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    47   3e-05
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    47   3e-05
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    47   3e-05
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    47   3e-05
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    47   3e-05
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    47   3e-05
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    47   3e-05
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    47   3e-05
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    47   3e-05
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    47   3e-05
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    47   3e-05
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    47   3e-05
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    47   3e-05
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    47   4e-05
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    47   4e-05
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    47   4e-05
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    47   4e-05
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    47   4e-05
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    47   4e-05
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    47   4e-05
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    47   4e-05
ZYRO0F14146g Chr6 (1162473..1163828) [1356 bp, 451 aa] {ON} simi...    47   4e-05
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    47   4e-05
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    47   5e-05
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    46   5e-05
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    46   5e-05
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    47   5e-05
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    47   5e-05
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    46   5e-05
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    47   5e-05
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    47   5e-05
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    46   6e-05
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    46   6e-05
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    46   6e-05
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     46   6e-05
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      46   6e-05
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    46   6e-05
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    46   7e-05
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    46   7e-05
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    46   7e-05
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    46   7e-05
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    46   7e-05
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    46   7e-05
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    46   8e-05
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    46   8e-05
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    46   8e-05
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    46   8e-05
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    46   8e-05
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    46   8e-05
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    46   8e-05
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    45   9e-05
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    45   9e-05
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    45   9e-05
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    46   9e-05
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    45   1e-04
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    46   1e-04
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    46   1e-04
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    46   1e-04
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    46   1e-04
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    45   1e-04
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    45   1e-04
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    45   1e-04
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    45   1e-04
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    45   1e-04
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    45   1e-04
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    45   1e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    45   1e-04
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    45   1e-04
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    45   1e-04
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    45   1e-04
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    45   1e-04
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    45   1e-04
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    45   1e-04
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    45   1e-04
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    45   2e-04
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    45   2e-04
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    45   2e-04
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    45   2e-04
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    45   2e-04
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    45   2e-04
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    45   2e-04
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    45   2e-04
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    45   2e-04
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    45   2e-04
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    45   2e-04
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    45   2e-04
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    45   2e-04
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    44   2e-04
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    45   2e-04
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    45   2e-04
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    45   2e-04
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    45   2e-04
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    45   2e-04
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    44   2e-04
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    44   2e-04
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    45   2e-04
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    44   2e-04
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    44   2e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    45   2e-04
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    45   2e-04
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    44   2e-04
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    44   3e-04
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    44   3e-04
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    44   3e-04
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    44   3e-04
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    44   3e-04
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    44   3e-04
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    44   3e-04
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    44   3e-04
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    44   3e-04
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    44   3e-04
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    44   3e-04
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    44   3e-04
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    44   3e-04
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    44   3e-04
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    44   3e-04
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    44   4e-04
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    44   4e-04
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    44   4e-04
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    44   4e-04
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    44   4e-04
TBLA0A07380 Chr1 complement(1829567..1832275) [2709 bp, 902 aa] ...    44   4e-04
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    44   4e-04
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    44   4e-04
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    44   4e-04
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    44   4e-04
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    43   5e-04
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    44   5e-04
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    44   5e-04
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    43   5e-04
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    43   5e-04
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    44   5e-04
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    43   5e-04
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    44   5e-04
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    44   6e-04
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    43   6e-04
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    43   6e-04
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    42   7e-04
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    43   7e-04
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    43   7e-04
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    43   7e-04
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    43   7e-04
ABL096W Chr2 (217132..218472) [1341 bp, 446 aa] {ON} Syntenic ho...    43   7e-04
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    43   7e-04
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    42   8e-04
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    43   8e-04
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    43   8e-04
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    43   8e-04
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    42   8e-04
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    42   8e-04
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    43   9e-04
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    43   9e-04
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    42   0.001
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    43   0.001
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    43   0.001
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    42   0.001
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    42   0.001
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    42   0.001
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    42   0.001
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    42   0.001
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    42   0.001
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    42   0.001
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    42   0.001
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    42   0.001
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    42   0.001
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    42   0.001
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    42   0.001
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    42   0.001
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    42   0.001
KLTH0H12870g Chr8 (1098531..1100117) [1587 bp, 528 aa] {ON} simi...    42   0.001
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    42   0.001
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    42   0.001
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    42   0.002
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    42   0.002
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    42   0.002
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    42   0.002
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    42   0.002
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    42   0.002
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    41   0.002
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    41   0.002
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    41   0.002
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    41   0.002
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    41   0.002
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    42   0.002
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    42   0.002
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    41   0.002
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    41   0.002
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    42   0.002
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    41   0.002
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    41   0.002
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    41   0.002
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    41   0.003
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    41   0.003
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    41   0.003
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    41   0.003
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    41   0.003
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    41   0.003
KNAG0B05540 Chr2 (1079174..1080511) [1338 bp, 445 aa] {ON} Anc_4...    41   0.003
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    41   0.003
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    41   0.003
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    41   0.003
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    41   0.003
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    40   0.003
TDEL0D02290 Chr4 complement(442275..443876) [1602 bp, 533 aa] {O...    41   0.003
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    40   0.003
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    40   0.003
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    41   0.003
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    41   0.003
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    40   0.004
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    41   0.004
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    40   0.004
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    40   0.004
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    40   0.004
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    41   0.004
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    40   0.004
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    40   0.004
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    40   0.004
ADL316C Chr4 complement(141605..145861) [4257 bp, 1418 aa] {ON} ...    41   0.004
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    40   0.004
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    40   0.004
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    40   0.004
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    40   0.005
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    40   0.005
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    40   0.005
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    40   0.005
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    40   0.005
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    40   0.005
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               40   0.005
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    40   0.005
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    40   0.005
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    40   0.005
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    40   0.005
ZYRO0C12188g Chr3 (953145..959606) [6462 bp, 2153 aa] {ON} simil...    40   0.005
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    40   0.006
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    40   0.006
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    40   0.006
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    40   0.006
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    40   0.006
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    40   0.006
Ecym_5534 Chr5 complement(1080033..1082465) [2433 bp, 810 aa] {O...    40   0.006
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    40   0.006
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    40   0.006
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    40   0.007
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    40   0.007
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    40   0.007
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    40   0.008
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    40   0.008
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    39   0.008
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    40   0.008
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    39   0.009
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    40   0.009
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    40   0.009
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    39   0.009
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    39   0.009
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    39   0.009
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    40   0.010
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    39   0.010
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    39   0.010
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    39   0.010
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    39   0.010
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    39   0.010
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    39   0.010
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    39   0.011
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    39   0.011
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.011
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    39   0.011
CAGL0L09757g Chr12 complement(1048895..1049875) [981 bp, 326 aa]...    39   0.011
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    39   0.011
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    39   0.011
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    39   0.011
TBLA0D04920 Chr4 complement(1202907..1204853) [1947 bp, 648 aa] ...    39   0.011
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    39   0.012
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    39   0.012
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    39   0.012
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    39   0.012
Kwal_0.356 s0 (169040..170620) [1581 bp, 526 aa] {ON} YFR021W (A...    39   0.013
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    39   0.013
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    39   0.013
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    39   0.013
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    39   0.013
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    39   0.013
TBLA0F02330 Chr6 complement(576335..577975) [1641 bp, 546 aa] {O...    39   0.013
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    39   0.014
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    39   0.014
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    39   0.014
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    39   0.014
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    39   0.014
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    39   0.014
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    39   0.015
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    39   0.015
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    39   0.015
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    39   0.016
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    39   0.016
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    39   0.016
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    39   0.017
Ecym_8312 Chr8 complement(636090..638663) [2574 bp, 857 aa] {ON}...    39   0.017
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               39   0.018
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    39   0.018
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    39   0.019
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    39   0.019
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    39   0.020
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    39   0.020
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    39   0.020
TPHA0E03510 Chr5 (741718..748116) [6399 bp, 2132 aa] {ON} Anc_1....    39   0.021
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    38   0.021
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    38   0.021
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    39   0.021
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    38   0.021
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    38   0.022
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    38   0.022
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    38   0.022
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    38   0.022
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    38   0.023
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    38   0.024
KLLA0D04664g Chr4 (397818..399320) [1503 bp, 500 aa] {ON} simila...    38   0.024
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    38   0.025
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    38   0.025
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    38   0.025
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    38   0.026
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    38   0.026
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    38   0.026
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    38   0.026
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    38   0.026
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    38   0.027
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    38   0.027
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    38   0.028
SAKL0F15730g Chr6 (1278090..1279715) [1626 bp, 541 aa] {ON} simi...    38   0.028
Ecym_3559 Chr3 complement(1060241..1061944) [1704 bp, 567 aa] {O...    38   0.029
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    37   0.029
SAKL0H18436g Chr8 complement(1637161..1640109) [2949 bp, 982 aa]...    38   0.029
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    38   0.030
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    38   0.030
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    38   0.031
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    38   0.031
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    38   0.032
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    38   0.032
Kpol_1006.15 s1006 complement(54320..55933) [1614 bp, 537 aa] {O...    38   0.032
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    38   0.033
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    38   0.034
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    38   0.034
Smik_4.319 Chr4 (570640..573624) [2985 bp, 994 aa] {ON} YDR080W ...    38   0.034
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    37   0.034
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    37   0.035
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    38   0.035
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    37   0.035
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    37   0.035
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    37   0.036
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    38   0.036
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    37   0.036
TPHA0D02860 Chr4 (596215..597192) [978 bp, 325 aa] {ON} Anc_5.61...    37   0.036
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    37   0.037
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    37   0.037
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    38   0.038
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    37   0.038
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    38   0.038
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    37   0.038
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    37   0.039
TBLA0D04560 Chr4 (1130244..1131584) [1341 bp, 446 aa] {ON} Anc_7...    37   0.039
YFR021W Chr6 (194812..196314) [1503 bp, 500 aa] {ON}  ATG18Phosp...    37   0.041
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    37   0.042
TDEL0F01750 Chr6 (325359..328655) [3297 bp, 1098 aa] {ON} Anc_6....    37   0.042
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    37   0.042
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    37   0.042
KLTH0E02134g Chr5 (192040..193065) [1026 bp, 341 aa] {ON} conser...    37   0.043
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    37   0.043
Skud_4.335 Chr4 (579305..582289) [2985 bp, 994 aa] {ON} YDR080W ...    37   0.044
TDEL0F01000 Chr6 (176870..178516) [1647 bp, 548 aa] {ON} Anc_8.1...    37   0.044
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    37   0.045
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    37   0.046
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    37   0.047
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    37   0.047
AAL119W Chr1 (137922..139535) [1614 bp, 537 aa] {ON} Syntenic ho...    37   0.047
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    37   0.049
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    37   0.050
ZYRO0G00946g Chr7 complement(72544..74184) [1641 bp, 546 aa] {ON...    37   0.051
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    37   0.053
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    37   0.053
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    37   0.054
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    37   0.055
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    37   0.055
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    37   0.056
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    37   0.056
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    37   0.056
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    37   0.057
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    37   0.057
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    37   0.058
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    37   0.059
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    37   0.059
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    37   0.059
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    37   0.060
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    37   0.062
NCAS0B04140 Chr2 complement(748270..751122) [2853 bp, 950 aa] {O...    37   0.062
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    37   0.062
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    37   0.064
Kwal_0.49 s0 (20604..22358) [1755 bp, 584 aa] {ON} YJL069C (UTP1...    37   0.065
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    37   0.065
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    37   0.066
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    37   0.066
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    37   0.066
Kpol_1057.7 s1057 complement(16034..17017) [984 bp, 327 aa] {ON}...    37   0.066
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    37   0.067
Kpol_1018.67 s1018 (194053..195033) [981 bp, 326 aa] {ON} (19405...    36   0.067
ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar...    36   0.067
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    37   0.068
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    36   0.069
TPHA0D01010 Chr4 complement(204354..206117) [1764 bp, 587 aa] {O...    37   0.070
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    37   0.072
KNAG0L00330 Chr12 (45380..47014) [1635 bp, 544 aa] {ON} Anc_8.43...    37   0.072
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    36   0.073
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    36   0.073
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    37   0.073
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    36   0.073
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    37   0.074
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.075
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    36   0.078
TBLA0C00970 Chr3 complement(193861..194844) [984 bp, 327 aa] {ON...    36   0.081
TBLA0C02620 Chr3 (622295..624985) [2691 bp, 896 aa] {ON} Anc_1.3...    37   0.081
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    36   0.086
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    36   0.087
TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1....    37   0.089
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    36   0.090
YDR080W Chr4 (604008..606986) [2979 bp, 992 aa] {ON}  VPS41Vacuo...    36   0.097
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    36   0.097
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    36   0.098
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    36   0.098
Kpol_1055.37 s1055 (93164..95716) [2553 bp, 850 aa] {ON} (93164....    36   0.100
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    36   0.10 
NDAI0G05990 Chr7 complement(1480864..1482261) [1398 bp, 465 aa] ...    36   0.10 
AAR048W Chr1 (425661..428696) [3036 bp, 1011 aa] {ON} Syntenic h...    36   0.10 
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    36   0.11 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    36   0.11 
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    36   0.11 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    36   0.11 
TDEL0F03030 Chr6 (545760..552173) [6414 bp, 2137 aa] {ON} Anc_1....    36   0.11 
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    36   0.11 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    36   0.12 
KAFR0C04445 Chr3 (882595..884274) [1680 bp, 559 aa] {ON}               36   0.12 
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    36   0.12 
ZYRO0D15510g Chr4 (1296067..1297374) [1308 bp, 435 aa] {ON} simi...    36   0.12 
TPHA0A05030 Chr1 complement(1134867..1136255) [1389 bp, 462 aa] ...    36   0.12 
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    36   0.12 
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    36   0.12 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    36   0.12 
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    35   0.13 
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    35   0.13 
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    36   0.13 
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    36   0.13 
CAGL0L06578g Chr12 complement(741735..742333,742449..743709) [18...    36   0.14 
Kwal_47.19083 s47 (1089260..1090234) [975 bp, 324 aa] {ON} YGL21...    35   0.14 
SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} simila...    35   0.14 
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    36   0.14 
NDAI0I01440 Chr9 (343925..345076) [1152 bp, 383 aa] {ON} Anc_6.1...    35   0.14 
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    36   0.14 
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    35   0.15 
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    35   0.15 
ZYRO0B15290g Chr2 (1246428..1247783) [1356 bp, 451 aa] {ON} simi...    35   0.15 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    36   0.15 
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    35   0.15 
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    35   0.16 
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    35   0.16 
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    35   0.16 
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    35   0.16 
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    35   0.16 
KLTH0C05456g Chr3 complement(468453..471500) [3048 bp, 1015 aa] ...    35   0.17 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    35   0.17 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    35   0.17 
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    35   0.17 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    35   0.18 
Kwal_55.19926 s55 (180008..180946) [939 bp, 312 aa] {ON} YOR026W...    35   0.18 
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    35   0.18 
AGR149W Chr7 (1028985..1031642) [2658 bp, 885 aa] {ON} Syntenic ...    35   0.18 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    35   0.18 
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    35   0.18 
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    35   0.19 
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    35   0.19 
Kwal_33.14449 s33 complement(675978..677504) [1527 bp, 508 aa] {...    35   0.19 
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    35   0.19 
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    35   0.19 
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    35   0.20 
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    34   0.20 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    35   0.20 
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    35   0.21 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    35   0.21 
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    35   0.21 
KNAG0C02000 Chr3 (392436..393917) [1482 bp, 493 aa] {ON} Anc_1.3...    35   0.21 
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    35   0.21 
CAGL0K10692g Chr11 (1040242..1041759) [1518 bp, 505 aa] {ON} sim...    35   0.22 
KLTH0H11022g Chr8 (947447..949195) [1749 bp, 582 aa] {ON} simila...    35   0.22 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    35   0.23 
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    35   0.23 
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    35   0.23 
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    35   0.23 
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    35   0.24 
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    35   0.24 
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    35   0.24 
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    35   0.24 
Ecym_5584 Chr5 complement(1199282..1200238) [957 bp, 318 aa] {ON...    35   0.25 
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    35   0.25 
Smik_11.117 Chr11 (199819..202362) [2544 bp, 847 aa] {ON} YKL121...    35   0.26 
ZYRO0E08602g Chr5 (687971..689242) [1272 bp, 423 aa] {ON} simila...    35   0.26 
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    35   0.26 
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    35   0.27 
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    35   0.28 
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     35   0.28 
KLLA0E18063g Chr5 (1608371..1609351) [981 bp, 326 aa] {ON} highl...    34   0.28 
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    35   0.29 
TDEL0A01650 Chr1 (298190..299332) [1143 bp, 380 aa] {ON} Anc_6.1...    35   0.29 
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    35   0.30 
NCAS0D00540 Chr4 complement(85322..86953) [1632 bp, 543 aa] {ON}...    35   0.30 
KNAG0A04990 Chr1 complement(726567..727844) [1278 bp, 425 aa] {O...    35   0.30 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    35   0.30 
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    35   0.30 
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              35   0.31 
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    35   0.31 
TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.4...    35   0.31 
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    35   0.32 
KLTH0F03806g Chr6 complement(336740..343105) [6366 bp, 2121 aa] ...    35   0.32 
TPHA0H02270 Chr8 complement(540737..543412) [2676 bp, 891 aa] {O...    35   0.32 
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    34   0.33 
AER439W Chr5 (1476148..1476150,1476201..1477442) [1245 bp, 414 a...    34   0.33 
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    34   0.33 
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    34   0.33 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    34   0.35 
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    34   0.35 
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    34   0.35 
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    34   0.36 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    34   0.37 
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    34   0.37 
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    34   0.38 
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    34   0.38 
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    34   0.40 
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    34   0.40 
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    34   0.40 
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    34   0.41 
TPHA0C00610 Chr3 complement(112452..113798) [1347 bp, 448 aa] {O...    34   0.42 
YER124C Chr5 complement(407342..409063) [1722 bp, 573 aa] {ON}  ...    34   0.42 
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    34   0.42 
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    34   0.44 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    34   0.44 
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    34   0.45 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    34   0.45 
NDAI0J00810 Chr10 complement(179995..181353) [1359 bp, 452 aa] {...    34   0.48 
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    34   0.48 
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    34   0.49 
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    34   0.49 
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    34   0.51 
Smik_15.204 Chr15 (345627..346652) [1026 bp, 341 aa] {ON} YOR026...    33   0.51 
AGR242C Chr7 complement(1203146..1204405) [1260 bp, 419 aa] {ON}...    34   0.52 
Skud_6.105 Chr6 (190549..192051) [1503 bp, 500 aa] {ON} YFR021W ...    34   0.54 
Suva_2.240 Chr2 (404330..407275) [2946 bp, 981 aa] {ON} YDR080W ...    34   0.54 
KLLA0A07106g Chr1 complement(640536..641468) [933 bp, 310 aa] {O...    33   0.54 
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    33   0.55 
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    34   0.56 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    33   0.58 
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    33   0.58 
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      33   0.59 
Kpol_1036.90 s1036 (235306..236667) [1362 bp, 453 aa] {ON} (2353...    33   0.59 
NDAI0A07070 Chr1 complement(1610054..1612360) [2307 bp, 768 aa] ...    34   0.60 
NCAS0B08480 Chr2 (1619636..1626055) [6420 bp, 2139 aa] {ON} Anc_...    34   0.60 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    33   0.60 
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    34   0.61 
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               33   0.61 
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    33   0.62 
KLTH0G01650g Chr7 complement(121279..122466,122554..122556) [119...    33   0.62 
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    34   0.63 
KLLA0C11759g Chr3 (1011298..1013889) [2592 bp, 863 aa] {ON} simi...    34   0.63 
NCAS0A08960 Chr1 (1774232..1775620) [1389 bp, 462 aa] {ON} Anc_1...    33   0.63 
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    33   0.64 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    33   0.64 
TBLA0E03320 Chr5 complement(831986..832945) [960 bp, 319 aa] {ON...    33   0.64 
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    33   0.66 
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    33   0.69 
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    33   0.71 
KLLA0F01991g Chr6 complement(179904..182510) [2607 bp, 868 aa] {...    33   0.71 
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    33   0.71 
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    33   0.72 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    33   0.75 
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    33   0.75 
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    33   0.76 
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    33   0.78 
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    33   0.78 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    33   0.79 
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    33   0.79 
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    33   0.79 
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    33   0.79 
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    33   0.80 
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    33   0.82 
KNAG0B02990 Chr2 (577427..579097) [1671 bp, 556 aa] {ON} Anc_7.2...    33   0.84 
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    33   0.85 
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    33   0.88 
CAGL0E00979g Chr5 complement(89783..91048) [1266 bp, 421 aa] {ON...    33   0.89 
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    33   0.90 
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    33   0.93 
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    33   0.95 
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    33   0.99 
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    33   1.0  
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    33   1.1  
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    33   1.1  
Smik_7.332 Chr7 (556142..557641) [1500 bp, 499 aa] {ON} YFR021W ...    33   1.1  
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    33   1.1  
Suva_6.93 Chr6 (160006..161508) [1503 bp, 500 aa] {ON} YFR021W (...    33   1.1  
YIR012W Chr9 (378486..379781) [1296 bp, 431 aa] {ON}  SQT1Essent...    33   1.1  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    33   1.1  
CAGL0K11638g Chr11 complement(1124172..1125950) [1779 bp, 592 aa...    33   1.2  
KAFR0E00720 Chr5 (153164..154477) [1314 bp, 437 aa] {ON} Anc_8.5...    33   1.2  
SAKL0H22638g Chr8 complement(1968593..1972378) [3786 bp, 1261 aa...    33   1.2  
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    33   1.2  
SAKL0H25740g Chr8 (2254859..2254871,2254990..2256593) [1617 bp, ...    33   1.2  
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    33   1.2  
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    33   1.3  
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    33   1.3  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   1.3  
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    33   1.3  
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    33   1.3  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    33   1.3  
TDEL0G01290 Chr7 (261621..262943) [1323 bp, 440 aa] {ON} Anc_5.1...    32   1.3  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    33   1.3  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    32   1.4  
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    33   1.4  
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    32   1.4  
NDAI0C00230 Chr3 (35404..36426) [1023 bp, 340 aa] {ON} Anc_2.657...    32   1.5  
NDAI0H03610 Chr8 (887848..889410) [1563 bp, 520 aa] {ON} Anc_1.359     32   1.5  
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    32   1.5  
TDEL0A07480 Chr1 complement(1303665..1306520) [2856 bp, 951 aa] ...    32   1.5  
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    32   1.5  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    33   1.5  
NCAS0C01450 Chr3 complement(267976..270597) [2622 bp, 873 aa] {O...    32   1.6  
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    32   1.6  
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    32   1.6  
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    32   1.6  
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    32   1.6  
NCAS0A12450 Chr1 (2459574..2460878) [1305 bp, 434 aa] {ON} Anc_7...    32   1.6  
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    32   1.6  
SAKL0F13640g Chr6 (1089998..1093051) [3054 bp, 1017 aa] {ON} hig...    32   1.7  
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    32   1.7  
Smik_4.81 Chr4 (151682..153250) [1569 bp, 522 aa] {ON} YDL156W (...    32   1.7  
Suva_8.79 Chr8 (141412..142443) [1032 bp, 343 aa] {ON} YOR026W (...    32   1.8  
NCAS0J01050 Chr10 (175326..179243) [3918 bp, 1305 aa] {ON} Anc_4...    32   1.8  
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    32   1.8  
TPHA0D04410 Chr4 (949150..951882) [2733 bp, 910 aa] {ON} Anc_8.2...    32   1.8  
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    32   1.9  
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    32   1.9  
ZYRO0G21736g Chr7 (1788792..1789856) [1065 bp, 354 aa] {ON} high...    32   1.9  
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    32   1.9  
TPHA0F02850 Chr6 complement(633867..635480) [1614 bp, 537 aa] {O...    32   1.9  
CAGL0J11286g Chr10 (1097912..1099498) [1587 bp, 528 aa] {ON} sim...    32   1.9  
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    32   1.9  
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    32   1.9  
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    32   1.9  
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    32   2.0  
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    32   2.0  
YCR032W Chr3 (179520..186023) [6504 bp, 2167 aa] {ON}  BPH1PProt...    32   2.0  
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    32   2.0  
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    32   2.0  
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    32   2.1  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    32   2.1  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    32   2.1  
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    32   2.1  
Kwal_14.1924 s14 complement(529306..532131) [2826 bp, 941 aa] {O...    32   2.2  
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    32   2.3  
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    32   2.3  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    32   2.3  
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    32   2.4  
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    32   2.4  
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    32   2.4  
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    32   2.4  
TPHA0O01210 Chr15 complement(238057..239778) [1722 bp, 573 aa] {...    32   2.4  
YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Prote...    32   2.4  
Kwal_56.24577 s56 complement(1061240..1062766) [1527 bp, 508 aa]...    32   2.4  
ABR189W Chr2 (764141..765370) [1230 bp, 409 aa] {ON} Syntenic ho...    32   2.6  
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    32   2.6  
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    32   2.7  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    32   2.7  
Kwal_27.10573 s27 complement(399825..402872) [3048 bp, 1015 aa] ...    32   2.8  
AEL153W Chr5 (343247..344950) [1704 bp, 567 aa] {ON} Syntenic ho...    32   2.9  
SAKL0C04422g Chr3 complement(431806..438456) [6651 bp, 2216 aa] ...    32   2.9  
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    32   2.9  
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    32   2.9  
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    32   2.9  
SAKL0B10934g Chr2 complement(947188..948693) [1506 bp, 501 aa] {...    32   3.0  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    32   3.0  
Smik_9.212 Chr9 (354323..355615) [1293 bp, 430 aa] {ON} YIR012W ...    31   3.0  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    32   3.0  
Ecym_2491 Chr2 complement(962810..965785) [2976 bp, 991 aa] {ON}...    32   3.0  
NDAI0E02190 Chr5 complement(450769..453492) [2724 bp, 907 aa] {O...    32   3.1  
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    31   3.1  
KAFR0A01660 Chr1 complement(339554..341353) [1800 bp, 599 aa] {O...    32   3.1  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    32   3.1  
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    31   3.1  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    32   3.1  
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    31   3.2  
CAGL0A00781g Chr1 (77746..81366) [3621 bp, 1206 aa] {ON} similar...    32   3.2  
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    32   3.2  
TDEL0H02670 Chr8 complement(447727..449049) [1323 bp, 440 aa] {O...    31   3.2  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    32   3.3  
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    31   3.3  
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    31   3.3  
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    31   3.3  
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    31   3.3  
KLTH0C01848g Chr3 complement(165526..166121,166518..167517) [159...    31   3.4  
Kpol_242.8 s242 (12067..13335) [1269 bp, 422 aa] {ON} (12067..13...    31   3.4  
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    31   3.4  
KLLA0F23397g Chr6 complement(2184751..2186256) [1506 bp, 501 aa]...    31   3.4  
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    31   3.4  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    31   3.5  
KLLA0C16533g Chr3 complement(1448866..1450404) [1539 bp, 512 aa]...    31   3.5  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    31   3.7  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    31   3.7  
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    31   3.7  
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    31   3.8  
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    31   3.8  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    31   3.9  
KAFR0A06530 Chr1 (1320422..1324123) [3702 bp, 1233 aa] {ON} Anc_...    31   4.0  
TBLA0B01860 Chr2 complement(424732..427818) [3087 bp, 1028 aa] {...    31   4.0  
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    31   4.1  
NDAI0J01790 Chr10 (441237..445535) [4299 bp, 1432 aa] {ON} Anc_4...    31   4.1  
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    31   4.2  
TPHA0A01250 Chr1 (240466..241863) [1398 bp, 465 aa] {ON} Anc_8.5...    31   4.2  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    31   4.2  
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    31   4.2  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    31   4.3  
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    31   4.3  
Skud_5.254 Chr5 (412459..414180) [1722 bp, 573 aa] {ON} YER124C ...    31   4.4  
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    31   4.6  
ZYRO0B11264g Chr2 (888911..891631) [2721 bp, 906 aa] {ON} simila...    31   4.7  
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    31   4.8  
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    31   4.9  
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    31   5.0  
Smik_1.66 Chr1 (126883..130701) [3819 bp, 1272 aa] {ON} YAL002W ...    31   5.1  
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    31   5.2  
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    31   5.2  
Suva_9.223 Chr9 (366063..367358) [1296 bp, 431 aa] {ON} YIR012W ...    30   5.4  
SAKL0H09130g Chr8 (778200..779408) [1209 bp, 402 aa] {ON} simila...    30   5.5  
Ecym_8134 Chr8 (277019..283225) [6207 bp, 2068 aa] {ON} similar ...    31   5.6  
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               30   5.7  
ACR162C Chr3 complement(637642..640224) [2583 bp, 860 aa] {ON} S...    31   5.7  
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    30   5.9  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    31   6.1  
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    30   6.1  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    30   6.2  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    30   6.3  
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               30   6.6  
KAFR0K00510 Chr11 (107850..109355) [1506 bp, 501 aa] {ON} Anc_7....    30   6.7  
Kpol_1010.25 s1010 complement(55113..58259) [3147 bp, 1048 aa] {...    30   6.8  
Kwal_0.40 s0 complement(16823..19411) [2589 bp, 862 aa] {ON} YBR...    30   6.9  
NDAI0F00770 Chr6 (185453..188332) [2880 bp, 959 aa] {ON} Anc_5.6...    30   7.0  
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    30   7.2  
YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}  VPS8Membr...    30   7.2  
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    30   7.2  
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    30   7.2  
KLLA0C12771g Chr3 (1081988..1085017) [3030 bp, 1009 aa] {ON} sim...    30   7.2  
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    30   7.3  
Suva_16.211 Chr16 (371708..373201) [1494 bp, 497 aa] {ON} YPL100...    30   7.4  
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    30   7.4  
YHR073W Chr8 (242582..245572) [2991 bp, 996 aa] {ON}  OSH3Member...    30   7.4  
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    30   7.6  
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    30   7.7  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    30   7.8  
Smik_5.269 Chr5 complement(416222..417940) [1719 bp, 572 aa] {ON...    30   7.8  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    30   7.9  
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    30   8.1  
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    30   8.2  
TPHA0A00660 Chr1 (118435..120429) [1995 bp, 664 aa] {ON} Anc_3.9...    30   8.2  
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    30   8.3  
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    30   8.4  
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    30   8.5  
YPL100W Chr16 (361872..363362) [1491 bp, 496 aa] {ON}  ATG21Phos...    30   8.6  
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    30   8.6  
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    30   8.7  
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    30   9.0  
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    30   9.0  
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    30   9.0  
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    30   9.1  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    30   9.2  
Kwal_23.6290 s23 complement(1517611..1520487) [2877 bp, 958 aa] ...    30   9.3  
Smik_8.150 Chr8 (218930..221941) [3012 bp, 1003 aa] {ON} YHR073W...    30   9.6  
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    30   9.6  
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    30   9.7  
Suva_4.21 Chr4 complement(45539..48805) [3267 bp, 1088 aa] {ON} ...    30   9.8  
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    30   9.8  
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    30   9.9  
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    30   10.0 

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/303 (99%), Positives = 303/303 (100%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI+DDF
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/303 (99%), Positives = 302/303 (99%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPN TDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF
Sbjct: 181 GNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/303 (93%), Positives = 299/303 (98%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSV+LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT+DKKLLA AGHQNVRLYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPVASFEGHRGNVTS+SFQQDN+WMV+SSEDGTIKVWDVR+PS+PRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDT LQSLS+ASDGSML AAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANSK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPN TDAS+LKPVTKFR+H+TYITRILLSSDVKHLATCSADHTARVWSID++F
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKHLATCSADHTARVWSIDNNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           +LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST+EIVRQYGGHHKGAVCVAL
Sbjct: 241 ELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTKEIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/303 (93%), Positives = 296/303 (97%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLL  AGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPVA+FEGH+GNVTS+SFQQDNRWMVTSSEDGTIKVWDVRSPS+PRNYKHNAPVN
Sbjct: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+T LQSLS+ASDGSML AAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPNHTDAS+LKPVTKF+AHS YITRILLSSDVKHLATCSAD TAR WS+DD+F
Sbjct: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           KLE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/303 (94%), Positives = 296/303 (97%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLA AGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPVASFEGHRGNVTSVSFQQDN+WM TSSEDGTIKVWDVR+PSIPRNYK NAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDG+IRIWDLGENQCTHQLTPEDDT LQSLS+ASDGSML AAN K
Sbjct: 121 EVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANNK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPN TDAS+LKPVTKFR+H+TYITRILLSSDVKHLATCSADHTARVWS+DD+F
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSADHTARVWSVDDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           KLETTLDGHQRWVWDCAFSADSAYL+TASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/303 (93%), Positives = 296/303 (97%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLA AGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPVASFEGH+GNVTS+SFQQDN+WMV+SSEDGTIKVWDVRSPSIPRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD  LQS+S+ASDGSML AANTK
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDIPLQSISVASDGSMLVAANTK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNC+VWEMPNHTDAS+LKPVTKF+AH+ YITRILLSSDVKHLATCSADHT RVWSID++F
Sbjct: 181 GNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDVKHLATCSADHTTRVWSIDNNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           KLE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE+VRQYGGHHKG VCVAL
Sbjct: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREVVRQYGGHHKGVVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/303 (89%), Positives = 292/303 (96%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSV+LVSAGYDHTIRFWEALTGVC RTIQH DSQVNRLEITNDKKLLA AGHQN+RLYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           +T+N NPVASFEGHRGNVTSVSFQQDN+WMVTSSEDGTIKVWD+RSPS+PRNYKHNAPVN
Sbjct: 61  KTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD  LQSLS+ASDGSML AAN K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPNHTDAS+LKP TKF+AH +YITR+LLSSDVKH+ATCSADHTAR+WS++D+F
Sbjct: 181 GNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            LE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR+I+RQYGGHHKGAVCVAL
Sbjct: 241 NLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/303 (91%), Positives = 288/303 (95%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRL ITNDKKLLA AGHQNV+LYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
            TTNPNPVASFEGHRGNVTS+SFQ DNRWMVTSSEDGTIKVWDVRSPS+PR YKHNAPVN
Sbjct: 61  NTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EV IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDT +QSLS+A+DGSML AAN+K
Sbjct: 121 EVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLSLATDGSMLVAANSK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVWEMPN TDAS+LKPVTKFRAH  YITRILLSSDVK LATCSADHTAR+WSIDD+F
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSIDDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            L TTLDGHQRWVWDCAFSADSAYL+TASSDHYVRLWDLSTREIVRQY GHHKGAVCVAL
Sbjct: 241 NLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {ON}
           highly similar to uniprot|P41318 Saccharomyces
           cerevisiae YNL006W LST8 Protein required for the
           transport of amino acid permease Gap1p from the Golgi to
           the cell surface component of the TOR signaling pathway
           associates with both Tor1p and Tor2p contains a
           WD-repeat
          Length = 303

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/303 (89%), Positives = 291/303 (96%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEIT+DK+ LA AGH +VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPV SFEGHRGNVTS+SFQQDN+WMV+SSEDGTIKVWDVR+PS+ RNYKH+APVN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCD+DGNIRIWDLGENQCTHQLTPEDDT LQSLS+ASDGSML A N K
Sbjct: 121 EVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVW+MPNHTDA++LKPVTKFR+H+ YITR+LLSSDVKHLATCSADHTARVWSI+D+F
Sbjct: 181 GNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           KLETTLDGHQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGAVCVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/307 (88%), Positives = 291/307 (94%), Gaps = 4/307 (1%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLA AG+QNVRLYDI
Sbjct: 21  MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDI 80

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPN VA+FEGH+GNVTSVSFQQDN+WMVTSSEDGTIKVWDVRSPS+PRNYKHNAPVN
Sbjct: 81  RTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 140

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD-TSLQSLSMASDGSMLAAANT 179
           EVVIHPNQGELISCDRDG I+IWDLGENQCTHQL P+DD TSLQSLS+ASDGSML AAN 
Sbjct: 141 EVVIHPNQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANN 200

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI--- 236
           KG+CYVWEMPNHTDAS+LKP+ KF AH  YITR++LSSDVKH+ATCSAD TA++WS+   
Sbjct: 201 KGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGET 260

Query: 237 DDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 296
           +DDF LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV
Sbjct: 261 EDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 320

Query: 297 CVALNDV 303
           CVALNDV
Sbjct: 321 CVALNDV 327

>NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON} 
          Length = 303

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/303 (87%), Positives = 288/303 (95%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSV+LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRL+ITNDKKLLA AGH NV+LYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLQITNDKKLLAAAGHLNVKLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
            TTNPNPV SFEGH+GNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS+PRNYKHNAPVN
Sbjct: 61  NTTNPNPVGSFEGHKGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQ+TPE+D SL+SLS+ASDGSMLAAAN +
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQITPEEDVSLESLSIASDGSMLAAANDR 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCY+WEMPNHTDAS+LKPV  F AH TY+TR+LLSSDVKHLATCSAD +AR+WS+++ F
Sbjct: 181 GNCYIWEMPNHTDASNLKPVKTFSAHETYVTRVLLSSDVKHLATCSADQSARIWSVENGF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           + E  L+GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 QRECALEGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           +DV
Sbjct: 301 DDV 303

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/303 (86%), Positives = 286/303 (94%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT+DK+ LA AGH NVRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKRFLAAAGHLNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPV SFEGHRGNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PS+ RNYKH+A VN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAAVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCD+DGNI+IWDLGENQC HQL PEDDT LQSLS+ASDGSML A N K
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVW+MP+ TDA++ +PVTKFR+H+ YITR+LLSSDVKHLATCSADHTARVWSIDD+F
Sbjct: 181 GNCYVWQMPHQTDAANPRPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           +LETTLDGHQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 QLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 284/303 (93%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ LA AGH NVRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPV SFEGHRGNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PS+ RNYKH A VN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PEDDT LQSLS+ASDGSML A N K
Sbjct: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVW+MP+ TDA++ KPVTKFR+H+ YITR+LLSSDVKHLATCSADHTARVWSIDD+F
Sbjct: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           +LETTLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 288/303 (95%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEIT+DKK LA AGH +VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           R+ NPNPV+SFEGH+GNVTS++FQQ+NRWMV+SSEDGTIKVWDVRSPS+ RNYKHNAPVN
Sbjct: 61  RSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EV IHPNQGELISCD+DGNIRIWDLGENQCT+QLTPED+T LQSLS+ASDGSML A N K
Sbjct: 121 EVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVW+MP+HTDAS L+PVTKF++H+ YITR+LLS+DVKHLATCSADHTARVW+I+D+F
Sbjct: 181 GNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           +LETTLDGHQRWVWDCAFSADSAYLVTA SDHYVRLWDLST EIVRQYGGHHKGAVCVAL
Sbjct: 241 ELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL006W
           (LST8)
          Length = 303

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/303 (85%), Positives = 285/303 (94%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEIT+DK+ LA AGH +VR+YDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPV SFEGHRGNVTS++FQQDN+WMV+SSEDGTIKVWDVRSPS+ RNYKH+APVN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCD+DGNI+IWDLGENQCT+QL  ED+T+LQSLS+ASDGSML A N K
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVW+MPNHTD + LKPVTKFR+HS YITR+LLS DVKHLATCSADHTARVWS++D+F
Sbjct: 181 GNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           +LETTLD H RWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGAVCVAL
Sbjct: 241 QLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to
           Ashbya gossypii AAL009C
          Length = 303

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/303 (85%), Positives = 284/303 (93%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEIT+DK+ LA  GH +VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAGGHLHVRLYDI 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           RTTNPNPV SFEGHRGNVTS++FQQDN+WMV+SSEDGTIKVWDVR+PS+ RNYKHNAPVN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRTPSVQRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           EVVIHPNQGELISCD+DGNI+IWDLGENQCTHQL  EDDT LQSLS+ASDGSML A + K
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCTHQLALEDDTPLQSLSIASDGSMLVAGSNK 180

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
           GNCYVW+MPNHTD ++LKPVTKFR+H+ YITR+LLS DVKHLATCSADHTARVWSI+D+F
Sbjct: 181 GNCYVWKMPNHTDTANLKPVTKFRSHTKYITRVLLSVDVKHLATCSADHTARVWSIEDNF 240

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           +LETTLD H RWVWDCAFSADSAYLVTA SDHY+RLWDLSTREIVRQYGGHHKGAVCVAL
Sbjct: 241 QLETTLDTHSRWVWDCAFSADSAYLVTACSDHYIRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.399
           YNL006W
          Length = 304

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/304 (80%), Positives = 278/304 (91%), Gaps = 1/304 (0%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQH DSQVN+LEITNDKKLLA AG  N++LYD+
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHPDSQVNKLEITNDKKLLAAAGSNNIKLYDV 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
            T+N NP+ASF+GH+ NVTS++FQ +N+WMVTSSED TIK+WD+RSPS PR YKHN PVN
Sbjct: 61  NTSNSNPIASFDGHKNNVTSINFQVENKWMVTSSEDNTIKLWDIRSPSSPRTYKHNCPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED-DTSLQSLSMASDGSMLAAANT 179
           EV+IHPNQGELISCD+DGNIRIWDLGENQCTHQLTPED D S+QS+S+A+DGSML AAN 
Sbjct: 121 EVIIHPNQGELISCDKDGNIRIWDLGENQCTHQLTPEDNDISIQSISLANDGSMLVAANN 180

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           KGNCYVW+MPN  DAS+LKP+TKF+AH +YIT+ILLSSDVK++ATCSADHTAR+WS++D+
Sbjct: 181 KGNCYVWDMPNKIDASNLKPITKFKAHDSYITKILLSSDVKYMATCSADHTARIWSVEDN 240

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           F L+ TL GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST EIVRQY GH KGA CVA
Sbjct: 241 FTLDKTLTGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTNEIVRQYSGHQKGATCVA 300

Query: 300 LNDV 303
           LND+
Sbjct: 301 LNDI 304

>TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {ON}
           Anc_1.399 YNL006W
          Length = 327

 Score =  469 bits (1206), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 223/327 (68%), Positives = 262/327 (80%), Gaps = 24/327 (7%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQH +SQVNRLEI++DK LLA A +Q+VRLYD+
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHPESQVNRLEISSDKTLLAAAANQSVRLYDL 60

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSI-PRNYKHN--- 116
           ++ NP P+A  +GH GNVT+V+FQ++ +W+ T+SEDG ++VWDVRSP   PR Y H    
Sbjct: 61  QSANPTPLACLDGHGGNVTAVAFQRERQWIATASEDGAVRVWDVRSPPTQPRIYLHGSSG 120

Query: 117 -------------------APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157
                              APVN+V IHPNQ EL+SCDR G +R+WDL   + THQL PE
Sbjct: 121 SSSSTSGNSSSASSVGTGAAPVNDVAIHPNQAELVSCDRSGTLRVWDLAGGRSTHQLVPE 180

Query: 158 DDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSS 217
           DD  LQSLS++ DGS L AANTKGNCYVW+MPN TDAS LKP++ F+AH+TYITR LLSS
Sbjct: 181 DDIPLQSLSLSPDGSTLVAANTKGNCYVWDMPNRTDASSLKPLSVFKAHNTYITRALLSS 240

Query: 218 DVKHLATCSADHTARVWSIDDD-FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
           D KH+ATCSADHTA++WSID++   LE TLDGHQRWVWDCAFSADSAYLVTASSDHYVRL
Sbjct: 241 DGKHIATCSADHTAKIWSIDNESVNLEITLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 300

Query: 277 WDLSTREIVRQYGGHHKGAVCVALNDV 303
           WDLST+EIVRQYGGH KG +CVALND+
Sbjct: 301 WDLSTKEIVRQYGGHQKGVICVALNDI 327

>YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box
           protein containing five copies of the WD40 motif,
           controls cell cycle function, sulfur metabolism, and
           methionine biosynthesis as part of the ubiquitin ligase
           complex; interacts with and regulates Met4p, localizes
           within the nucleus
          Length = 640

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 126/288 (43%), Gaps = 12/288 (4%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               ++++ GH  +V SV   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-SDGSMLAAANTKGN 182
           +HP      SC  D  IR+WD+  N C            + + +   D   LA  NT   
Sbjct: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDG 488

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKL 242
               + P  TD +           +     I   +   HL +C  D+T ++W +     +
Sbjct: 489 SSPQDDPTMTDGADESDTPSNEQETVLDENIPYPT---HLLSCGLDNTIKLWDVKTGKCI 545

Query: 243 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
            T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 546 RTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 87/225 (38%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V ++ F  + R + T S D TI +WD+ +  + R    H+  V    ++ 
Sbjct: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 350

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 351 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 374

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R HS  +  + + S  K + + SAD T +VW ++   +   TL
Sbjct: 375 -------------ISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES--RTCYTL 417

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 46/119 (38%), Gaps = 20/119 (16%)

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           KG+C + E   H D                   + L  + + L T S D T  +W +   
Sbjct: 290 KGHCRIQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTIGIWDLFTG 332

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
            KL   L GH   V    F  D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 333 -KLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388

 Score = 33.1 bits (74), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 14/86 (16%)

Query: 229 HTARVWSI--DDDFKLETT----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
            T R W +   + FK+E+             GH   V    F+     L T S D  + +
Sbjct: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGI 326

Query: 277 WDLSTREIVRQYGGHHKGAVCVALND 302
           WDL T +++R+  GH  G   +  +D
Sbjct: 327 WDLFTGKLIRRLSGHSDGVKTLYFDD 352

>ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL046W
           (MET30)
          Length = 569

 Score = 95.1 bits (235), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 133/302 (44%), Gaps = 26/302 (8%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L++  YD T+  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 271 LLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTG 329

Query: 64  NPNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
               V+++ GH+ +V SV SF+   + +V+ S D T+KVW V S +      H   VN V
Sbjct: 330 AC--VSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            +HP      S   D  IR+WD+  N C            + + +     ++        
Sbjct: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEDPKD--- 441

Query: 183 CYVWEMPNHTDASHLKPV--TKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
                 P+ T  +H   V    F     Y T         HL +CS D+T ++W++    
Sbjct: 442 --AVVPPDATAPAHDPSVQAANFDHSLPYPT---------HLLSCSLDNTIKLWNVKTGA 490

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            + T   GH   VWD A  AD+  +V+ S D   ++WDL T + +  + G H    CV +
Sbjct: 491 CIRTQF-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547

Query: 301 ND 302
            D
Sbjct: 548 GD 549

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 82/224 (36%), Gaps = 56/224 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V  +S Q  N+ ++T S D T+ +WD+ +  + R    +    + +   +
Sbjct: 252 IQEFKGHMDGV--LSLQLTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
           Q +LI+   D  IR+W+     C        D+ L                         
Sbjct: 310 Q-KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS------------------------ 344

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
                       V  FR               K + + SAD T +VW ++   +   TL 
Sbjct: 345 ------------VDSFR---------------KLIVSGSADKTVKVWHVES--RTCYTLR 375

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH  WV        S    + S D  +R+WD+ T   VR + GH
Sbjct: 376 GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFS 259
           + +F+ H   +  + L++  K L T S D T  +W +    KL   L GH   V   A  
Sbjct: 252 IQEFKGHMDGVLSLQLTN--KLLLTGSYDSTVAIWDLATG-KLIRRLSGHTDGVK--ALR 306

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
            D   L+T S D  +R+W+  T   V  Y GH    + V
Sbjct: 307 FDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV 345

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 107/228 (46%), Gaps = 7/228 (3%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D  ++ T +ED  I++W+++   I    K H   +  +   P+  +L+S   
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D +IRIWDL   QC+  L+ ED  +  ++S  ++G ++AA +   +  +W+         
Sbjct: 404 DRSIRIWDLKTGQCSLTLSIEDGVTTVAVS-PNEGKLIAAGSLDRSVRIWDSSTGFLVER 462

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD----FKLETTLDGHQR 251
           L    +    H   +  +  + D +H+ + S D T ++W++ D      K E T  GH+ 
Sbjct: 463 LDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKD 522

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           +V   A S D  Y+ + S D  V +WD  +   +    GH    + VA
Sbjct: 523 FVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVA 570

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 10/108 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDI--- 60
           LVS   D +IR W+  TG CS T+   D         N+ KL+A     ++VR++D    
Sbjct: 398 LVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTG 457

Query: 61  ----RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
               R  + N   S  GH+ +V SV+F +D + +V+ S D T+K+W++
Sbjct: 458 FLVERLDSDN--ESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 123/286 (43%), Gaps = 24/286 (8%)

Query: 38  LEITNDKKLLATAGHQNVRLYDIRT----------------TNPNPVASFEGHRGNVTSV 81
           +  +ND + LAT  ++  R+Y   T                +N     + E     + SV
Sbjct: 404 VRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSV 463

Query: 82  SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNI 140
            F  D +++   +ED  I++WD+ +  I    K H   +  +   P+  +L+S   D  +
Sbjct: 464 CFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTV 523

Query: 141 RIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPV 200
           RIWDL   QC+  L+ ED  +  S S  ++G  +AA +   +  +W+         L   
Sbjct: 524 RIWDLRTGQCSLTLSIEDGVTTVS-SSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQ 582

Query: 201 TKFR-AHSTYITRILLSSDVKHLATCSADHTARVWSID-----DDFKLETTLDGHQRWVW 254
           T  +  H   I  +  + D K L + S D + ++W++D      +   E T  GH+ +V 
Sbjct: 583 TDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVL 642

Query: 255 DCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
               S +  Y+++ S D  V  WD ++   +    GH    + VA+
Sbjct: 643 SVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISVAV 688

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/305 (20%), Positives = 116/305 (38%), Gaps = 35/305 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTI------------------QHSDSQVNRLEITNDKKL 46
            ++ G + T R ++  TG    T+                  + SD  +  +  + D K 
Sbjct: 412 FLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFSPDGKF 471

Query: 47  LATAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
           LA       +R++DI T     V   +GH  ++ S+ +      +V+ S D T+++WD+R
Sbjct: 472 LAAGAEDKLIRIWDITTKQI--VMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLR 529

Query: 106 SPSIPRNYKHNAPVNEVVIHPNQGELISCDR-DGNIRIWDLGENQCTHQLTPEDDT---- 160
           +            V  V   PN G+ I+    D + RIWD        +L  + D     
Sbjct: 530 TGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGH 589

Query: 161 --SLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSD 218
             S+ S+S   DG  L + +   +  +W +    + S+      F  H  ++  +  S +
Sbjct: 590 KDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQN 649

Query: 219 VKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA------FSADSAYLVTASSDH 272
            +++ + S D     W  +    L   L GH+  V   A         +     T S D 
Sbjct: 650 DEYVLSGSKDRGVLFWDTNSGNPL-LMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDF 708

Query: 273 YVRLW 277
             ++W
Sbjct: 709 TAKIW 713

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 15/114 (13%)

Query: 5   LVSAGYDHTIRFWEALTG------VCSRT-IQHSDSQVNRLEITNDKKLLATAGHQNVRL 57
           LVS   D +++ W   T        C  T I H D  ++     ND+ +L+ +  + V  
Sbjct: 605 LVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLF 664

Query: 58  YDIRTTNPNPVASFEGHRGNVTSVSFQQDNRW------MVTSSEDGTIKVWDVR 105
           +D  +   NP+   +GH+ +V SV+               T S D T K+W  R
Sbjct: 665 WDTNSG--NPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIWRYR 716

>KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} similar
           to uniprot|P39014 Saccharomyces cerevisiae YIL046W MET30
           F-box protein containing five copies of the WD40 motif
           controls cell cycle function sulfur metabolism and
           methionine biosynthesis as part of the ubiquitin ligase
           complex interacts with and regulates Met4p localizes
           within the nucleus
          Length = 623

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 136/301 (45%), Gaps = 23/301 (7%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  +G   R +      V  +   +D+K++  +  + +R+++  T 
Sbjct: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITG 382

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
           +   ++++ GH+ +V SV   +  + +V++S D T+KVW V S +      H   VN V 
Sbjct: 383 SC--ISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNC 183
           +HP      S   D  +R+WD+  N C            + + +    +     + K   
Sbjct: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK--- 495

Query: 184 YVWEMPN-HTDASHLKPVTK-FRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFK 241
            + ++PN   +       T  F  +  Y T         HL +CS D+T ++W +     
Sbjct: 496 -IEKVPNPELEEDFADDCTGIFDPNLKYPT---------HLLSCSLDNTIKLWEVSSGRC 545

Query: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
           + T   GH   VWD A  AD+  +V+ S D  +++WDL   + ++ + GH    VCV + 
Sbjct: 546 IRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIG 602

Query: 302 D 302
           D
Sbjct: 603 D 603

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 86/225 (38%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V S+ F  ++R + T S D T+ +WD +S ++ R    H   V    I+ 
Sbjct: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG--IYF 360

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           +  ++I+   D  IR+W+     C                                    
Sbjct: 361 DDQKMITASLDKTIRVWNYITGSC------------------------------------ 384

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R H   +  +   S  K + + SAD T +VW ++   +   TL
Sbjct: 385 -------------ISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVES--RTCYTL 427

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    ++S D  +R+WD+ T   ++ + GH
Sbjct: 428 RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE----ITNDKKLLATAGH-QNVRLYD 59
           L+S   D+TI+ WE  +G C RT      Q   +E    I  D   + +  H ++++++D
Sbjct: 526 LLSCSLDNTIKLWEVSSGRCIRT------QFGHVEGVWDIAADNFRIVSGSHDKSIKVWD 579

Query: 60  IRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVW 102
           ++  N   + +F GH+  +  V     +   V+  E G +K+W
Sbjct: 580 LQ--NGKCIQTFTGHKAPIVCVGIGDSS--FVSGDELGEVKMW 618

>Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON}
           (30012..32012) [2001 nt, 667 aa]
          Length = 666

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 123/288 (42%), Gaps = 18/288 (6%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +  +   V  L   +D+KL+  +  + +R+++  T 
Sbjct: 321 LLFTGSYDSTIAIWDLSTGKLLRRLTGNGDGVKTLHF-DDQKLITGSLDKTIRVWNYVTG 379

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               ++++ GH  +V S+   +  + +V+ S D T+KVW + S +      H   VN V 
Sbjct: 380 EC--ISTYRGHTDSVMSIDSYK--KIIVSGSADKTVKVWHIESRACYTLRGHTEWVNCVK 435

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-SDGSMLAAANTKGN 182
           +HP      SC  D  IR+WD+  N C            + + +   D   L       N
Sbjct: 436 LHPKSFSCFSCSDDTTIRMWDIRSNSCLKVFRGHVGQVQKVIPLTILDVENLVVDQVPDN 495

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKL 242
               E     D        K      Y T         HL +CS D+T ++W +     +
Sbjct: 496 LSSSETQESNDEEDTSENVKLDESLPYPT---------HLLSCSLDNTIKLWDVKTGNCI 546

Query: 243 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
            T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 547 RTQF-GHVEGVWDIA--ADNFRIISGSHDGTIKIWDLQSGKCMHTFAG 591

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 84/224 (37%), Gaps = 56/224 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V ++ F  + R + T S D TI +WD+ +  + R    N       +H +
Sbjct: 302 LQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIAIWDLSTGKLLRRLTGNGD-GVKTLHFD 358

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
             +LI+   D  IR+W+    +C                                     
Sbjct: 359 DQKLITGSLDKTIRVWNYVTGEC------------------------------------- 381

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
                       ++ +R H+  +  I   S  K + + SAD T +VW I+   +   TL 
Sbjct: 382 ------------ISTYRGHTDSVMSI--DSYKKIIVSGSADKTVKVWHIES--RACYTLR 425

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH  WV        S    + S D  +R+WD+ +   ++ + GH
Sbjct: 426 GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRSNSCLKVFRGH 469

>Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W
           (REAL)
          Length = 638

 Score = 92.0 bits (227), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 129/291 (44%), Gaps = 22/291 (7%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 312 LLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 370

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               ++++ GH  +V SV   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 371 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 426

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-SDGSMLAAANTKGN 182
           +HP      SC  D  IR+WD+  N C            + + +   D   LA  NT   
Sbjct: 427 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDAENLATDNTSSQ 486

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK---HLATCSADHTARVWSIDDD 239
                M N  +AS   P +   A        +L   +    HL +C  D+T ++W +   
Sbjct: 487 NEP-AMSNDANASE-TPSSDQEA--------VLDETIPYPTHLLSCGLDNTIKLWEVRTG 536

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
             + T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 537 KCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFQG 584

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 85/225 (37%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V ++ F  + R + T S D TI +WD+ +  + R    H   V    ++ 
Sbjct: 293 IQEFKGHMDGVLTLQF--NFRLLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVK--TLYF 348

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 349 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 372

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R HS  +  +   S  K + + SAD T +VW ++   +   TL
Sbjct: 373 -------------ISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES--RTCYTL 415

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 416 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 460

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 46/119 (38%), Gaps = 20/119 (16%)

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           KG+C + E   H D                   + L  + + L T S D T  +W +   
Sbjct: 288 KGHCRIQEFKGHMDGV-----------------LTLQFNFRLLFTGSYDSTIGIWDLFTG 330

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
            KL   L GH   V    F  D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 331 -KLIRRLSGHTDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 386

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
           L T S D  + +WDL T +++R+  GH  G   +  +D
Sbjct: 313 LFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVKTLYFDD 350

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 92.0 bits (227), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 131/279 (46%), Gaps = 38/279 (13%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDI---------------RTTNP 65
           VC  T  +++S++  LE ++D +L A AG Q+  ++++ +               RT N 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRL-AAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNE 476

Query: 66  NPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI 124
             V    GH G V S SF  DNR+++++SED T+++W   + +   NYK HN P+ +V  
Sbjct: 477 TLV----GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAF 532

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAANTK 180
            P      +   D   R+W      C H    ++       + ++S   +G+ +   ++ 
Sbjct: 533 SPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSD 587

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
             C +W++    D+  L     F  H+  +T   +S D + L+T S D    VW I    
Sbjct: 588 KTCRMWDI-TSGDSVRL-----FLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGK 641

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +L+      +  V+  ++S +   L++  +DH VR+WD+
Sbjct: 642 RLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 94/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+SA  D T+R W   T       +  +  +  +  +      ATA H Q  RL+     
Sbjct: 497 LLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSC--D 554

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
           +  P+  F GH  +V +VSF  +  ++ T S D T ++WD+ S    R +  H APV   
Sbjct: 555 HIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTST 614

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+      ++ SLS + +G +L +     +
Sbjct: 615 AVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHS 674

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYIT 211
             VW++   T     +P   F  +S  +T
Sbjct: 675 VRVWDVKKSTAEPGSEPEQPFTGYSGDVT 703

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 12/102 (11%)

Query: 203 FRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF---KLET---------TLDGHQ 250
           F   ++ +T +  S DV+  A    D   ++WS+D +    KL +         TL GH 
Sbjct: 423 FHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHS 482

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
             V+  +FS D+ YL++AS D  VRLW   T   +  Y GH+
Sbjct: 483 GTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHN 524

>KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.231
           YIL046W
          Length = 654

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 133/314 (42%), Gaps = 38/314 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
            L +  YD T+  W+  TG   R +      V  L   + +KL+  +  + +R+++  T 
Sbjct: 290 FLFTGSYDGTVAIWDLFTGKLIRRLNGHQDGVKTL-FFDGQKLITGSLDKTIRVWNYMTG 348

Query: 64  NPNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
               ++++ GH  +V SV SF+   + +V+ S D T+KVW V S +      H+  VN V
Sbjct: 349 EC--ISTYRGHTNSVMSVDSFK---KIIVSGSADKTVKVWHVESRTCYTLRGHSEWVNCV 403

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMASDGS 172
            +HP      SC  D  IR+WD+  N C            ++ P     +++L M S+ +
Sbjct: 404 KLHPKSFCCFSCSDDTTIRMWDIRTNTCLKVFTGHVGQVQKVIPLTILDIENLVMDSNSA 463

Query: 173 MLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTAR 232
                         E P     S L     +                 HL +CS D+T +
Sbjct: 464 DDETVTGVDESVNEETPPLVVGSQLDGTIPYPT---------------HLLSCSLDNTIK 508

Query: 233 VWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG-- 290
           +W +     + T   GH   VWD A  AD+  +V+ S D  +++WDL +   +  + G  
Sbjct: 509 LWEVKSGKCIRTQF-GHVEGVWDIA--ADNFRIVSGSHDGSIKIWDLQSGRCMHTFHGKN 565

Query: 291 -HHKGAVCVALNDV 303
              +G V  +  DV
Sbjct: 566 LQKEGMVASSSGDV 579

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 86/224 (38%), Gaps = 56/224 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           V  F+GH   + S+ F  + R++ T S DGT+ +WD+ +  + R    +    + +    
Sbjct: 271 VKEFKGHMDGILSMKF--NFRFLFTGSYDGTVAIWDLFTGKLIRRLNGHQDGVKTLFFDG 328

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
           Q +LI+   D  IR+W+    +C                                     
Sbjct: 329 Q-KLITGSLDKTIRVWNYMTGEC------------------------------------- 350

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
                       ++ +R H+  +  +   S  K + + SAD T +VW ++   +   TL 
Sbjct: 351 ------------ISTYRGHTNSVMSV--DSFKKIIVSGSADKTVKVWHVES--RTCYTLR 394

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 395 GHSEWVNCVKLHPKSFCCFSCSDDTTIRMWDIRTNTCLKVFTGH 438

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 132/279 (47%), Gaps = 38/279 (13%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLY---------------DIRTTNP 65
           VC  T  +++S++  LE ++D +L A+AG Q+  V+++               D R+ N 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRL-ASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNN- 475

Query: 66  NPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI 124
              A+  GH G V S +F  DNR+++++SED T+++W   + +   +YK HN P+ +V  
Sbjct: 476 ---ATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAF 532

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAANTK 180
            P      +   D   R+W      C H    ++       + ++S   +G+ +   ++ 
Sbjct: 533 SPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSD 587

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
             C +W+M      S    V  F  H+  +T   +S D + L+T S D    VW I    
Sbjct: 588 KTCRMWDM------STGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGK 641

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +L+      +  V+  ++S +   LV+  +DH +R+WD+
Sbjct: 642 RLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 94/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+SA  D T+R W   T     + +  +  +  +  +      ATA H Q  RL+     
Sbjct: 497 LLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHI 556

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V +VSF  +  ++ T S D T ++WD+ +    R +  H APV   
Sbjct: 557 YP--LRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTAT 614

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+      ++ SLS + +G +L +     +
Sbjct: 615 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHS 674

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYIT 211
             VW++   T     +P   F + S  +T
Sbjct: 675 LRVWDVKKSTAEPGSEPEQPFTSFSGDVT 703

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 76/178 (42%), Gaps = 19/178 (10%)

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDT------------SLQSLSMASDGSMLAAANTKGNC 183
           +D  ++IW L     + +L  + D             ++ S + + D   L +A+     
Sbjct: 447 QDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYSTAFSPDNRYLLSASEDKTV 506

Query: 184 YVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLE 243
            +W    +T       +  ++ H+  I  +  S    + AT S D TAR+WS D  + L 
Sbjct: 507 RLWSTDTYTS------LVSYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLR 560

Query: 244 TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
               GH   V   +F  +  Y+ T SSD   R+WD+ST + VR + GH       A++
Sbjct: 561 I-FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVS 617

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 62/152 (40%), Gaps = 16/152 (10%)

Query: 159 DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA-------HSTYIT 211
           ++ + SL  + D  + +A        +W +     +S L      R+       HS  + 
Sbjct: 427 NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVY 486

Query: 212 RILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSD 271
               S D ++L + S D T R+WS D    L  +  GH   +WD AFS    Y  TAS D
Sbjct: 487 STAFSPDNRYLLSASEDKTVRLWSTDTYTSL-VSYKGHNHPIWDVAFSPLGHYFATASHD 545

Query: 272 HYVRLWDLSTREIVRQYGGHHKGAVCVALNDV 303
              RLW       +R + GH        LNDV
Sbjct: 546 QTARLWSCDHIYPLRIFAGH--------LNDV 569

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 12/102 (11%)

Query: 203 FRAHSTYITRILLSSDVKHLATCSADHTARVWSID------------DDFKLETTLDGHQ 250
           F   ++ +T +  S DV+  +    D   ++WS+D            D+     TL GH 
Sbjct: 423 FHNTNSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHS 482

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
             V+  AFS D+ YL++AS D  VRLW   T   +  Y GH+
Sbjct: 483 GTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHN 524

>Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W
           (REAL)
          Length = 630

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 128/291 (43%), Gaps = 18/291 (6%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 304 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDRTIRVWNYITG 362

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               ++++ GH  +V SV   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 363 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 418

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-SDGSMLAAANTKGN 182
           +HP      SC  D  IR+WD+  N C            + + +   D   LA  NT   
Sbjct: 419 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFKGHVGQVQKVVPLTIKDTENLATDNTSDG 478

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK---HLATCSADHTARVWSIDDD 239
             + +     D++    V +    S     I L   +    HL +C  D+T ++W +   
Sbjct: 479 STLQD-----DSAMADGVNESETPSDE-QEIALDETIPYPTHLLSCGLDNTIKLWDVKTG 532

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
             + T   GH   VWD A  AD+  +++ S D  +++WDL +   +  + G
Sbjct: 533 KCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGRCMHTFNG 580

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 87/225 (38%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V ++ F  + R + T S D TI +WD+ +  + R    H+  V    ++ 
Sbjct: 285 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 340

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 341 DDRKLITGSLDRTIRVWNYITGEC------------------------------------ 364

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R HS  +  + + S  K + + SAD T +VW ++   +   TL
Sbjct: 365 -------------ISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES--RTCYTL 407

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 408 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFKGH 452

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 46/119 (38%), Gaps = 20/119 (16%)

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           KG+C + E   H D                   + L  + + L T S D T  +W +   
Sbjct: 280 KGHCRIQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTIGIWDLFTG 322

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
            KL   L GH   V    F  D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 323 -KLIRRLSGHSDGVKTLYF--DDRKLITGSLDRTIRVWNYITGECISTYRGHSDSVLSV 378

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
           L T S D  + +WDL T +++R+  GH  G   +  +D
Sbjct: 305 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD 342

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 132/285 (46%), Gaps = 36/285 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRTT---NPNPVASFE- 72
           AL  VC  T Q+++  ++ L+ ++D ++ A AG Q+  ++++ +  +   NPN V + E 
Sbjct: 453 ALPSVCMYTFQNTNKDMSCLDFSDDCRV-AAAGFQDSYIKIWSLDGSSLNNPNIVLNNET 511

Query: 73  -------------GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAP 118
                        GH G V S SF  DN+++++ SED T+++W + + +   +YK HN P
Sbjct: 512 NYKDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHP 571

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSML 174
           V +V   P      +   D   R+W      C H    ++       +  +S   +G  L
Sbjct: 572 VWDVNFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYL 626

Query: 175 AAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW 234
              ++   C +W      + S    V  F  H+  +  I +S D + L+T S D    VW
Sbjct: 627 FTGSSDKTCRMW------NVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVW 680

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
            I    +L+      +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 681 DIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 90/201 (44%), Gaps = 4/201 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  +  +      ATA H Q  RL+     
Sbjct: 542 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 601

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++W+V +    R +  H APV  +
Sbjct: 602 YP--LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISI 659

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+      ++ SLS + +G++L +     +
Sbjct: 660 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 719

Query: 183 CYVWEMPNHTDASHLKPVTKF 203
             VW++   T     +P   F
Sbjct: 720 VRVWDLKKATTEPSAEPDEPF 740

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 7/140 (5%)

Query: 161 SLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK 220
           ++ S S + D   L + +      +W M  HT       +  ++ H+  +  +  S    
Sbjct: 529 TVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHT------ALVSYKGHNHPVWDVNFSPLGH 582

Query: 221 HLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
           + AT S D TAR+WS D  + L     GH   V   +F  +  YL T SSD   R+W++S
Sbjct: 583 YFATASHDQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVS 641

Query: 281 TREIVRQYGGHHKGAVCVAL 300
           T + VR + GH    + +A+
Sbjct: 642 TGDSVRLFLGHTAPVISIAV 661

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 43/96 (44%), Gaps = 1/96 (1%)

Query: 205 AHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAY 264
            HS  +     S D K+L + S D T R+WS+D    L  +  GH   VWD  FS    Y
Sbjct: 525 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTAL-VSYKGHNHPVWDVNFSPLGHY 583

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
             TAS D   RLW       +R + GH     CV+ 
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSF 619

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 41/96 (42%), Gaps = 18/96 (18%)

Query: 215 LSSDVKHLATCSADHTARVWSID------------------DDFKLETTLDGHQRWVWDC 256
            S D +  A    D   ++WS+D                  DD     TL GH   V+  
Sbjct: 474 FSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCKTLVGHSGTVYST 533

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +FS D+ YL++ S D  VRLW + T   +  Y GH+
Sbjct: 534 SFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 569

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 135/312 (43%), Gaps = 40/312 (12%)

Query: 26  RTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHR-------GN- 77
           +T++H+ S V  ++ +ND + LAT  ++  ++Y  R ++   VA F           GN 
Sbjct: 486 KTLEHT-SVVCCVKFSNDGEFLATGCNKTTQIY--RVSDGELVARFSDENAHTDKADGND 542

Query: 78  ---------------VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
                          + SV F  D +++ T +ED  I++WD+    I    K H   +  
Sbjct: 543 NAEAETSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYS 602

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKG 181
           +   P+  +L+S   D  +RIWDL   QCT  L+ ED  +  ++S   DG  +AA +   
Sbjct: 603 LDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVS-PGDGKFIAAGSLDR 661

Query: 182 NCYVWEMPNHTDASHLKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSI---- 236
              VW+         L    +    H   +  ++ + D   + + S D + ++W++    
Sbjct: 662 AVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVN 721

Query: 237 --DDDFK-----LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYG 289
             + D K      E T  GH+ +V   A + D  Y+++ S D  V  WD  +   +    
Sbjct: 722 HNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQ 781

Query: 290 GHHKGAVCVALN 301
           GH    + VA+N
Sbjct: 782 GHRNSVISVAVN 793

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (47%), Gaps = 16/120 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG C+ T+   D          D K +A     + VR++D    
Sbjct: 612 LVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTG 671

Query: 61  ----RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
               R  + N + +  GH+ +V SV F +D   +V+ S D ++K+W++      RN  HN
Sbjct: 672 FLVERLDSENELGT--GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL------RNVNHN 723

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 131/303 (43%), Gaps = 32/303 (10%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRL-------------YDIRTTNP 65
           AL  VC  T  +++  +  LE ++D +L A AG Q+ ++             YD      
Sbjct: 483 ALPSVCMYTFHNTNRDMTSLEFSDDCRL-AAAGFQDSQIKLFSLDGSPLGNRYDPDLPED 541

Query: 66  NPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI 124
               +  GH G V S SF  DNR++V+SSED T+++W + + S   +YK HN PV +V  
Sbjct: 542 ATSKTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKF 601

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAANTK 180
            P      +   D   R+W      C H    ++       +  +S   +G  L   ++ 
Sbjct: 602 SPLGHYFATASHDHTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSD 656

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
             C +W++    D   L     F   +  +    +S D + L+T S D    VW I    
Sbjct: 657 KTCRMWDIAT-GDCVRL-----FLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGK 710

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           +L+      +  ++  A+  +   L++  +DH VR+WDL  ++   + G   + A    L
Sbjct: 711 RLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDL--KKATTESGPEPEQAFVGYL 768

Query: 301 NDV 303
            DV
Sbjct: 769 GDV 771

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 88/201 (43%), Gaps = 4/201 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           LVS+  D T+R W   T     + +  +  V  ++ +      ATA H    RL+     
Sbjct: 566 LVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTARLWSCDHI 625

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++WD+ +    R +    APV   
Sbjct: 626 YP--LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVIST 683

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+      ++ SL+   +G+ L +     +
Sbjct: 684 CVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHS 743

Query: 183 CYVWEMPNHTDASHLKPVTKF 203
             VW++   T  S  +P   F
Sbjct: 744 VRVWDLKKATTESGPEPEQAF 764

>Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W
           (REAL)
          Length = 639

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 129/297 (43%), Gaps = 31/297 (10%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               ++++ GH  +V SV   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMASDGSM 173
           +HP      SC  D  IR+WD+  N C            ++ P   T   + ++A+D + 
Sbjct: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL--TIKDAENLATDNTS 486

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
               + +    + + P        +          Y T         HL +C  D+T ++
Sbjct: 487 DGGGSLQDGSAMIDEPEAVAGD--QEAAALDESIPYPT---------HLLSCGLDNTIKL 535

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
           W +     + T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 536 WDVKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFQG 589

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 85/225 (37%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V ++ F  + R + T S D TI +WD+ +  + R    H   V    ++ 
Sbjct: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVK--TLYF 350

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 351 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 374

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R HS  +  +   S  K + + SAD T +VW ++   +   TL
Sbjct: 375 -------------ISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES--RTCYTL 417

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 46/119 (38%), Gaps = 20/119 (16%)

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           KG+C + E   H D                   + L  + + L T S D T  +W +   
Sbjct: 290 KGHCRIQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTIGIWDLFTG 332

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
            KL   L GH   V    F  D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 333 -KLIRRLSGHTDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
           L T S D  + +WDL T +++R+  GH  G   +  +D
Sbjct: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVKTLYFDD 352

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 126/284 (44%), Gaps = 35/284 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDI---------------- 60
           AL  VC  T  +++  +  LE ++D +L A AG Q+  ++++ +                
Sbjct: 460 ALPSVCMYTFHNTNRDMTSLEFSDDCRL-AAAGFQDSYIKIWSLDGSSLINPKYSSSQFD 518

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R +  N  ++  GH G V S SF  DN ++V+ SED T+K+W + + +   NYK HN PV
Sbjct: 519 RFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPV 578

Query: 120 NEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLA 175
            +V   P      S   D   R+W      C H    ++       + ++S   +G  + 
Sbjct: 579 WDVKFSPLGHYFASASHDQTARLW-----ACDHIYPLRIFAGHTNDVDTVSFHPNGCYVF 633

Query: 176 AANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWS 235
             ++   C +W      D S    V  F  H+  +    +S D + LAT S D    +W 
Sbjct: 634 TGSSDKTCRMW------DVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWD 687

Query: 236 IDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           I    +++      +  V   +F+ +   L++  +DH VR+WD+
Sbjct: 688 IGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 96/211 (45%), Gaps = 4/211 (1%)

Query: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIR 61
           + LVS   D T++ W   T       +  +  V  ++ +      A+A H Q  RL+   
Sbjct: 546 MYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW--A 603

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVN 120
             +  P+  F GH  +V +VSF  +  ++ T S D T ++WDV +    R +  H APV 
Sbjct: 604 CDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVL 663

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
              + P+   L +   DG I +WD+G  +   Q+      ++ SLS   +G++L +    
Sbjct: 664 STQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGAD 723

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYIT 211
            +  VW++ + T     +P   F AH   IT
Sbjct: 724 HSVRVWDVKHGTTEQGPEPEQPFNAHVGDIT 754

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 17/100 (17%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSID--------------DDFKLE---TTLDGHQRW 252
           +T +  S D +  A    D   ++WS+D              D F  +   +TL GH   
Sbjct: 476 MTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGT 535

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           V+  +FS D+ YLV+ S D  V+LW + T   +  Y GH+
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHN 575

>TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.231
           YIL046W
          Length = 584

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 125/290 (43%), Gaps = 24/290 (8%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           S +L +  YD T+  W+  +G   R +      V  L   +++KL+  +  + +R+++  
Sbjct: 270 SRLLFTGSYDSTVAIWDLCSGRLIRRLSRHGDGVKALHF-DEQKLVTGSLDKTIRVWNYI 328

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNE 121
           T     ++++ GH  +V SV   +  + +V+ S D T+KVW V S +      H   VN 
Sbjct: 329 TGEC--ISTYRGHTDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYSLRGHTEWVNC 384

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-SDGSMLAAANTK 180
           V +HP      SC  D  IR+WD+  N C            + + +   D   L   + +
Sbjct: 385 VKLHPKSFLCFSCSDDTTIRMWDIRTNACLRVFRGHVGQVQKVIPLTIVDIDNLVVDDRQ 444

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
            N    E     D   LK    +                 HL +CS D+T ++W I    
Sbjct: 445 INRSTQEEDTEEDQDVLKEDLPYPT---------------HLLSCSLDNTIKMWDIRTGK 489

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
            + T   GH   VWD A  AD+  +V+ S D  V+LWDL + + +  + G
Sbjct: 490 CVRTQF-GHVEGVWDIA--ADNFRIVSGSHDGKVKLWDLQSGKCIHTFQG 536

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 102/264 (38%), Gaps = 51/264 (19%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEVVIHP 126
           +  F+GH   V ++ F   +R + T S D T+ +WD+ S  + R   +H   V    +H 
Sbjct: 253 IQEFKGHMDGVLTLQFS--SRLLFTGSYDSTVAIWDLCSGRLIRRLSRHGDGVK--ALHF 308

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           ++ +L++   D  IR+W+    +C        D+    LS+ S   ++ + +      VW
Sbjct: 309 DEQKLVTGSLDKTIRVWNYITGECISTYRGHTDS---VLSVDSYKKIIVSGSADKTVKVW 365

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
            + + T  S        R H+ ++  + L        +CS D T R+W I  +  L    
Sbjct: 366 HVESRTCYS-------LRGHTEWVNCVKLHPKSFLCFSCSDDTTIRMWDIRTNACLR-VF 417

Query: 247 DGHQRWVWDC--------------------------------AFSADSAY---LVTASSD 271
            GH   V                                       D  Y   L++ S D
Sbjct: 418 RGHVGQVQKVIPLTIVDIDNLVVDDRQINRSTQEEDTEEDQDVLKEDLPYPTHLLSCSLD 477

Query: 272 HYVRLWDLSTREIVRQYGGHHKGA 295
           + +++WD+ T + VR   GH +G 
Sbjct: 478 NTIKMWDIRTGKCVRTQFGHVEGV 501

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 113/257 (43%), Gaps = 33/257 (12%)

Query: 59  DIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK---- 114
           D R   P  V  +EGH   + ++   +D +W+ T S+D T+ +W  R  S    +K    
Sbjct: 387 DSRDCFPLEVELYEGHTDLLNALDSSEDGKWLATCSKDHTVILW--RYSSELEKFKAYAK 444

Query: 115 ---HNAPVNEVVIHPNQGE------LISCDRDGNIRIWDLG----ENQCTHQLTPED--- 158
              H  PV  V + PN         +I+   D  I+ W +     E    H +   D   
Sbjct: 445 FTGHAGPVTAVGL-PNVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTR 503

Query: 159 ---DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215
              D  + +LS++ + S  A A+    C VW++    D+  L+       H   +  +  
Sbjct: 504 RAHDKDINALSISPNDSTFATASYDKTCKVWDV----DSGELQGT--LANHKRGLWDVSF 557

Query: 216 SSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275
               K LATCS D T +VWS+D    +  TL+GH   V  C+F   +  LV+  +D  ++
Sbjct: 558 CQYDKLLATCSGDKTVKVWSLDT-LSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIK 616

Query: 276 LWDLSTREIVRQYGGHH 292
           LWDLST E VR    H 
Sbjct: 617 LWDLSTGECVRTLDAHE 633

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 109/284 (38%), Gaps = 32/284 (11%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSFQQDNR--- 88
           +N L+ + D K LAT    +  +   Y          A F GH G VT+V      R   
Sbjct: 406 LNALDSSEDGKWLATCSKDHTVILWRYSSELEKFKAYAKFTGHAGPVTAVGLPNVMRSAW 465

Query: 89  --WMVTSSEDGTIKVWDVRSP----SIPRNYK--------HNAPVNEVVIHPNQGELISC 134
             +++T+S D TIK W V  P    + P   K        H+  +N + I PN     + 
Sbjct: 466 PEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFATA 525

Query: 135 DRDGNIRIWDL--GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT 192
             D   ++WD+  GE Q T          L  +S      +LA  +      VW +    
Sbjct: 526 SYDKTCKVWDVDSGELQGT---LANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDT-- 580

Query: 193 DASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRW 252
               L  V     H+  + R    +  K L +  AD   ++W +    +   TLD H+  
Sbjct: 581 ----LSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTG-ECVRTLDAHENR 635

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 296
           +W  +   D    VTA +D   + W   + E  ++   +HK  V
Sbjct: 636 IWALSVLHDGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKV 679

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 77/168 (45%), Gaps = 10/168 (5%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRTT 63
             +A YD T + W+  +G    T+ +    +  +      KLLAT +G + V+++ + T 
Sbjct: 522 FATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTL 581

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
             + V + EGH   V   SF   N+ +V++  DG IK+WD+ +    R    H   +  +
Sbjct: 582 --SVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWAL 639

Query: 123 VIHPNQGELISCDRDGNIRIW------DLGENQCTHQLTPEDDTSLQS 164
            +  +  E ++ D DG  + W         EN   H+   E D SLQ+
Sbjct: 640 SVLHDGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKVEQDQSLQN 687

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/263 (20%), Positives = 105/263 (39%), Gaps = 24/263 (9%)

Query: 40  ITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTI 99
           ++ D +LLAT+    V + ++  T              +T++    D  ++   S+   +
Sbjct: 25  VSEDGRLLATSVIDEVNIIELAPTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLL 84

Query: 100 KVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD 159
           +++ +RS  + R+ K ++PV  +   P+   +     DG++ + D+     TH L     
Sbjct: 85  RIYHLRSKRVVRSMKVSSPVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGA 144

Query: 160 TSLQSLSMASDGS----MLAAANTKGNCYVWEMPN----HTDASHLKPV--TKFRAHSTY 209
           T + S+    + +     L + +T G   VW++      HT   H   V    FR     
Sbjct: 145 T-ISSVKFFGELNSTTWRLGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDA- 202

Query: 210 ITRILLSSDVKHLATCSADHTARVWSID--DDFKLETTLDGHQRWVWDCAFSADSAY--- 264
                   DV  L +   D    ++ +      KL  T+  HQ+ +  C F  D  +   
Sbjct: 203 ------DDDVLELLSGGRDDIVNLYQLGSTKKVKLVKTIPVHQQ-IEACGFIHDGEHQDL 255

Query: 265 LVTASSDHYVRLWDLSTREIVRQ 287
             TA  D   ++  L+T  ++++
Sbjct: 256 FYTAGGDAVYQILSLATASVIKK 278

>KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 658

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 135/309 (43%), Gaps = 38/309 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 360 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKTLYF-DDQKLITGSLDRTIRVWNYVTG 418

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               V+++ GH  +V SV   +  + +V+ S D T+K+W V S +      H+  V  V 
Sbjct: 419 AC--VSTYRGHSDSVLSVDSYK--KIIVSGSADKTVKMWHVESRTCYTLRGHSEWVGCVK 474

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMASDGSM 173
           +HP      S   D  IR+WD+  N C            ++ P +   L + ++ +D + 
Sbjct: 475 LHPKSFTCFSGSDDTTIRMWDIRSNTCLKVFRGHVGQVQKVLPLN--ILDTENLVTDPAS 532

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
            A  N +         N      L P+     + +            HL +CS D+T ++
Sbjct: 533 EAQRNDE------PAANDPSEGQLAPLDDSLPYPS------------HLLSCSLDNTIKL 574

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           W +     + T   GH   +WD A  AD+  +++ + D  V++WDL + + +  +  HH 
Sbjct: 575 WDVRTGKCVRTHF-GHLEGIWDIA--ADNFRIISGAHDKTVKVWDLQSGKCIHTFDSHHA 631

Query: 294 GAVCVALND 302
              CV + D
Sbjct: 632 PITCVGIGD 640

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 85/224 (37%), Gaps = 56/224 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V ++ F  + R + T S D T+ +WD+ +  + R    +    + +   +
Sbjct: 341 IQDFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKTLYFDD 398

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
           Q +LI+   D  IR+W+     C                                     
Sbjct: 399 Q-KLITGSLDRTIRVWNYVTGAC------------------------------------- 420

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
                       V+ +R HS  +  + + S  K + + SAD T ++W ++   +   TL 
Sbjct: 421 ------------VSTYRGHSDSV--LSVDSYKKIIVSGSADKTVKMWHVES--RTCYTLR 464

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH  WV        S    + S D  +R+WD+ +   ++ + GH
Sbjct: 465 GHSEWVGCVKLHPKSFTCFSGSDDTTIRMWDIRSNTCLKVFRGH 508

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 51/98 (52%), Gaps = 7/98 (7%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
           LL+ +    ++L+D+RT     V +  GH   +  ++   DN  +++ + D T+KVWD++
Sbjct: 563 LLSCSLDNTIKLWDVRTGKC--VRTHFGHLEGIWDIA--ADNFRIISGAHDKTVKVWDLQ 618

Query: 106 SPSIPRNY-KHNAPVNEVVIHPNQGELISCDRDGNIRI 142
           S      +  H+AP+  V I     E +S D  G +++
Sbjct: 619 SGKCIHTFDSHHAPITCVGI--GDSEFVSGDELGCVKL 654

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 7/98 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-KLLATAGHQNVRLYDIRTT 63
           L+S   D+TI+ W+  TG C RT  H        +I  D  ++++ A  + V+++D+++ 
Sbjct: 563 LLSCSLDNTIKLWDVRTGKCVRT--HFGHLEGIWDIAADNFRIISGAHDKTVKVWDLQSG 620

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKV 101
               + +F+ H   +T V         V+  E G +K+
Sbjct: 621 --KCIHTFDSHHAPITCVGIGDSE--FVSGDELGCVKL 654

>ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]
           {ON} similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 608

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 129/296 (43%), Gaps = 42/296 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T  
Sbjct: 298 LFTGSYDSTIAIWDLCTGRLVRRLSSHTDGVKALYF-DDQKLITGSLDKTIRVWNYLTGE 356

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              ++++ GH  +V SV   +  + +V+ S D T+KVW V S +      H   VN V +
Sbjct: 357 C--ISTYRGHTDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYSLRGHTEWVNCVKL 412

Query: 125 HPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMASDGSML 174
           HP      SC  D  IR+WD+  N C            ++ P   T + S ++  D    
Sbjct: 413 HPKSFLCFSCSDDTTIRMWDIRTNVCLKVFRGHLGQVQKVVPL--TIIDSENLVVDDKAE 470

Query: 175 AAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW 234
                +G+          D +    +T+   + T            HL +CS D+T ++W
Sbjct: 471 DDGEEQGD----------DENAQDVLTENLPYPT------------HLLSCSLDNTIKLW 508

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
            I     + T   GH   VWD A  AD+  +V+ S D  V++WDL + + +  + G
Sbjct: 509 DIKKGRCIRTQF-GHVEGVWDLA--ADNFRIVSGSHDGKVKVWDLQSGKCIHTFQG 561

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 104/262 (39%), Gaps = 47/262 (17%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V ++ F  + R++ T S D TI +WD+ +  + R    +    + +   +
Sbjct: 278 IKEFKGHMDGVLALQF--NTRYLFTGSYDSTIAIWDLCTGRLVRRLSSHTDGVKALYFDD 335

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
           Q +LI+   D  IR+W+    +C        D+    LS+ S   ++ + +      VW 
Sbjct: 336 Q-KLITGSLDKTIRVWNYLTGECISTYRGHTDS---VLSVDSYKKIIVSGSADKTVKVWH 391

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLE---- 243
           + + T  S        R H+ ++  + L        +CS D T R+W I  +  L+    
Sbjct: 392 VESRTCYS-------LRGHTEWVNCVKLHPKSFLCFSCSDDTTIRMWDIRTNVCLKVFRG 444

Query: 244 -----------TTLDGHQRWVWDCA----------------FSADSAY---LVTASSDHY 273
                      T +D     V D A                 + +  Y   L++ S D+ 
Sbjct: 445 HLGQVQKVVPLTIIDSENLVVDDKAEDDGEEQGDDENAQDVLTENLPYPTHLLSCSLDNT 504

Query: 274 VRLWDLSTREIVRQYGGHHKGA 295
           ++LWD+     +R   GH +G 
Sbjct: 505 IKLWDIKKGRCIRTQFGHVEGV 526

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 82/210 (39%), Gaps = 48/210 (22%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVRLYDIRT 62
           I+VS   D T++ W   +  C     H++  VN +++     L  + +    +R++DIRT
Sbjct: 377 IIVSGSADKTVKVWHVESRTCYSLRGHTE-WVNCVKLHPKSFLCFSCSDDTTIRMWDIRT 435

Query: 63  TNPNPVASFEGHRGNVTSV---------------------SFQQDNR------------- 88
                V  F GH G V  V                       Q D+              
Sbjct: 436 NVCLKV--FRGHLGQVQKVVPLTIIDSENLVVDDKAEDDGEEQGDDENAQDVLTENLPYP 493

Query: 89  -WMVTSSEDGTIKVWDVRSPSIPR-NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++ S D TIK+WD++     R  + H   V ++    +   ++S   DG +++WDL 
Sbjct: 494 THLLSCSLDNTIKLWDIKKGRCIRTQFGHVEGVWDLA--ADNFRIVSGSHDGKVKVWDLQ 551

Query: 147 ENQCTHQLTPEDDTSLQSLSMASDGSMLAA 176
             +C H          +SL   SDG+  A 
Sbjct: 552 SGKCIHTFQG------KSLEQRSDGTEPAV 575

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 43/112 (38%), Gaps = 20/112 (17%)

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           KG C + E   H D                   + L  + ++L T S D T  +W +   
Sbjct: 273 KGTCLIKEFKGHMDGV-----------------LALQFNTRYLFTGSYDSTIAIWDLCTG 315

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            +L   L  H   V   A   D   L+T S D  +R+W+  T E +  Y GH
Sbjct: 316 -RLVRRLSSHTDGVK--ALYFDDQKLITGSLDKTIRVWNYLTGECISTYRGH 364

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 12/75 (16%)

Query: 238 DDFKLETT----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQ 287
           D FK+E+             GH   V   A   ++ YL T S D  + +WDL T  +VR+
Sbjct: 263 DRFKVESNWRKGTCLIKEFKGHMDGVL--ALQFNTRYLFTGSYDSTIAIWDLCTGRLVRR 320

Query: 288 YGGHHKGAVCVALND 302
              H  G   +  +D
Sbjct: 321 LSSHTDGVKALYFDD 335

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 102/231 (44%), Gaps = 9/231 (3%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+ S  I    + H   +  +   P   +L+S   
Sbjct: 372 IRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 431

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 432 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRTVRVWDSETGFLVER 490

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKHLATCSADHTARVWSI------DDDFKLETTLDGH 249
           L    +    H   +  ++ + D + + + S D + ++W +            E T  GH
Sbjct: 491 LDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH 550

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           + +V   A + D  Y+++ S D  V  WD ++   +    GH    + VA+
Sbjct: 551 KDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAV 601

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 10/109 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 426 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
                  + N +++  GH+ +V SV F +D R +V+ S D ++K+WD+R
Sbjct: 486 FLVERLDSENELST--GHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLR 532

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  YL T + D  +R+WDLS+++I+    GH +
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQ 412

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 114/250 (45%), Gaps = 32/250 (12%)

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY------KHNAP 118
           P  V  +EGH   + S++  +D +W+ T+S+D T  +W   + S  R Y       H A 
Sbjct: 380 PIEVNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTS-KRFYIYATFVGHAAS 438

Query: 119 VNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTP-----------EDDTS 161
           V+ V + PN  E      +I+   D  ++ W++   +      P             +  
Sbjct: 439 VSAVCL-PNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKD 497

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKH 221
           + ++SMA + S+ A A+    C +W +         +PV     H   +  +      K 
Sbjct: 498 INAISMAPNDSIFATASYDKTCKLWNVDTG------EPVATLANHKRGLWDVSFCESEKW 551

Query: 222 LATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST 281
           +ATCS D T ++WS++  F +  TL+GH   V  C+F      LV+A +D  +++WD+++
Sbjct: 552 IATCSGDKTVKIWSLES-FTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIAS 610

Query: 282 REIVRQYGGH 291
            + ++   GH
Sbjct: 611 GDCIKNLDGH 620

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 70/185 (37%), Gaps = 45/185 (24%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           I  +A YD T + W   TG                                         
Sbjct: 509 IFATASYDKTCKLWNVDTG----------------------------------------- 527

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEV 122
              PVA+   H+  +  VSF +  +W+ T S D T+K+W + S ++ +  + H   V   
Sbjct: 528 --EPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRC 585

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
                Q +L+S   DG I++WD+    C   L    +  + +LS+  DG ++ +A+    
Sbjct: 586 SFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSN-RIWALSVLEDGDLIISADADSV 644

Query: 183 CYVWE 187
              W+
Sbjct: 645 FQFWK 649

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 110/277 (39%), Gaps = 31/277 (11%)

Query: 30  HSDSQVNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF--- 83
           HSD  +N L  T D + LATA      +   ++  +      A+F GH  +V++V     
Sbjct: 389 HSD-LLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNV 447

Query: 84  --QQDNRWMVTSSEDGTIKVWDVR-------------SPSIPRNYKHNAPVNEVVIHPNQ 128
             +   ++++T+S D T+K W++                SI   + H   +N + + PN 
Sbjct: 448 MEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPND 507

Query: 129 GELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEM 188
               +   D   ++W++   +    L       L  +S       +A  +      +W +
Sbjct: 508 SIFATASYDKTCKLWNVDTGEPVATLA-NHKRGLWDVSFCESEKWIATCSGDKTVKIWSL 566

Query: 189 PNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248
            + T    L+       H+  + R    +  K L +  AD   +VW I     ++  LDG
Sbjct: 567 ESFTVLKTLE------GHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKN-LDG 619

Query: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLW-DLSTREI 284
           H   +W  +   D   +++A +D   + W D +  EI
Sbjct: 620 HSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEI 656

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 92/222 (41%), Gaps = 21/222 (9%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRD 137
           +T +S   D ++++  S+   +K+ +V +  I R+ K ++P   +   P    +     D
Sbjct: 65  ITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSSPSYVMTCDPTSTLVAIGGTD 124

Query: 138 GNIRIWDLGENQCTHQLTPEDDTSLQSLS----MASDGSMLAAANTKGNCYVWEMPNHTD 193
           G+I + D+      H       T + SL     + ++  +L + +T G   VW++     
Sbjct: 125 GSITVIDIENGYIAHSFKGHGGT-ISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTR-- 181

Query: 194 ASHLKPVTKFRAHSTYITRILLS----SDVKHLATCSADHTARVWSID---DDFKLETTL 246
               K     + HS+ I  I  +     DV +L T   D+   +W  +      KL  T+
Sbjct: 182 ----KCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLVKTI 237

Query: 247 DGHQRWVWDCAFSA--DSAYLVTASSDHYVRLWDLSTREIVR 286
             H + +  C F    D  +  TA  D   ++ DL+   +V+
Sbjct: 238 PAHLQ-IEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVK 278

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/311 (20%), Positives = 118/311 (37%), Gaps = 38/311 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT--NDKKL--LATAGHQNVR--- 56
           +L S   +   + W+ +T  C  T+Q   S +  ++ T  +DK +  L T G  NV    
Sbjct: 163 LLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLW 222

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSF--QQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK 114
            ++I+  +   V +   H   + +  F    D  +  T+  D   ++ D+   S+ +  K
Sbjct: 223 RFNIKGKSSKLVKTIPAHL-QIEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTK 281

Query: 115 HNAPVNEV----VIHPNQG-ELISCDRDGNIRIWDLGEN---------QCTHQLTPEDDT 160
              P+ E+    VI  NQG +  +   D  I++               Q    +     T
Sbjct: 282 K--PIEELFITGVIPINQGNQFYAVLSDQTIQLLQPNSEIFSSKSEFIQIQEYIAGNHGT 339

Query: 161 SLQSLSMASDGSMLAAANTKGNCYVWEMP----NHTDASHLKPVTKFRAHSTYITRILLS 216
                 +  +   +A A    +  +  +P    +  D      V  +  HS  +  +  +
Sbjct: 340 VADLCLVTKNKDCIALATNSPSLRIIPLPKIDADTQDTDLPIEVNLYEGHSDLLNSLACT 399

Query: 217 SDVKHLATCSADHTARVW---SIDDDFKLETTLDGHQRWVWDCAF-----SADSAYLVTA 268
            D + LAT S D TA +W   +    F +  T  GH   V               Y++TA
Sbjct: 400 EDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNVMEKNYPKYIITA 459

Query: 269 SSDHYVRLWDL 279
           S+D  V+ W++
Sbjct: 460 SNDLTVKKWEI 470

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV-- 219
           L SL+   DG  LA A+      +W   N +   ++     F  H+  ++ + L + +  
Sbjct: 393 LNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYI--YATFVGHAASVSAVCLPNVMEK 450

Query: 220 ---KHLATCSADHTARVWSI--------DDDFKLETTL---DGHQRWVWDCAFSADSAYL 265
              K++ T S D T + W I        +  F +++++     H++ +   + + + +  
Sbjct: 451 NYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIF 510

Query: 266 VTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            TAS D   +LW++ T E V     H +G
Sbjct: 511 ATASYDKTCKLWNVDTGEPVATLANHKRG 539

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 70/150 (46%), Gaps = 15/150 (10%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQ-HSDSQVNRLEITNDKKLLATAGHQ-NVRLYDIRT 62
           L+       ++     TGV +R+++  S S V   + T+   L+A  G   ++ + DI  
Sbjct: 77  LIYVSQSQLVKIVNVETGVITRSLKVSSPSYVMTCDPTS--TLVAIGGTDGSITVIDIE- 133

Query: 63  TNPNPVASFEGHRGNVTSVSFQQD---NRWMVTSSE-DGTIKVWDVRSPSIPRNYK-HNA 117
            N     SF+GH G ++S+ F  +   N W++ S + +G  KVWD+ +       + H++
Sbjct: 134 -NGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSS 192

Query: 118 PVNEVVIHPNQGE----LISCDRDGNIRIW 143
            +  +    N  +    LI+  RD  + +W
Sbjct: 193 AIRGIDFTKNDDKDVLNLITGGRDNVLNLW 222

>Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii ADL082C
          Length = 583

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 133/310 (42%), Gaps = 40/310 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  +G   R +      V  +   +D+KL+  +  + +R+++  T 
Sbjct: 282 LLFTGSYDSTVAIWDLCSGKLLRRLTGHTDGVKCVRF-DDQKLITGSLDKTIRVWNYVTG 340

Query: 64  NPNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
               V+++ GH+ +V SV SF+   + +V+ S D T+KVW V S +      H   +N V
Sbjct: 341 KC--VSTYRGHQDSVLSVDSFR---KIIVSGSADKTVKVWHVESRTCYTLRGHTKWINCV 395

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMASDGS 172
            +HP      S   D  IR+WD+  N C            ++ P +      +  A D +
Sbjct: 396 KLHPKSFTCFSGSDDTTIRMWDIRTNTCIKIFRGHVGQVQKVIPLNLVDENLVQDAEDAT 455

Query: 173 MLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTAR 232
           +++             P + D S   P                     +L +CS D+T +
Sbjct: 456 VISDVENTDVEDPTVNPENWDDSLPYP--------------------NYLLSCSLDNTIK 495

Query: 233 VWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +W +     + T   GH   VWD A  AD+  +V+ S D   ++WDL T + +  + G+ 
Sbjct: 496 LWDVKTSKCIRTQF-GHVEGVWDIA--ADNFRIVSGSHDRTCKVWDLQTGKCMHTFTGNQ 552

Query: 293 KGAVCVALND 302
               CV + D
Sbjct: 553 APIACVGIGD 562

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 82/224 (36%), Gaps = 56/224 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           V  F GH   V S+ F      + T S D T+ +WD+ S  + R    +    + V   +
Sbjct: 263 VQEFMGHMDGVLSLQFTHS--LLFTGSYDSTVAIWDLCSGKLLRRLTGHTDGVKCVRFDD 320

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
           Q +LI+   D  IR+W+    +C        D+ L                         
Sbjct: 321 Q-KLITGSLDKTIRVWNYVTGKCVSTYRGHQDSVLS------------------------ 355

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
                       V  FR       +I++S         SAD T +VW ++   +   TL 
Sbjct: 356 ------------VDSFR-------KIIVSG--------SADKTVKVWHVES--RTCYTLR 386

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH +W+        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 387 GHTKWINCVKLHPKSFTCFSGSDDTTIRMWDIRTNTCIKIFRGH 430

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
           LL+ +    ++L+D++T+    + +  GH   V  ++   DN  +V+ S D T KVWD++
Sbjct: 485 LLSCSLDNTIKLWDVKTSKC--IRTQFGHVEGVWDIA--ADNFRIVSGSHDRTCKVWDLQ 540

Query: 106 SPSIPRNYKHN-APVNEVVIHPNQGELISCDRDGNIRIW 143
           +      +  N AP+  V I     E +S D  G ++++
Sbjct: 541 TGKCMHTFTGNQAPIACVGI--GDSEFVSGDELGCVKLY 577

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
           GH   V    F+   + L T S D  V +WDL + +++R+  GH  G  CV  +D
Sbjct: 268 GHMDGVLSLQFT--HSLLFTGSYDSTVAIWDLCSGKLLRRLTGHTDGVKCVRFDD 320

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 86.3 bits (212), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 100/219 (45%), Gaps = 9/219 (4%)

Query: 74  HRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELIS 133
           H G +  + +  D   +++   D  +K+WD+ S S      H   V+ V +HP+     S
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAAS 273

Query: 134 CDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD 193
              D    +WDL E +   QL      ++ +++  SDG++LA+A     C +W++ +   
Sbjct: 274 ASFDLTWILWDL-ERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSG-- 330

Query: 194 ASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV 253
               +P+ K   H+  I+ +  S +   LAT  AD T RVW I  +   E+ L  HQ   
Sbjct: 331 ----EPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDI-RNVGTESALLAHQVAA 385

Query: 254 WDCAFSADSA-YLVTASSDHYVRLWDLSTREIVRQYGGH 291
            D  F  ++  +LV+   D  V +++    + +    GH
Sbjct: 386 LDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGH 424

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 94/234 (40%), Gaps = 13/234 (5%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV- 104
           LL+  G   V+L+D+ +   N      GH G V+ V      R   ++S D T  +WD+ 
Sbjct: 230 LLSGGGDNLVKLWDMTS---NSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLE 286

Query: 105 RSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQS 164
           R   +     H+  V  +    +   L S   D    IWDL   +   +L      ++  
Sbjct: 287 RKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGH-AGAISG 345

Query: 165 LSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRI-LLSSDVKHLA 223
           +  + +G  LA A   G   VW++ N    S L       AH      +    ++   L 
Sbjct: 346 VDWSPNGYQLATAGADGTVRVWDIRNVGTESAL------LAHQVAALDVKFKKNNGTFLV 399

Query: 224 TCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
           +C  D    +++ D+  KL  +L+GH   V+    + D + + +   D  ++ W
Sbjct: 400 SCGHDRLVNIFNADNWQKL-ASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 80/186 (43%), Gaps = 6/186 (3%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNV-RLYDIRT 62
           +  SA +D T   W+    V  +  +     V  +   +D  LLA+AG   V  ++D+R+
Sbjct: 270 LAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRS 329

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNE 121
             P  +   EGH G ++ V +  +   + T+  DGT++VWD+R+         H     +
Sbjct: 330 GEP--IMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALD 387

Query: 122 VVIHPNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           V    N G  L+SC  D  + I++    Q    L    D    ++ +  DGS + +    
Sbjct: 388 VKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVF-TVDITEDGSTIYSGGKD 446

Query: 181 GNCYVW 186
            +   W
Sbjct: 447 RSLKQW 452

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 128/279 (45%), Gaps = 30/279 (10%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPN---PVASFE- 72
           A   VC  T  +++  +  LE ++D  L A AG Q+  ++L+ +  T  +   P    E 
Sbjct: 408 AAPSVCMYTFHNTNRDMTCLEFSDDATL-AAAGFQDSYIKLWSLDGTPLDSKLPSKQREK 466

Query: 73  -------GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI 124
                  GH G V S SF  DN++++++SED T+++W + + S   +YK HN PV +V  
Sbjct: 467 INNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSF 526

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAANTK 180
            P      +   D   R+W      C H    ++       +  +S   +G+ +   +T 
Sbjct: 527 SPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTD 581

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
             C +W++    D+  L     F  H+  +    +S D + L+T S D    VW I    
Sbjct: 582 KTCRMWDI-GTGDSVRL-----FLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGK 635

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +L+      +  V+  ++S +   LV+  +DH VR+WDL
Sbjct: 636 RLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 93/204 (45%), Gaps = 4/204 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+SA  D T+R W   T     + +  +  V  +  +      ATA H Q  RL+     
Sbjct: 491 LLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI 550

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++WD+ +    R +  H APV   
Sbjct: 551 YP--LRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVIST 608

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+      ++ SLS + +G++L +     +
Sbjct: 609 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHS 668

Query: 183 CYVWEMPNHTDASHLKPVTKFRAH 206
             VW++   T   + +P   F ++
Sbjct: 669 VRVWDLKRSTAEPNTEPEQPFTSY 692

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 45/100 (45%), Gaps = 1/100 (1%)

Query: 201 TKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSA 260
           T    HS  +     S D K+L + S D T R+WS+D    L  +  GH   VWD +FS 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSL-VSYKGHNHPVWDVSFSP 528

Query: 261 DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
              Y  TAS D   RLW       +R + GH     CV+ 
Sbjct: 529 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSF 568

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 7/141 (4%)

Query: 161 SLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK 220
           ++ S S + D   L +A+      +W M  ++       +  ++ H+  +  +  S    
Sbjct: 478 TVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSS------LVSYKGHNHPVWDVSFSPLGH 531

Query: 221 HLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
           + AT S D TAR+WS D  + L     GH   V   +F  +  Y+ T S+D   R+WD+ 
Sbjct: 532 YFATASHDQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIG 590

Query: 281 TREIVRQYGGHHKGAVCVALN 301
           T + VR + GH    +  A++
Sbjct: 591 TGDSVRLFLGHTAPVISTAVS 611

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 46/95 (48%), Gaps = 12/95 (12%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDD---DFKLE---------TTLDGHQRWVWDCA 257
           +T +  S D    A    D   ++WS+D    D KL          TTL GH   V+  +
Sbjct: 424 MTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTS 483

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           FS D+ YL++AS D  VRLW + T   +  Y GH+
Sbjct: 484 FSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHN 518

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 130/286 (45%), Gaps = 37/286 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRTT---NPNPV----- 68
           AL  VC  T Q+++  ++ L  ++D ++ A AG Q+  ++++ +  +   NPN +     
Sbjct: 454 ALPSVCMYTFQNTNKDMSCLNFSDDCRI-AAAGFQDSYIKIWSLDGSSLNNPNIMLNSAN 512

Query: 69  ----------ASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNA 117
                      +  GH G V S SF  DN+++++ SED T+++W + + +   +YK HN 
Sbjct: 513 NNYRDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNH 572

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSM 173
           PV +V   P      +   D   R+W      C H    ++       +  +S   +G  
Sbjct: 573 PVWDVNFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCY 627

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
           +   ++   C +W      D S    V  F  H+  +  I +S D + L+T S D    +
Sbjct: 628 VFTGSSDKTCRMW------DVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINI 681

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           W I    +L+      +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 682 WDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 90/201 (44%), Gaps = 4/201 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  +  +      ATA H Q  RL+     
Sbjct: 544 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 603

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++WDV +    R +  H APV  +
Sbjct: 604 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICI 661

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I IWD+G  +   Q+      ++ SLS + +G++L +     +
Sbjct: 662 AVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 721

Query: 183 CYVWEMPNHTDASHLKPVTKF 203
             VW++   T     +P   F
Sbjct: 722 VRVWDLKKATTEPSAEPDEPF 742

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 96/231 (41%), Gaps = 29/231 (12%)

Query: 70  SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQG 129
           +F+    +++ ++F  D R      +D  IK+W +   S+                 N  
Sbjct: 462 TFQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSL-----------------NNP 504

Query: 130 ELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMP 189
            ++    + N R     ++  T +       ++ S S + D   L + +      +W M 
Sbjct: 505 NIMLNSANNNYR-----DDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMD 559

Query: 190 NHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGH 249
            HT       +  ++ H+  +  +  S    + AT S D TAR+WS D  + L     GH
Sbjct: 560 THT------ALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRI-FAGH 612

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
              V   +F  +  Y+ T SSD   R+WD+ST + VR + GH    +C+A+
Sbjct: 613 LNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAV 663

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 108/247 (43%), Gaps = 9/247 (3%)

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVN 120
           T N N  AS       + SV F  D +++ T +ED  I++WD+ +  I    K H   + 
Sbjct: 393 TGNQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIY 452

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
            +   P+  +L+S   D  +RIWDL    C+  L+ ED  +  ++S   +G  +AA +  
Sbjct: 453 SLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVS-PGEGKFIAAGSLD 511

Query: 181 GNCYVWEMPNHTDASHLKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSID-- 237
               VW+         L    +    H   +  ++ + D K + + S D + ++W+++  
Sbjct: 512 RTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGL 571

Query: 238 ----DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
                  + E T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH  
Sbjct: 572 SGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRN 631

Query: 294 GAVCVAL 300
             + V +
Sbjct: 632 SVISVTV 638

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 70/156 (44%), Gaps = 18/156 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+   D          + K +A     + VR++D    
Sbjct: 463 LVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTG 522

Query: 61  ----RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-- 114
               R  + N + +  GHR +V SV F +D + +V+ S D ++K+W++   S  +++   
Sbjct: 523 FLVERLDSENELGT--GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAEC 580

Query: 115 ------HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
                 H   V  V    N   ++S  +D  +  WD
Sbjct: 581 EVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 616

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/334 (23%), Positives = 136/334 (40%), Gaps = 54/334 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D +L+AT    N VRL++ +T 
Sbjct: 156 MVTGAGDNTARIWDCDTQTPMATLTGHHNWVLCVSWSPDGELIATGSMDNTVRLWESKTG 215

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
            P   A   GH   +TS+S++        +   + TSS+DGTIK+WD            +
Sbjct: 216 KPFGDA-LRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTRRVCTMTLSGH 274

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL-GENQCTHQLT-------------------- 155
                 V    Q  L S   D  +R+WD+    +C + L                     
Sbjct: 275 TSSVSCVKWGGQNFLYSGSHDKTVRVWDMKNSGRCINILKNHAHWVNHLSLSTDYALRVG 334

Query: 156 PEDDTSLQSLSM------------------ASDGSMLAAANTKGNCYVWEMPNHTDASHL 197
           P D T  Q  +                     +  ++  A+     ++W+    T     
Sbjct: 335 PFDYTGEQPATPEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTT----- 389

Query: 198 KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257
           KP+ +   H   +  +  S D +H+ + S D++ ++W    D K  TT  GH   V+  A
Sbjct: 390 KPIARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWD-SRDGKFITTFRGHVASVYQVA 448

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           +S+D   LV+ S D  +++WD+ TR++     GH
Sbjct: 449 WSSDCRLLVSCSKDTTLKVWDIRTRKLSVDLPGH 482

 Score = 67.8 bits (164), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L ++  D TI+ W+    VC+ T+    S V+ ++      L + +  + VR++D++ + 
Sbjct: 248 LATSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWGGQNFLYSGSHDKTVRVWDMKNSG 307

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              +   + H   V  +S   D    V   +      +    P+ P   K  A  N   +
Sbjct: 308 -RCINILKNHAHWVNHLSLSTDYALRVGPFD------YTGEQPATPEIAKAKALKNYEKV 360

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
               G+    +++   D  + +WD L   +   ++T      +  ++ + DG  + +A+ 
Sbjct: 361 AKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKL-VNHVAFSPDGRHIVSASF 419

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D+   K +T FR H   + ++  SSD + L +CS D T +VW I   
Sbjct: 420 DNSIKLW------DSRDGKFITTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDIRTR 473

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VR+W
Sbjct: 474 -KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 510

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 48/90 (53%), Gaps = 6/90 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+   A + + + IL S+   H    + T + D+TAR+W  D    +  TL GH  
Sbjct: 126 VKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPM-ATLTGHHN 184

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLST 281
           WV   ++S D   + T S D+ VRLW+  T
Sbjct: 185 WVLCVSWSPDGELIATGSMDNTVRLWESKT 214

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV----W 254
           P+     H  ++  +  S D + +AT S D+T R+W           L GH +W+    W
Sbjct: 175 PMATLTGHHNWVLCVSWSPDGELIATGSMDNTVRLWESKTGKPFGDALRGHGKWITSLSW 234

Query: 255 D---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +        +   L T+S D  +++WD + R       GH     CV
Sbjct: 235 EPIHLVTPGERPRLATSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCV 281

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 233 VWSIDDDFKLETTLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           V+ +    +  + + GH   +   AF+   S+ +VT + D+  R+WD  T+  +    GH
Sbjct: 123 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMATLTGH 182

Query: 292 HKGAVCVA 299
           H   +CV+
Sbjct: 183 HNWVLCVS 190

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 134/325 (41%), Gaps = 36/325 (11%)

Query: 11  DHTIRFWEALTGVCSRTIQHS---DSQVNRLEITNDKKLLATAGHQNVRLY--------- 58
           D+ + F  AL       + HS    S V  ++ +ND + LAT  ++  ++Y         
Sbjct: 304 DYYVVFNPALPLELDVELHHSLNHSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIA 363

Query: 59  ---DIRTTNPNPVASFEGHRGN----VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPR 111
              D   T+P+  ++  G   +    + SV F  D  ++ T +ED  I++WD++   I  
Sbjct: 364 KLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVM 423

Query: 112 NYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             K H   V  +   PN  +L+S   D  +RIWDL   QC+  L+ E   +  ++S  +D
Sbjct: 424 VLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVS-PND 482

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKF-RAHSTYITRILLSSDVKHLATCSADH 229
           G  +AA +      VW+         L    +    H   +  ++ + D   + + S D 
Sbjct: 483 GKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDK 542

Query: 230 TARVWSI--------------DDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275
           T ++W++                    E T  GH+ +V     S D  Y+++ S D  + 
Sbjct: 543 TVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGIL 602

Query: 276 LWDLSTREIVRQYGGHHKGAVCVAL 300
            WD  +   +    GH    + VA+
Sbjct: 603 FWDKESGNPLLMLQGHRNSVISVAV 627

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+             ND K +A     + VR++D    
Sbjct: 444 LVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG 503

Query: 61  ----RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
               R  + N + +  GHR +V SV F +D   +V+ S D T+K+W++R
Sbjct: 504 FLVERLDSENELGT--GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMR 550

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 102/231 (44%), Gaps = 9/231 (3%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+ +  I    + H   +  +   P   +L+S   
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 415 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRTVRVWDSETGFLVER 473

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKHLATCSADHTARVWSI------DDDFKLETTLDGH 249
           L    +    H   +  ++ + D + + + S D + ++W +            E T  GH
Sbjct: 474 LDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH 533

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           + +V   A + D  Y+++ S D  V  WD ++   +    GH    + VA+
Sbjct: 534 KDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAV 584

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 103/253 (40%), Gaps = 33/253 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ITNDKKLLATAGHQNVRLYDIRTT 63
           L +   D  IR W+  T     T+Q  +  +  L+      KL++ +G + VR++D+RT 
Sbjct: 367 LATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTG 426

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-DNRWMVTSSEDGTIKVWDVRSPSIPRNY--------K 114
             +   S E     VT+V+    D +++   S D T++VWD  +  +             
Sbjct: 427 QCSLTLSIE---DGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTG 483

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDL-GEN------QCTHQLTPEDDTSLQSLSM 167
           H   V  VV   +   +IS   D ++++WDL G N       C    T   D  L   + 
Sbjct: 484 HKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATT 543

Query: 168 ASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL------LSSDVKH 221
             D  +L+ +  +G  + W      D +   P+   + H   +  +       L  DV  
Sbjct: 544 QDDEYILSGSKDRGVLF-W------DTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGV 596

Query: 222 LATCSADHTARVW 234
            AT S D  AR+W
Sbjct: 597 FATGSGDCKARIW 609

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  YL T + D  +R+WDL+T++I+    GH +
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQ 395

>SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 643

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 133/309 (43%), Gaps = 39/309 (12%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L +  YD T+  W+  +G   R +      V  +   +D+KL+  +  + +R+++ +T  
Sbjct: 345 LFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYF-DDQKLITGSLDKTIRVWNYQTGA 403

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              ++++ GH  +V SV   +  + +V+ S D T+KVW V S +      H+  VN V +
Sbjct: 404 C--ISTYRGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYTLRGHSEWVNCVKL 459

Query: 125 HPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSM-ASDGSM 173
           HP      S   D  IR+WD+  N C            ++ P     +++L +   + + 
Sbjct: 460 HPKSFTCFSGSDDTTIRMWDIRSNTCIKVFKGHVGQVQKVIPLKIVDVENLVVDKQEEAQ 519

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
                  G   V ++    D +   P                     H+ +CS D+T ++
Sbjct: 520 ELIPEPNGEGAVDDVTGTMDPNLPYPT--------------------HILSCSLDNTIKL 559

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           W +    K   T  GH   VWD A  AD+  +++ + D  V++WDL + + +  + GH  
Sbjct: 560 WEVRSG-KCVRTHFGHVEGVWDIA--ADNFRVISGAHDRTVKIWDLQSGKCMHTFTGHQA 616

Query: 294 GAVCVALND 302
              CV + D
Sbjct: 617 PIACVDIGD 625

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 87/225 (38%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V S+ F  ++R++ T S D T+ +WD+ S  + R    H+  V  V    
Sbjct: 325 IQEFKGHMDGVLSLQF--NHRYLFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYF-- 380

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           +  +LI+   D  IR+W+     C                                    
Sbjct: 381 DDQKLITGSLDKTIRVWNYQTGAC------------------------------------ 404

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R HS  +  + + S  K + + SAD T +VW ++   +   TL
Sbjct: 405 -------------ISTYRGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES--RTCYTL 447

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ +   ++ + GH
Sbjct: 448 RGHSEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRSNTCIKVFKGH 492

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 78/195 (40%), Gaps = 49/195 (25%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIR 61
           I+VS   D T++ W   +  C     HS+  VN +++ + K     +G  +  +R++DIR
Sbjct: 424 IIVSGSADKTVKVWHVESRTCYTLRGHSE-WVNCVKL-HPKSFTCFSGSDDTTIRMWDIR 481

Query: 62  TTNPNPVASFEGHRGNVTS-------------VSFQQDNRWMV----------------- 91
           +     +  F+GH G V               V  Q++ + ++                 
Sbjct: 482 SN--TCIKVFKGHVGQVQKVIPLKIVDVENLVVDKQEEAQELIPEPNGEGAVDDVTGTMD 539

Query: 92  ----------TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV-VIHPNQGELISCDRDGNI 140
                     + S D TIK+W+VRS    R   H   V  V  I  +   +IS   D  +
Sbjct: 540 PNLPYPTHILSCSLDNTIKLWEVRSGKCVRT--HFGHVEGVWDIAADNFRVISGAHDRTV 597

Query: 141 RIWDLGENQCTHQLT 155
           +IWDL   +C H  T
Sbjct: 598 KIWDLQSGKCMHTFT 612

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 44/112 (39%), Gaps = 20/112 (17%)

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           KG+C + E   H D                   + L  + ++L T S D T  +W +   
Sbjct: 320 KGSCVIQEFKGHMDGV-----------------LSLQFNHRYLFTGSYDSTVAIWDLCSG 362

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            KL   L GH   V    F  D   L+T S D  +R+W+  T   +  Y GH
Sbjct: 363 -KLIRRLTGHHDGVKSVYF--DDQKLITGSLDKTIRVWNYQTGACISTYRGH 411

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
             GH   V    F  +  YL T S D  V +WDL + +++R+  GHH G   V  +D
Sbjct: 328 FKGHMDGVLSLQF--NHRYLFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYFDD 382

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-KLLATAGHQNVRLYDIRTT 63
           ++S   D+TI+ WE  +G C RT  H        +I  D  ++++ A  + V+++D+++ 
Sbjct: 548 ILSCSLDNTIKLWEVRSGKCVRT--HFGHVEGVWDIAADNFRVISGAHDRTVKIWDLQSG 605

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVW 102
               + +F GH+  +  V         V+  E G +K++
Sbjct: 606 --KCMHTFTGHQAPIACVDIGDSE--FVSGDELGCVKLY 640

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 125/307 (40%), Gaps = 45/307 (14%)

Query: 38  LEITNDKKLLATAGHQNVRLYDIR----------------TTNPNPVASFEGHRGN---- 77
           +  +ND K LAT  ++  ++Y++                 T   N   S  G   N    
Sbjct: 358 VRFSNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGGEENNDTTT 417

Query: 78  ------------VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI 124
                       + SV F  D +++ T +ED  I++WD+    I    + H   +  +  
Sbjct: 418 YSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDY 477

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCY 184
            P+  +L+S   D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      
Sbjct: 478 FPSGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PEDGKYIAAGSLDRAVR 536

Query: 185 VWEMPNHTDASHLKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDD----D 239
           VW+         L    +    H   +  ++ + D  ++ + S D + ++W+++D    D
Sbjct: 537 VWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKD 596

Query: 240 FK------LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
            K       E T  GH+ +V   A +    Y+++ S D  V  WD  +   +    GH  
Sbjct: 597 LKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRN 656

Query: 294 GAVCVAL 300
             + VA+
Sbjct: 657 SVISVAV 663

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 22/160 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 484 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETG 543

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR-------SPSI 109
                  + N + +  GH+ +V SV F +D   +V+ S D ++K+W++         P++
Sbjct: 544 FLVERLDSENELGT--GHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNV 601

Query: 110 PRNYK-----HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
           P   +     H   V  V        ++S  +D  +  WD
Sbjct: 602 PGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWD 641

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 132/276 (47%), Gaps = 32/276 (11%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDI-----------RTTNPNPVA 69
           VC  T  +++ ++  L  ++D +L+A AG Q+  ++L+ +           +  + +   
Sbjct: 478 VCMYTFHNTNREMTCLRFSDDSRLVA-AGFQDSYIKLWSLDGTPLESQLPSKAKDASNTV 536

Query: 70  SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQ 128
           +  GH G V SVSF  DNR++V++SED T+++W + + +   +YK HN PV +V   P  
Sbjct: 537 TLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLG 596

Query: 129 GELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAANTKGNCY 184
               +   D   R+W      C H    ++       +  ++   +G+ +   ++   C 
Sbjct: 597 HYFATGSHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCR 651

Query: 185 VWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLET 244
           +W++    D+  L     F  H+  +  + +S D + L T S D    VW I    +++ 
Sbjct: 652 MWDI-QTGDSVRL-----FLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIK- 704

Query: 245 TLDGHQR-WVWDCAFSADSAYLVTASSDHYVRLWDL 279
            + GH +  V+  +F+ +   LV+  +D  VR+WDL
Sbjct: 705 QMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 96/204 (47%), Gaps = 4/204 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           LVSA  D T+R W   T  C  + +  +  V  ++ +      AT  H Q  RL+     
Sbjct: 557 LVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHI 616

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  V+F  +  +++T S D T ++WD+++    R +  H A V  V
Sbjct: 617 YP--LRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV 674

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+     +++ SLS   +G++L +     +
Sbjct: 675 AVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQS 734

Query: 183 CYVWEMPNHTDASHLKPVTKFRAH 206
             VW++   T+   L+P   +  +
Sbjct: 735 VRVWDLKKFTNEPSLEPEQPYSGY 758

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 107/262 (40%), Gaps = 33/262 (12%)

Query: 55  VRLYDIRTTNPNPVASFEGHRGN--VTSVSFQQDNRWMVTSSEDGTIKVWDV-RSP---S 108
           +++ +++T+ P+ V  +  H  N  +T + F  D+R +    +D  IK+W +  +P    
Sbjct: 466 IKMDNLQTSAPS-VCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQ 524

Query: 109 IPRNYK----------HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT--- 155
           +P   K          H+ PV  V   P+   L+S   D  +R+W L    C        
Sbjct: 525 LPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHN 584

Query: 156 -PEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL 214
            P  D     L     G   A  +      +W         H+ P+  F  H   +  + 
Sbjct: 585 HPVWDVKFSPL-----GHYFATGSHDQTARLWS------CDHIYPLRIFAGHLNDVDCVT 633

Query: 215 LSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
              +  ++ T S+D T R+W I     +   L GH   V   A S D  +L T S D  +
Sbjct: 634 FHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFL-GHTASVVSVAVSPDGRWLTTGSEDGVI 692

Query: 275 RLWDLSTREIVRQYGGHHKGAV 296
            +WD+ T + ++Q  GH K AV
Sbjct: 693 IVWDIGTGKRIKQMRGHGKSAV 714

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 119/259 (45%), Gaps = 31/259 (11%)

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS---IP--RNYKHNAPV 119
           P  V  +EGH+  + +V   +D  W+ T+S+D T  +W  +S S   +P  +   H++ V
Sbjct: 369 PIDVELYEGHKDLLNAVDATEDGLWLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAV 428

Query: 120 NEV----VIHPNQGELI-SCDRDGNIRIW------------DLGENQCTHQLTPEDDTSL 162
             V    ++H    E I +   D  ++ W            +L   + +       +  +
Sbjct: 429 TAVGLPNIMHKGWPEFILTASNDLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKDI 488

Query: 163 QSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHL 222
            +LS+A + S  A A+    C VW++    ++  +K       H   +  +      + +
Sbjct: 489 NALSVAPNDSTFATASYDKTCKVWDL----ESGEVKAT--LANHRRGLWDVAFCQYERLI 542

Query: 223 ATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           ATCS D T ++WS+D  F +  T +GH   V  C+F      LV++S+D  V++WD ST 
Sbjct: 543 ATCSGDKTIKIWSLDT-FAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTG 601

Query: 283 EIVRQYGGHHKG--AVCVA 299
           E V+   GH     A+CVA
Sbjct: 602 ECVKTLDGHTNRIWALCVA 620

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 104/276 (37%), Gaps = 30/276 (10%)

Query: 35  VNRLEITNDKKLLATAGHQNVRLYDIRTTNPN---PVASFEGHRGNVTSVSFQQDN---- 87
           +N ++ T D   LATA   +  +     +N N   P A FEGH   VT+V          
Sbjct: 382 LNAVDATEDGLWLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAVTAVGLPNIMHKGW 441

Query: 88  -RWMVTSSEDGTIKVWDVRSP--------------SIPRNYKHNAPVNEVVIHPNQGELI 132
             +++T+S D T+K W V  P              S      H   +N + + PN     
Sbjct: 442 PEFILTASNDLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFA 501

Query: 133 SCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT 192
           +   D   ++WDL   +    L       L  ++      ++A  +      +W +    
Sbjct: 502 TASYDKTCKVWDLESGEVKATLA-NHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDT-- 558

Query: 193 DASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRW 252
                  V  F  H+  + R    +    L + SAD   ++W      +   TLDGH   
Sbjct: 559 ----FAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTG-ECVKTLDGHTNR 613

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
           +W    + D   +V+A +D   + W  ST +  +Q+
Sbjct: 614 IWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQH 649

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 75/168 (44%), Gaps = 10/168 (5%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRTT 63
             +A YD T + W+  +G    T+ +    +  +     ++L+AT +G + ++++ + T 
Sbjct: 500 FATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTF 559

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEV 122
               V +FEGH   V   SF      +V+SS DG +K+WD  +    +    H   +  +
Sbjct: 560 --AVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWAL 617

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQ------LTPEDDTSLQS 164
            +  +   ++S D DG  + W     Q   Q      L  E + SLQ+
Sbjct: 618 CVAEDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQSLQN 665

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 107/260 (41%), Gaps = 21/260 (8%)

Query: 40  ITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTI 99
           +++D  +LAT     + +  +                ++T++    D R++  +S+   +
Sbjct: 25  VSSDGSILATPVLDEINIIQLVPERKTLFTIENDDEQDITALKLTADGRYLCFASQAQLL 84

Query: 100 KVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD 159
           K++D+R   I R+ K ++P   V        L     DG+I + D+     TH L     
Sbjct: 85  KIFDLREGKIVRSMKISSPSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGG 144

Query: 160 TSLQSLSMASDGS----MLAAANTKGNCYVWEMPN----HTDASHLKPVTKFRAHSTYIT 211
           T + S+    + +    +LA+ +T G   +W++      HT   H   V     H +   
Sbjct: 145 T-ISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESK-- 201

Query: 212 RILLSSDVKHLATCSA--DHTARVWSIDDDFK--LETTLDGHQRWVWDCAFSADSAYLVT 267
               ++D   L   S   D     W  +   K  L  TL   Q+ V  C F A+S  + T
Sbjct: 202 ----NNDESELFLISGGRDDVINYWQFNLKKKCTLLKTLPVSQQ-VESCGF-ANSELIYT 255

Query: 268 ASSDHYVRLWDLSTREIVRQ 287
           A SD +++L  L + + V++
Sbjct: 256 AGSDAFLQLISLESGKAVKR 275

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/100 (21%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-KLLATAGHQNVRLYDIRT 62
           ++ +   D TI+ W   T    +T +   + V R    N + +L++++    V+++D  T
Sbjct: 541 LIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCST 600

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVW 102
                V + +GH   + ++   +D   +V++  DG  + W
Sbjct: 601 --GECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFW 638

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 128/284 (45%), Gaps = 36/284 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDI---------------- 60
           AL  VC  T Q+++  ++ L+ ++D ++ A AG Q+  ++++ +                
Sbjct: 453 ALPSVCMYTFQNTNKDMSCLDFSDDCRI-AAAGFQDSYIKIWSLDGSSLNNPNIALNNND 511

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           +  +P    +  GH G V S SF  DN+++++ SED T+++W + + +   +YK HN PV
Sbjct: 512 KDEDPT-CKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPV 570

Query: 120 NEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLA 175
            +V   P      +   D   R+W      C H    ++       +  +S   +G  + 
Sbjct: 571 WDVSFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVF 625

Query: 176 AANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWS 235
             ++   C +W      D S    V  F  H+  +  I +  D + L+T S D    VW 
Sbjct: 626 TGSSDKTCRMW------DVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWD 679

Query: 236 IDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           I    +L+      +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 680 IGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 89/201 (44%), Gaps = 4/201 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  +  +      ATA H Q  RL+     
Sbjct: 540 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI 599

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++WDV +    R +  H APV  +
Sbjct: 600 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISI 657

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+      ++ SLS + +G++L +      
Sbjct: 658 AVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHT 717

Query: 183 CYVWEMPNHTDASHLKPVTKF 203
             VW++   T     +P   F
Sbjct: 718 VRVWDLKKATTEPSAEPDEPF 738

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 7/140 (5%)

Query: 161 SLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK 220
           ++ S S + D   L + +      +W M  HT       +  ++ H+  +  +  S    
Sbjct: 527 TVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHT------ALVSYKGHNHPVWDVSFSPLGH 580

Query: 221 HLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
           + AT S D TAR+WS D  + L     GH   V   +F  +  Y+ T SSD   R+WD+S
Sbjct: 581 YFATASHDQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 639

Query: 281 TREIVRQYGGHHKGAVCVAL 300
           T + VR + GH    + +A+
Sbjct: 640 TGDSVRLFLGHTAPVISIAV 659

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 205 AHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAY 264
            HS  +     S D K+L + S D T R+WS+D    L  +  GH   VWD +FS    Y
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTAL-VSYKGHNHPVWDVSFSPLGHY 581

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
             TAS D   RLW       +R + GH     CV+ 
Sbjct: 582 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSF 617

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 16/94 (17%)

Query: 215 LSSDVKHLATCSADHTARVWSID----------------DDFKLETTLDGHQRWVWDCAF 258
            S D +  A    D   ++WS+D                D+     TL GH   V+  +F
Sbjct: 474 FSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSF 533

Query: 259 SADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           S D+ YL++ S D  VRLW + T   +  Y GH+
Sbjct: 534 SPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 567

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 127/283 (44%), Gaps = 36/283 (12%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRT-IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           L S G+ D  I+ W +L G    T    ++   NR+ IT D+ L     H +  L     
Sbjct: 469 LASTGFQDSYIKIW-SLDGTSLNTKFTQANKDRNRITIT-DRSLT----HMDNEL----- 517

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
                 A+  GH G V S SF  DNR++++ SED T+++W + + +   +YK HN P+ +
Sbjct: 518 -----SATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWD 572

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAA 177
           V   P      +   D   R+W      C H    ++       +  +S   +G  +   
Sbjct: 573 VQFSPLGHYFATASHDQTARLW-----SCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTG 627

Query: 178 NTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID 237
           ++   C +W      D S    V  F  H++ +    +S D + L T S D T  VW I 
Sbjct: 628 SSDKTCRMW------DISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIG 681

Query: 238 DDFKLETTLDGH-QRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
              +L+ +L GH +  V+   +S +   LV++ +D  VR+WDL
Sbjct: 682 SGKRLK-SLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 111/270 (41%), Gaps = 37/270 (13%)

Query: 37  RLEITNDKKLLATAGHQNVRLYDIRTTNPNPVAS-----FEGHRGNVTSVSFQQDNRWMV 91
           RLEI   ++       +++RL     TNPN + S     F     ++TS+ F  D R   
Sbjct: 421 RLEIQKVRE-----SRESIRL----DTNPNSLPSVCMYTFHNTNQDMTSLEFSDDCRLAS 471

Query: 92  TSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           T  +D  IK+W +   S+   + + N   N + I          DR       +L     
Sbjct: 472 TGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITI---------TDRSLTHMDNELSATLI 522

Query: 151 THQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYI 210
            H  T      + S S + D   L + +      +W +  HT       +  ++ H+  I
Sbjct: 523 GHSGT------VYSTSFSPDNRYLISGSEDKTVRLWSLDTHT------ALVSYKGHNHPI 570

Query: 211 TRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASS 270
             +  S    + AT S D TAR+WS D  F L     GH   V   +F  +  Y+ T SS
Sbjct: 571 WDVQFSPLGHYFATASHDQTARLWSCDHIFPLRI-FAGHLNDVDCVSFHPNGYYVFTGSS 629

Query: 271 DHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           D   R+WD+ST + VR + GH    V  A+
Sbjct: 630 DKTCRMWDISTGDSVRLFLGHTSAVVSTAV 659

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 5/160 (3%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRTT 63
             +A +D T R W        R      + V+ +    N   +   +  +  R++DI T 
Sbjct: 582 FATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTG 641

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEV 122
           +   V  F GH   V S +   D RW+ T S+DGTI VWD+ S    ++ + H       
Sbjct: 642 DS--VRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYS 699

Query: 123 VIHPNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTS 161
           + +  +G  L+S   D ++R+WDL +        P   T+
Sbjct: 700 LTYSKEGNLLVSSGADQSVRVWDLFKPSANANNNPSSGTT 739

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 115/266 (43%), Gaps = 46/266 (17%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSFQQ-DNR-- 88
           +N L+ T D   LATA   N  +   YD +T      A F GH G VT+V      NR  
Sbjct: 423 LNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLPNVMNRPW 482

Query: 89  --WMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++++S D TIK W V  P   ++  H    +E     ++ ++               
Sbjct: 483 PEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDI--------------- 527

Query: 147 ENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAH 206
                            +L+++ + S+ A A+    C +W +    D   L+       H
Sbjct: 528 ----------------NALAVSPNDSVFATASYDKTCKIWSL----DTGELE--ATLANH 565

Query: 207 STYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLV 266
              +  +      K LATCS D T ++WS+D  + +  TL+GH   V  C+F + +  LV
Sbjct: 566 KRGLWDVNFCQYDKLLATCSGDKTVKIWSLDT-YSVMKTLEGHTNAVQRCSFISKNKQLV 624

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHH 292
           ++ +D  V+LWD ST E V+    H+
Sbjct: 625 SSGADGLVKLWDCSTGECVKTLDAHN 650

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 67/142 (47%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           +  +A YD T + W   TG    T+ +    +  +      KLLAT +G + V+++ + T
Sbjct: 538 VFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDT 597

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNE 121
              + + + EGH   V   SF   N+ +V+S  DG +K+WD  +    +    HN  +  
Sbjct: 598 Y--SVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWA 655

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           + +  +   +++ D DG  + W
Sbjct: 656 LSVLKDGDIIVTADADGVFQFW 677

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 61/148 (41%), Gaps = 17/148 (11%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV-- 219
           L SL    DG  LA A+      +W     T+    K   KF  H+  +T + L + +  
Sbjct: 423 LNSLDATEDGMWLATASKDNFVILWRYDEQTEL--FKQYAKFVGHAGPVTAVGLPNVMNR 480

Query: 220 ---KHLATCSADHTARVWSID--DDFK--------LETTLDGHQRWVWDCAFSADSAYLV 266
              + L + S D T + W++   +D K         E T   H++ +   A S + +   
Sbjct: 481 PWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFA 540

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG 294
           TAS D   ++W L T E+      H +G
Sbjct: 541 TASYDKTCKIWSLDTGELEATLANHKRG 568

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 71/168 (42%), Gaps = 14/168 (8%)

Query: 33  SQVNRLEITNDKKLLATAGHQ-NVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQD---NR 88
           S V  +E      LLA  G   +V + DI   N     SF+GH G ++SV F  +   N 
Sbjct: 122 SPVYVMECDVTSTLLAIGGTDGSVSIIDIE--NGYVTHSFKGHGGTISSVKFHGELNSNV 179

Query: 89  WMVTSSE-DGTIKVWD-VRSPSIPRNYKHNAPVNEVVIH-----PNQGELISCDRDGNIR 141
           W + S +  G +K+WD V+   +    +H   V  +         +Q +LIS  RD  I 
Sbjct: 180 WRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIIN 239

Query: 142 IWDL-GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEM 188
           ++      +C    T      ++S    + G +     T G+  V+++
Sbjct: 240 LYQFDSRKKCKLLKTLPIHQQVESCGFINTGGVQNCVYTAGSDAVYQI 287

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 81/194 (41%), Gaps = 40/194 (20%)

Query: 28  IQHSDSQ-VNRLEITNDKKLLATAGH-QNVRLYDIRTTN-------PNPVASFEGHRGNV 78
           I++ D Q +  L IT D + L      Q +R+Y + +          +PV   E    +V
Sbjct: 75  IENDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSSPVYVMEC---DV 131

Query: 79  TSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIH----PNQGELIS 133
           TS         +     DG++ + D+ +  +  ++K H   ++ V  H     N   L S
Sbjct: 132 TST-------LLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLAS 184

Query: 134 CDRDGNIRIWDLGENQCTH--------------QLTPEDDTSLQSLSMASDGSM-LAAAN 178
            D  G ++IWDL + +C H              ++  ED+  +Q +S   D  + L   +
Sbjct: 185 GDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLYQFD 244

Query: 179 TKGNCYVWE-MPNH 191
           ++  C + + +P H
Sbjct: 245 SRKKCKLLKTLPIH 258

>CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar to
           uniprot|P39014 Saccharomyces cerevisiae YIL046w MET30
          Length = 673

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 131/301 (43%), Gaps = 40/301 (13%)

Query: 4   ILVSAGYDHTIRFWEALTG-VCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           +L +  YD T+  W+  TG +  R   HSD  V  L   +D+KL+  +  + +R+++  T
Sbjct: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG-VKTLYF-DDQKLITGSLDKTIRVWNYIT 403

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
                ++++ GH  +V SV   +  + +V+ S D T+KVW V S +      H   VN V
Sbjct: 404 GEC--ISTYRGHTDSVMSVDSHK--KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCV 459

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTH-------------QLTPEDDTSLQSLSMAS 169
            +HP      SC  D  IR+WD+  N C                LT  D  +L +     
Sbjct: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKP 519

Query: 170 DGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADH 229
                 A+N  G     E       +  + + K   + T            HL +C+ D+
Sbjct: 520 GEEDDIASNGTG-----EDDPENGVNGQRELDKKMPYPT------------HLLSCALDN 562

Query: 230 TARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYG 289
           T ++W +     + T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + 
Sbjct: 563 TIKLWEVRSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFH 619

Query: 290 G 290
           G
Sbjct: 620 G 620

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 86/224 (38%), Gaps = 56/224 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V ++ F  + R + T S D T+ +WD+ +  + R    ++   + +   +
Sbjct: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
           Q +LI+   D  IR+W+    +C                                     
Sbjct: 385 Q-KLITGSLDKTIRVWNYITGEC------------------------------------- 406

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
                       ++ +R H+  +  +   S  K + + SAD T +VW ++   +   TL 
Sbjct: 407 ------------ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES--RTCYTLK 450

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH  WV        S    + S D  +R+WD+ T   +R + GH
Sbjct: 451 GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256
           L  + +F+ H   +  + L  + + L T S D T  +W +    KL   L GH   V   
Sbjct: 324 LCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTL 380

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            F  D   L+T S D  +R+W+  T E +  Y GH
Sbjct: 381 YF--DDQKLITGSLDKTIRVWNYITGECISTYRGH 413

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
             GH   V    F  +   L T S D  V +WDL T +++R+  GH  G   +  +D
Sbjct: 330 FKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 133/310 (42%), Gaps = 39/310 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRTT------------- 63
           AL  VC  T  ++D  +  LE ++D +L A AG Q+  ++++ +  +             
Sbjct: 483 ALPSVCMYTFHNTDRDMTSLEFSDDCRL-AAAGFQDSQIKIFSLDGSSLNSKLTESNKKT 541

Query: 64  -----NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNA 117
                N    ++  GH G V S SF  DNR++V+ SED T+++W + + +   +YK HN 
Sbjct: 542 NKLLNNDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNH 601

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSM 173
           PV +V   P      +   D   R+W      C H    ++       +  +S   +G  
Sbjct: 602 PVWDVEFSPLGHYFATASHDHTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCY 656

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
           L   ++   C +W      D +    V  F   +  +    +S D + L+T S D    V
Sbjct: 657 LFTGSSDKTCRMW------DITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINV 710

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           W I    +L+      +  ++  +++ +   L++  +DH VR+WDL  ++   + G   +
Sbjct: 711 WDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDL--KKATTESGAEPE 768

Query: 294 GAVCVALNDV 303
                 L DV
Sbjct: 769 EPFVGYLGDV 778

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 88/201 (43%), Gaps = 4/201 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           LVS   D T+R W   T     + +  +  V  +E +      ATA H    RL+     
Sbjct: 573 LVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSCDHI 632

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++WD+ +    R +    APV   
Sbjct: 633 YP--LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMST 690

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+      ++ SLS   +G++L +     +
Sbjct: 691 SVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHS 750

Query: 183 CYVWEMPNHTDASHLKPVTKF 203
             VW++   T  S  +P   F
Sbjct: 751 VRVWDLKKATTESGAEPEEPF 771

>KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.231
           YIL046W
          Length = 591

 Score = 83.2 bits (204), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 131/297 (44%), Gaps = 44/297 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L +  YD T+  W+    +  R +      V  L   +DKKL+  +  + +++++  T  
Sbjct: 265 LFTGSYDSTVAIWDLYNNILIRRLNGHTDGVKALYF-DDKKLITGSLDKTIKIWNYVTGQ 323

Query: 65  PNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
              ++++ GH  +V SV +F+   + +V+ S D T+KVW + S +      H   VN V 
Sbjct: 324 C--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKVWHIESRTCYTLKGHTEWVNCVK 378

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMASDGSM 173
           +HP      SC  D  IR+WD+  N C            ++ P     +++L   SD S 
Sbjct: 379 LHPKSFTCFSCSDDTTIRMWDIRTNTCIKVFKGHVGQVQKVIPLTIIDIENL--VSDISN 436

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
              ++           N+ D    +P+     + T            HL +CS D+T ++
Sbjct: 437 DEDSD----------ENNEDDELNQPLDDSIPYPT------------HLLSCSLDNTIKL 474

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
           W++     + T   GH   VWD A  AD+  +++ S D  +++WDL   + +  + G
Sbjct: 475 WNVKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGCLKVWDLQNGQCLHTFQG 528

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 87/225 (38%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV-VIHP 126
           +  F+GH   V S+ F    +++ T S D T+ +WD+ +  + R  + N   + V  ++ 
Sbjct: 245 IIDFKGHLDGVLSLQFNY--KYLFTGSYDSTVAIWDLYNNILIR--RLNGHTDGVKALYF 300

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           +  +LI+   D  I+IW+    QC                                    
Sbjct: 301 DDKKLITGSLDKTIKIWNYVTGQC------------------------------------ 324

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R H+  +  +   +  K + + SAD T +VW I+   +   TL
Sbjct: 325 -------------ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKVWHIES--RTCYTL 367

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 368 KGHTEWVNCVKLHPKSFTCFSCSDDTTIRMWDIRTNTCIKVFKGH 412

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 75/188 (39%), Gaps = 42/188 (22%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62
           I+VS   D T++ W   +  C     H++  VN +++        + +    +R++DIRT
Sbjct: 344 IIVSGSADKTVKVWHIESRTCYTLKGHTE-WVNCVKLHPKSFTCFSCSDDTTIRMWDIRT 402

Query: 63  TNPNPVASFEGHRGNVTSV----------------------SFQQDNRW----------- 89
                +  F+GH G V  V                         +D+             
Sbjct: 403 N--TCIKVFKGHVGQVQKVIPLTIIDIENLVSDISNDEDSDENNEDDELNQPLDDSIPYP 460

Query: 90  --MVTSSEDGTIKVWDVRSPSIPR-NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++ S D TIK+W+V++    R  + H   V ++    +   +IS   DG +++WDL 
Sbjct: 461 THLLSCSLDNTIKLWNVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGCLKVWDLQ 518

Query: 147 ENQCTHQL 154
             QC H  
Sbjct: 519 NGQCLHTF 526

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
             GH   V    F+    YL T S D  V +WDL    ++R+  GH  G   +  +D
Sbjct: 248 FKGHLDGVLSLQFNY--KYLFTGSYDSTVAIWDLYNNILIRRLNGHTDGVKALYFDD 302

>KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {ON}
           highly similar to uniprot|P25636 Saccharomyces
           cerevisiae YCR057C PWP2 part of small (ribosomal)
           subunit (SSU) processosome (contains U3 snoRNA) Eight
           WD-repeats with homology with G protein beta subunits
           flanked by nonhomologous N-terminal and C-terminal
           extensions regulatory protein
          Length = 915

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 101/221 (45%), Gaps = 21/221 (9%)

Query: 77  NVTSVSFQQDNRWMVTSSEDGT---------IKVWD-VRSPSIPRNYKHNAPVNEVVIHP 126
           N+    ++Q N   +  SEDGT         + V+D V + S    Y+H   ++ V ++P
Sbjct: 9   NLLGTVYRQGN---ILFSEDGTQLISPVGNRVSVFDLVHNKSFTFEYEHRKNISCVALNP 65

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
               L+S D DG   + +       H L  ++   ++ L  + DG + A A  +    VW
Sbjct: 66  QGTLLLSVDEDGRAILVNFRAKTVLHHLNFKE--KVRDLKFSPDGKLFALACGR-FVQVW 122

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILL---SSDVKHLATCSADHTARVWSIDDDFK-- 241
           + P   +     P  ++R H+ + + I+    S D + L + S D TAR+WS+D + K  
Sbjct: 123 KTPEVAEDRQFAPFVRYRVHAGHFSDIISLTWSQDSRFLVSTSKDLTARIWSLDSEEKDL 182

Query: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
              T  GH+ +V    FS+D   + T S D  V  W+ + R
Sbjct: 183 ASVTFAGHRDYVMGAFFSSDQERIYTVSKDGAVFQWEYTIR 223

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 96/210 (45%), Gaps = 14/210 (6%)

Query: 78  VTSVSFQQDNRWM-VTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCD 135
           V +VS      W+   SS+ G + V++ +S S I +   H    N V   P+   +++  
Sbjct: 301 VNAVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTAS 360

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            DG I+IWD+    C      E  +++  L+ A  G +L +A+  G    W++  + +  
Sbjct: 361 EDGKIKIWDVVSGFCLVTFQ-EHTSAVTGLAFAKKGQVLFSASLDGTVRAWDLVRYRNFR 419

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATC--SADHTA-RVWSIDDDFKLETTLDGHQRW 252
                 + + +        L++D      C  S D  A  VWS+    +L  TLDGH+  
Sbjct: 420 TFTAAERIQFNC-------LAADPSGEVVCAGSVDSFAIHVWSVQTG-QLVETLDGHEGP 471

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           V   +FS +++ L +AS D  +R+W +  R
Sbjct: 472 VSCLSFSRENSVLASASWDKTIRVWSIFGR 501

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 95/235 (40%), Gaps = 8/235 (3%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L+    +   R +E       + +    + VN + + N  + LA    +  +L      
Sbjct: 270 MLIVGFNNGEFRLYELPGFTLLQQLSMGQNAVNAVSVNNTGEWLAFGSSKLGQLLVYEWQ 329

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEV 122
           + + +   +GH     +V++  D   +VT+SEDG IK+WDV S      ++ H + V  +
Sbjct: 330 SESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTSAVTGL 389

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKG- 181
                   L S   DG +R WDL   +     T  +      L+    G ++ A +    
Sbjct: 390 AFAKKGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSF 449

Query: 182 NCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236
             +VW +         + V     H   ++ +  S +   LA+ S D T RVWSI
Sbjct: 450 AIHVWSVQTG------QLVETLDGHEGPVSCLSFSRENSVLASASWDKTIRVWSI 498

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/333 (20%), Positives = 116/333 (34%), Gaps = 74/333 (22%)

Query: 20  LTGVCSRTIQH---SDSQVNRLEITNDKKLLATAGHQNVRLYDI-RTTNPNPVASF---- 71
           L    ++T+ H      +V  L+ + D KL A A  + V+++           A F    
Sbjct: 81  LVNFRAKTVLHHLNFKEKVRDLKFSPDGKLFALACGRFVQVWKTPEVAEDRQFAPFVRYR 140

Query: 72  --EGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSP----SIPRNYKHNAPVNEVVIH 125
              GH  ++ S+++ QD+R++V++S+D T ++W + S     +      H   V      
Sbjct: 141 VHAGHFSDIISLTWSQDSRFLVSTSKDLTARIWSLDSEEKDLASVTFAGHRDYVMGAFFS 200

Query: 126 PNQGELISCDRDGNIRIWDL----GENQCTHQLTPEDDTSLQS----------------- 164
            +Q  + +  +DG +  W+     G      +   E D SL S                 
Sbjct: 201 SDQERIYTVSKDGAVFQWEYTIRPGYEALGEEPETEIDPSLYSWRITKKNYFYASQARVK 260

Query: 165 -LSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKP------------------------ 199
            ++  +  +ML      G   ++E+P  T    L                          
Sbjct: 261 CVTFHAKSNMLIVGFNNGEFRLYELPGFTLLQQLSMGQNAVNAVSVNNTGEWLAFGSSKL 320

Query: 200 -------------VTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        + K + H      +  S D   + T S D   ++W +   F L  T 
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCL-VTF 379

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
             H   V   AF+     L +AS D  VR WDL
Sbjct: 380 QEHTSAVTGLAFAKKGQVLFSASLDGTVRAWDL 412

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/320 (20%), Positives = 126/320 (39%), Gaps = 66/320 (20%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVA-SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWD- 103
           L++T+     R++ + +   +  + +F GHR  V    F  D   + T S+DG +  W+ 
Sbjct: 161 LVSTSKDLTARIWSLDSEEKDLASVTFAGHRDYVMGAFFSSDQERIYTVSKDGAVFQWEY 220

Query: 104 -VR--------------SPSI------PRNYKH--NAPVNEVVIHPNQGELISCDRDGNI 140
            +R               PS+       +NY +   A V  V  H     LI    +G  
Sbjct: 221 TIRPGYEALGEEPETEIDPSLYSWRITKKNYFYASQARVKCVTFHAKSNMLIVGFNNGEF 280

Query: 141 RIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK----------GNCYVWEMPN 190
           R+++L       QL+   + ++ ++S+ + G  LA  ++K             Y+ +   
Sbjct: 281 RLYELPGFTLLQQLSMGQN-AVNAVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQG 339

Query: 191 HTDASH---LKP------------------------VTKFRAHSTYITRILLSSDVKHLA 223
           H DA++     P                        +  F+ H++ +T +  +   + L 
Sbjct: 340 HFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTSAVTGLAFAKKGQVLF 399

Query: 224 TCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASS-DHY-VRLWDLST 281
           + S D T R W +   ++   T    +R  ++C  +  S  +V A S D + + +W + T
Sbjct: 400 SASLDGTVRAWDLVR-YRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAIHVWSVQT 458

Query: 282 REIVRQYGGHHKGAVCVALN 301
            ++V    GH     C++ +
Sbjct: 459 GQLVETLDGHEGPVSCLSFS 478

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 73/159 (45%), Gaps = 4/159 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           +L SA  D T+R W+ +     RT   ++  Q N L      +++      +  ++    
Sbjct: 397 VLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAIHVWSV 456

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV--RSPSIPRNYKHNAPVN 120
                V + +GH G V+ +SF ++N  + ++S D TI+VW +  RS  +    +  A V 
Sbjct: 457 QTGQLVETLDGHEGPVSCLSFSRENSVLASASWDKTIRVWSIFGRSQQV-EPLEVYADVL 515

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD 159
            + + P+  E+ +   DG +  +D+ E +    +  + D
Sbjct: 516 SIAVRPDGNEVAASTLDGQVLFFDINEGKQVGAIDGKKD 554

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 113/254 (44%), Gaps = 29/254 (11%)

Query: 59  DIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-----IPRNY 113
           DI+   P  V  +EGH   + S+   ++  W+ T S+D T+ +W + + S       R  
Sbjct: 384 DIQNCLPLEVELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFT 443

Query: 114 KHNAPVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQC----THQLTPEDDT--- 160
            H  PV  V + PN         +I+   D  I+ W + +        H +   D T   
Sbjct: 444 GHAGPVTAVGL-PNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRA 502

Query: 161 ---SLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSS 217
               + +LS++ + S+ A A+    C +W    + D+  L+       H   +  +    
Sbjct: 503 HEKDINALSISPNDSVFATASYDKTCKIW----NVDSGELEGT--LANHKRGLWDVTFCQ 556

Query: 218 DVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             K LATCS D T +VWS++    +  TL+GH   V  C+F   +  +V+  +D  +++W
Sbjct: 557 YDKLLATCSGDKTIKVWSLES-MSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVW 615

Query: 278 DLSTREIVRQYGGH 291
           DLST E +R    H
Sbjct: 616 DLSTGECIRTLDAH 629

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 86/228 (37%), Gaps = 25/228 (10%)

Query: 67  PVASFEGHRGNVTSVSFQQDNR-----WMVTSSEDGTIKVWDVRSPSIPRNYKHNAPV-- 119
           P A F GH G VT+V      R     +++T+S D TIK W V  P+      HN  V  
Sbjct: 438 PYARFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSD 497

Query: 120 ----------NEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMAS 169
                     N + I PN     +   D   +IW++   +    L       L  ++   
Sbjct: 498 YTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLA-NHKRGLWDVTFCQ 556

Query: 170 DGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADH 229
              +LA  +      VW + +      +  V     H+  + R    +  K + +  AD 
Sbjct: 557 YDKLLATCSGDKTIKVWSLES------MSVVKTLEGHTNAVQRCSFINRNKQIVSTGADG 610

Query: 230 TARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             +VW +     + T LD H   +W  +  +D    VTA +D   + W
Sbjct: 611 LIKVWDLSTGECIRT-LDAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 80/175 (45%), Gaps = 10/175 (5%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           +  +A YD T + W   +G    T+ +    +  +      KLLAT +G + ++++ + +
Sbjct: 518 VFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLES 577

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNE 121
              + V + EGH   V   SF   N+ +V++  DG IKVWD+ +    R    H+  +  
Sbjct: 578 M--SVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWA 635

Query: 122 VVIHPNQGELISCDRDGNIRIW------DLGENQCTHQLTPEDDTSLQSLSMASD 170
           + +  +  E ++ D DG  + W      +  EN    +L  E + SLQ+     D
Sbjct: 636 LSVLSDGKEFVTADADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGD 690

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 67/148 (45%), Gaps = 17/148 (11%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKH 221
           L SL  + +G  LA  +      +W++  + D+   KP  +F  H+  +T + L + +++
Sbjct: 403 LNSLDSSENGEWLATCSKDHTVILWKL--NADSEKFKPYARFTGHAGPVTAVGLPNVMRN 460

Query: 222 -----LATCSADHTARVWSI----DDDFKL------ETTLDGHQRWVWDCAFSADSAYLV 266
                + T S D T + WS+     +D  +      + T   H++ +   + S + +   
Sbjct: 461 TWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFA 520

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG 294
           TAS D   ++W++ + E+      H +G
Sbjct: 521 TASYDKTCKIWNVDSGELEGTLANHKRG 548

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 84/192 (43%), Gaps = 34/192 (17%)

Query: 27  TIQHSDSQ-VNRLEIT-NDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQ 84
           TI++ D Q +  L++T N + L   +  Q +R+Y  + ++   + S +     V+S  + 
Sbjct: 54  TIENDDEQEITALKLTPNGEYLCFVSQAQLLRIY--KLSSKKIIRSMK-----VSSPVYV 106

Query: 85  QD----NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQG----ELISCD 135
            D    +  +     DG++ V D+ +  +  ++K H A ++ V  H  Q      L S D
Sbjct: 107 MDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGD 166

Query: 136 RDGNIRIWDLGENQCTH--------------QLTPEDDTSLQSLSMASDG--SMLAAANT 179
             G +++WDL    C H              +L+P DD  L+ L+   D   ++    +T
Sbjct: 167 TSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPADDGVLELLTGGRDDIVNLFQLNST 226

Query: 180 KGNCYVWEMPNH 191
           K    +  +P H
Sbjct: 227 KKAKLMRTIPVH 238

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 138/301 (45%), Gaps = 38/301 (12%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +LVSA  D T+  W+ LTG      V  R+ +     V  + +T D    L+ +  + +R
Sbjct: 32  LLVSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+D+ T        F GH+G+V SV+  +    +++ S D +IKVW ++   +     HN
Sbjct: 91  LWDVATGET--YQRFVGHKGDVMSVAIDRKASMIISGSRDKSIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             V++V + P + E      +IS   D  ++ W+L + Q         + ++ +++ + D
Sbjct: 149 DWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNLNQFQIEADFVGH-NANVNTITASPD 207

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHT 230
           G+++A+A+  G   +W + N T      P+    A    +  +  S +   LA  +A   
Sbjct: 208 GTLIASADKSGEIMLWNLHNKT------PMYTLNAQDE-VFAVAFSPNRYWLAAATASGI 260

Query: 231 ARVWSID-----DDFKLE-----TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
            +++S+D     DD + E        D H       A+SAD   L    +D+ +R+W + 
Sbjct: 261 -KIFSLDPEALIDDLRPEFVGYNKAADPHAI---SLAWSADGQTLFAGYTDNVIRVWQVM 316

Query: 281 T 281
           T
Sbjct: 317 T 317

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 102/225 (45%), Gaps = 24/225 (10%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  +V++S D T+  W    D +   +P R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +V + P+    +S   D  +R+WD+   + T+Q        + S+++    SM+ + +  
Sbjct: 70  DVTLTPDGAYALSASWDKTLRLWDVATGE-TYQRFVGHKGDVMSVAIDRKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSS------DVKHLATCSADHTARVW 234
            +  VW +     A+ L        H+ +++++ ++       D   + +   D   + W
Sbjct: 129 KSIKVWTIKGQCLATLL-------GHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAW 181

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +++  F++E    GH   V     S D   + +A     + LW+L
Sbjct: 182 NLNQ-FQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWNL 225

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHL-ATCSADHTARVWSI-DDDFKLET---TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +  DD K      +  GH   V D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDVT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            + D AY ++AS D  +RLWD++T E  +++ GH    + VA++
Sbjct: 73  LTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAID 116

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 78/189 (41%), Gaps = 19/189 (10%)

Query: 115 HNAPVNEVVIHPNQGEL-ISCDRDGNIRIWDL-GENQ---CTHQLTPEDDTSLQSLSMAS 169
           HN  V  +     Q  L +S  RD  +  W L G++Q      +        +Q +++  
Sbjct: 16  HNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDVTLTP 75

Query: 170 DGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADH 229
           DG+   +A+      +W      D +  +   +F  H   +  + +      + + S D 
Sbjct: 76  DGAYALSASWDKTLRLW------DVATGETYQRFVGHKGDVMSVAIDRKASMIISGSRDK 129

Query: 230 TARVWSIDDDFKLETTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTRE 283
           + +VW+I    +   TL GH  WV     +       D+  +++A +D  V+ W+L+  +
Sbjct: 130 SIKVWTIKG--QCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNLNQFQ 187

Query: 284 IVRQYGGHH 292
           I   + GH+
Sbjct: 188 IEADFVGHN 196

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 105/238 (44%), Gaps = 16/238 (6%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD++   I    + H+  V  +   P+  +L+S   
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSG 445

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 446 DRTVRIWDLKTGQCSLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVWDSETGFLVER 504

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKL------------- 242
           L    +    H   +  ++ + D   + + S D + ++W++ D+                
Sbjct: 505 LDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKSNATC 564

Query: 243 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           + T  GH+ +V     +A+  Y+++ S D  V  WD  +   +    GH    + VA+
Sbjct: 565 DVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 622

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 440 LVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETG 499

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
                  + N + +  GH+ +V SV F +D   +V+ S D ++K+W++R
Sbjct: 500 FLVERLDSENELGT--GHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLR 546

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQ 426

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 82.4 bits (202), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 143/336 (42%), Gaps = 58/336 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++AT    N +RL+D +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKTG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
                A   GH   +TS+S++            + +SS+DGTIK+WD  S      Y  +
Sbjct: 219 ECLGDA-LRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC--QYTMS 275

Query: 117 APVNEV--VIHPNQGELISCDRDGNIRIWDL-GENQCTHQL------------------- 154
              N V  V    QG L S   D  +R+WD+  + +C + L                   
Sbjct: 276 GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALR 335

Query: 155 ------------TPED--DTSLQSLSM-----ASDGSMLAAANTKGNCYVWEMPNHTDAS 195
                       TPED    +L++         +   M+  A+     ++W     T   
Sbjct: 336 VGAFDHTGKRPSTPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKST--- 392

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
             KPV +   H   +  +  S D +++ + S D++ ++W    D K  +T  GH   V+ 
Sbjct: 393 --KPVARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFISTFRGHVASVYQ 449

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            A+S+D   LV+ S D  +++WD+ TR++     GH
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L S+  D TI+ W+ ++ VC  T+    + V+ ++      L + +  + VR++DI +  
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQG 310

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              +   + H   V  +S   D    V + +         + PS P + +  A  N   I
Sbjct: 311 -RCINILKSHAHWVNHLSLSTDYALRVGAFDHTG------KRPSTPEDAQKKALENYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
               G     +++   D  + +W+ L   +   ++T      +  ++ + DG  + +A+ 
Sbjct: 364 CKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H   + ++  SSD + L +CS D T +VW +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D T+  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 MMVTASDDFTMFLWNPLKSTKPVARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 6/94 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+   A + + + IL S+   H    + T + D+TAR+W  D    +  TL GH  
Sbjct: 129 VKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMH-TLKGHYN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           WV   ++S D   + T S D+ +RLWD  T E +
Sbjct: 188 WVLCVSWSPDGEVIATGSMDNTIRLWDPKTGECL 221

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAF 258
           P+   + H  ++  +  S D + +AT S D+T R+W       L   L GH +W+   ++
Sbjct: 178 PMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSW 237

Query: 259 S-------ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
                        L ++S D  +++WD  +R       GH     CV
Sbjct: 238 EPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCV 284

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDDDFKLE------TTLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    FK++      + + GH   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + +VT + D+  R+WD  T+  +    GH+   +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVS 193

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 82.4 bits (202), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 102/236 (43%), Gaps = 14/236 (5%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+    I    + H   +  +   P+  +L+S   
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 437

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 438 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVWDSETGFLVER 496

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFK-----------LET 244
           L    +    H   +  ++ + D   + + S D + ++W++  D              E 
Sbjct: 497 LDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEV 556

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    + VA+
Sbjct: 557 TYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAV 612

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 59/136 (43%), Gaps = 6/136 (4%)

Query: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA 205
           G N+ T      D   +  LS  +   + A A +  N    + PN+   S +    K  +
Sbjct: 319 GCNKTTQVFRVSDGALIARLSDDAASQVAAPAGSPANA---DEPNNDVNSFV--TAKSAS 373

Query: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYL 265
              YI  +  S D K LAT + D   R+W I    ++   L GH++ ++   +      L
Sbjct: 374 SDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKK-QIVMVLQGHEQDIYSLDYFPSGDKL 432

Query: 266 VTASSDHYVRLWDLST 281
           V+ S D  VR+WDL T
Sbjct: 433 VSGSGDRTVRIWDLRT 448

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 432 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETG 491

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
                  + N + +  GH+ +V SV F +D   +V+ S D ++K+W++R
Sbjct: 492 FLVERLDSENELGT--GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 538

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD++ ++IV    GH +
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQ 418

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 51/117 (43%), Gaps = 21/117 (17%)

Query: 5   LVSAGYDHTIRFW------------EALTGVCSRT-IQHSDSQVNRLEITNDKKLLATAG 51
           +VS   D +++ W            +   G C  T   H D  ++     ND+ +L+ + 
Sbjct: 523 VVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSK 582

Query: 52  HQNVRLYDIRTTNPNPVASFEGHRGNVTSVS----FQQDNRWMV--TSSEDGTIKVW 102
            + V  +D ++   NP+   +GHR +V SV+    F    ++ V  T S D   ++W
Sbjct: 583 DRGVLFWDTQSG--NPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIW 637

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 128/275 (46%), Gaps = 30/275 (10%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRTT---NPNPVASFE----- 72
           VC  T  +++  +  L+ + D +L+A AG Q+  ++++ +  T   +  P  S E     
Sbjct: 463 VCMYTFHNTNRDMTSLQFSEDSRLVA-AGFQDSHIKIWSLDGTPLESKLPSKSKEASNTT 521

Query: 73  ---GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQ 128
              GH G V SVSF  DNR++V++SED T+++W + + +   +YK HN PV +V   P  
Sbjct: 522 TLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLG 581

Query: 129 GELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAANTKGNCY 184
               +   D   R+W      C H    ++       +  ++   +G+ +   ++   C 
Sbjct: 582 HYFATVSHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCR 636

Query: 185 VWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLET 244
           +W++    D+  L     F  H+  +  + +S D + L T S D    VW I    +++ 
Sbjct: 637 MWDI-QTGDSVRL-----FLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQ 690

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
                +  V   +F+ +   LV+  +D  VR+WDL
Sbjct: 691 MRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 97/205 (47%), Gaps = 4/205 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           LVSA  D T+R W   T  C  + +  +  V  ++ +      AT  H Q  RL+     
Sbjct: 542 LVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHI 601

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  V+F  +  +++T S D T ++WD+++    R +  H A V  V
Sbjct: 602 YP--LRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV 659

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+     +++ SLS   +G++L +     +
Sbjct: 660 AVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQS 719

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHS 207
             VW++   T+   L+P   +  +S
Sbjct: 720 VRVWDLKKFTNEPALEPEQPYSGYS 744

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 109/262 (41%), Gaps = 33/262 (12%)

Query: 55  VRLYDIRTTNPNPVASFEGHRGN--VTSVSFQQDNRWMVTSSEDGTIKVWDV-RSP---S 108
           ++L +++T+ P+ V  +  H  N  +TS+ F +D+R +    +D  IK+W +  +P    
Sbjct: 451 IKLDNLQTSAPS-VCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESK 509

Query: 109 IPRNYK----------HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT--- 155
           +P   K          H+ PV  V   P+   L+S   D  +R+W L    C        
Sbjct: 510 LPSKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHN 569

Query: 156 -PEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL 214
            P  D     L     G   A  +      +W         H+ P+  F  H   +  + 
Sbjct: 570 HPVWDVKFSPL-----GHYFATVSHDQTARLWS------CDHIYPLRIFAGHLNDVDCVA 618

Query: 215 LSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
              +  ++ T S+D T R+W I     +   L GH   V   A S D  +L T S D  +
Sbjct: 619 FHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFL-GHTASVVSVAVSPDGRWLTTGSEDGVI 677

Query: 275 RLWDLSTREIVRQYGGHHKGAV 296
            +WD+ T + ++Q  GH K AV
Sbjct: 678 IVWDIGTGKRIKQMRGHGKSAV 699

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 60/146 (41%), Gaps = 8/146 (5%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTK-------FRAHSTYITRIL 214
           + SL  + D  ++AA     +  +W +      S L   +K          HS  +  + 
Sbjct: 475 MTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHSGPVYSVS 534

Query: 215 LSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
            S D ++L + S D T R+WS+D  F    +  GH   VWD  FS    Y  T S D   
Sbjct: 535 FSPDNRYLVSASEDKTVRLWSLDT-FTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTA 593

Query: 275 RLWDLSTREIVRQYGGHHKGAVCVAL 300
           RLW       +R + GH     CVA 
Sbjct: 594 RLWSCDHIYPLRIFAGHLNDVDCVAF 619

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 105/235 (44%), Gaps = 13/235 (5%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+    I    + H   +  +   P+  +L+S   
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 524

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 525 DRTVRIWDLRNGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 583

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSI----DDDFK------LETT 245
           L    +    H   +  ++ + D  ++ + S D + ++W++    + D K       E T
Sbjct: 584 LDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVT 643

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
             GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    + VA+
Sbjct: 644 YTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 698

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 70/160 (43%), Gaps = 22/160 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+   G CS T+   D          D K +A     + VR++D  T 
Sbjct: 519 LVSGSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 578

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------PSI 109
                  + N + +  GH+ +V SV F +D   +V+ S D ++K+W++R        P++
Sbjct: 579 FLVERLDSENELGT--GHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNV 636

Query: 110 PRNYK-----HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
           P   +     H   V  V    N   ++S  +D  +  WD
Sbjct: 637 PGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 676

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD++ ++IV    GH +
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQ 505

>Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa]
           {ON} YIL046W (MET30) - Met30p contains five copies of
           WD40 motif and interacts with and regulates Met4p
           [contig 11] FULL
          Length = 627

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 126/299 (42%), Gaps = 18/299 (6%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R +      V  +   + +KL+  +  + +R+++  T 
Sbjct: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTG 387

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               VA++ GH  +V SV   +  + +V+ S D T+KVW V S +      H   V  V 
Sbjct: 388 AC--VAAYPGHSDSVLSVDSYK--KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNC 183
           +HP      S   D  IR+WD+  N C            + L +    ++L   N   + 
Sbjct: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPL----TILDTENLVTDR 499

Query: 184 YVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLE 243
                 N    +   P  +  A    +          HL +CS D+T ++W +     + 
Sbjct: 500 TSDPPRNEATTAQDPPDGQLSALDDSLPY------PSHLLSCSLDNTIKLWEVRTGKCVR 553

Query: 244 TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
           T   GH   +WD A  AD+  +V+ + D  V++WDL + + +  +  H     CV + D
Sbjct: 554 THF-GHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGD 609

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 103/266 (38%), Gaps = 53/266 (19%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V S+ F  + R + T S D T+ +WD+ +  + R    +    + +    
Sbjct: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDG 367

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
           Q +LI+   D  IR+W+     C        D+ L   S+ S   ++ + +      VW 
Sbjct: 368 Q-KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL---SVDSYKKIIVSGSADKTVKVWH 423

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
           + + T           R H+ ++  + L        + S D T R+W I  +  ++    
Sbjct: 424 VESRT-------CYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKV-FR 475

Query: 248 GHQRWVW---------------------------------DCAFSA--DS----AYLVTA 268
           GH   V                                  D   SA  DS    ++L++ 
Sbjct: 476 GHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSC 535

Query: 269 SSDHYVRLWDLSTREIVRQYGGHHKG 294
           S D+ ++LW++ T + VR + GH +G
Sbjct: 536 SLDNTIKLWEVRTGKCVRTHFGHVEG 561

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDV 104
           LL+ +    ++L+++RT           H G+V  +     DN  +V+ + D T+KVWD+
Sbjct: 532 LLSCSLDNTIKLWEVRTGK-----CVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDL 586

Query: 105 RSPSIPRNY-KHNAPVNEVVIHPNQGELISCDRDGNIRI 142
           +S      +  H AP+  V I     E +S D  G +++
Sbjct: 587 QSGKCIHTFDSHQAPITCVGI--GDSEFVSGDELGCVKV 623

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 7/98 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+S   D+TI+ WE  TG C RT  H        +I  D   + +  H + V+++D+++ 
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRT--HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKV 101
               + +F+ H+  +T V         V+  E G +KV
Sbjct: 590 --KCIHTFDSHQAPITCVGIGDSE--FVSGDELGCVKV 623

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 127/283 (44%), Gaps = 27/283 (9%)

Query: 40  ITNDK-KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRW 89
           IT+ K +L+ T  +  +  Y I       T+P P+ +     +G R ++ S+    DNR 
Sbjct: 346 ITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRL 405

Query: 90  MVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149
           + T+S +G++K+W+V++    R ++    +    + P    +I   R+G ++++DL  + 
Sbjct: 406 LATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRNGELQLFDLASSS 463

Query: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTK 202
               +    D ++ SL + SDG  L   +       W+       +P   D     P+ K
Sbjct: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KFLPILK 521

Query: 203 FRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257
               +T      I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V    
Sbjct: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSID 580

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            S DS  ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/309 (19%), Positives = 127/309 (41%), Gaps = 68/309 (22%)

Query: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87
           +Q   + +  ++I++D +LLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 387 LQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442

Query: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             ++  + +G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502

Query: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190
             EN              +  H  T E +  + SL ++ D   LA +       V+ + +
Sbjct: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS 562

Query: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID------------- 237
                 +K       H   +  I +S D K + T SAD   ++W +D             
Sbjct: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616

Query: 238 ----------------------------DDFKLETTLDGHQRWVWDCAFSADSAYLVTAS 269
                                       + F+    L  HQ  VW  A S D +++V++S
Sbjct: 617 SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSS 676

Query: 270 SDHYVRLWD 278
            DH +R+W+
Sbjct: 677 HDHSIRIWE 685

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELND 532

Query: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135
           ++ S+    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 533 DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDGTGTRLI 137

Query: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149
           + S+D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL   Q
Sbjct: 138 SGSKDSNIIVWDLVGE--VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQ 195

Query: 150 C 150
           C
Sbjct: 196 C 196

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 11/125 (8%)

Query: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96
           L T+  +NV ++DI+T +         P   +   G +    T +   QD   +     D
Sbjct: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100

Query: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155
           G IKVWD+ S ++  N+  H A +  +        LIS  +D NI +WDL      ++L 
Sbjct: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLR 160

Query: 156 PEDDT 160
              D+
Sbjct: 161 SHKDS 165

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633

Query: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q 
Sbjct: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 76/205 (37%), Gaps = 27/205 (13%)

Query: 90  MVTSSEDGTIKVWDVRSPSIPRNYKHNAP-------------VNEVVIHPNQGELISCDR 136
           ++TS+ +  + VWD+++  +        P                + +H +   L     
Sbjct: 41  LITSALE-NVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYA 99

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           DG I++WDL               ++  L     G+ L + +   N  VW++        
Sbjct: 100 DGVIKVWDLMSKTVLLNFNGHK-AAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVG--- 155

Query: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256
              + K R+H   IT      +   L + S D   ++W    D K +  ++ H     +C
Sbjct: 156 ---LYKLRSHKDSITGFWCQGE-DWLISTSKDGMIKLW----DLKTQQCIETHIAHTGEC 207

Query: 257 -AFSADSAYLVTASSDHYVRLWDLS 280
              S     L+T  +D  V+LW L+
Sbjct: 208 WGLSVKDDLLITTGTDSQVKLWKLN 232

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/337 (24%), Positives = 142/337 (42%), Gaps = 60/337 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D +L+AT    N +RL++ +  
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGSMDNTIRLWEGKNG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSIPRNYKH 115
            P   A   GH+  +TS+S++        +   + TSS+DGTIKVWD  R   +   Y  
Sbjct: 219 KPFGEA-MRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRVCL---YTL 274

Query: 116 NAPVNEV--VIHPNQGELISCDRDGNIRIWDLG-ENQCTHQLT----------------- 155
           +  VN V  V    +  L S   D  +R+WD+    +C + L                  
Sbjct: 275 SGHVNSVSCVKWGGKNLLYSGSHDKTVRVWDMNLGGKCINILKSHAHWVNHLSLSTDYAL 334

Query: 156 ---PEDDTSLQSLSM------------------ASDGSMLAAANTKGNCYVWEMPNHTDA 194
              P D T +   +                    SD  ++  A+     ++W     T  
Sbjct: 335 RVGPFDHTGIMPATPEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKST-- 392

Query: 195 SHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVW 254
              KP+++   H   +  +  S D +++ + S D++ ++W    D K  TT  GH   V+
Sbjct: 393 ---KPISRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-SRDGKFITTFRGHVASVY 448

Query: 255 DCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
             A+S+D   L + S D  +++WD+ T+++     GH
Sbjct: 449 QVAWSSDCRLLASCSKDTSLKVWDIRTKKLSVDLPGH 485

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 103/278 (37%), Gaps = 59/278 (21%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVRLYDIR 61
           +L S  +D T+R W+  L G C   ++     VN L ++ D  L +    H  +      
Sbjct: 291 LLYSGSHDKTVRVWDMNLGGKCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPE 350

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIP--RNYKHNAPV 119
                 + ++E       +     D   MVT+S+D T+ +W+    + P  R   H   V
Sbjct: 351 EARAKALKNYEK-----VAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLV 405

Query: 120 NEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
           N V   P                                           DG  + +A+ 
Sbjct: 406 NHVAFSP-------------------------------------------DGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D+   K +T FR H   + ++  SSD + LA+CS D + +VW I   
Sbjct: 423 DNSIKLW------DSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDTSLKVWDIRTK 476

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH   V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHLDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV----W 254
           P+     H+ ++  +  S D + +AT S D+T R+W   +       + GHQ+W+    W
Sbjct: 178 PMVTLSGHTNWVLCVAWSPDGELIATGSMDNTIRLWEGKNGKPFGEAMRGHQKWITSLSW 237

Query: 255 D---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +      + +   L T+S D  +++WD   R  +    GH     CV
Sbjct: 238 EPLHLVKAGERPKLATSSKDGTIKVWDTGRRVCLYTLSGHVNSVSCV 284

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           S+ +VT + D+  R+WD  T+  +    GH    +CVA
Sbjct: 156 SSRMVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVA 193

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 124/277 (44%), Gaps = 26/277 (9%)

Query: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 352 ELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS- 410

Query: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155
           +G++K+W+V++    R ++    ++   + P    +I   R G ++++DL  +     + 
Sbjct: 411 NGSLKIWNVKTHKCIRTFECGYALSCKFL-PGGLLVILGTRTGELQLFDLASSSLLDTVE 469

Query: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208
              D ++ SL + SDG  L   +       W+       +P   D   L P+ K    +T
Sbjct: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTT 527

Query: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263
                 I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586

Query: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 124/290 (42%), Gaps = 28/290 (9%)

Query: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87
           +Q   + V  ++I++D KLLATA + ++++++++T     + +FE   G   S  F    
Sbjct: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALSCKFLPGG 442

Query: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502

Query: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190
             EN              +  H  T E +  + S+ ++ D   LA +       V+ + +
Sbjct: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562

Query: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
             +    F  +S    + S D  V+ WD    E +++   H      +A+
Sbjct: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELND 532

Query: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             + + K  AH + +  + ++S+   + + S DH+ R+W   +D
Sbjct: 646 KFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETED 689

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 73/176 (41%), Gaps = 14/176 (7%)

Query: 38  LEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSED 96
           LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      +++ S D
Sbjct: 85  LEVHEDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRLISGSRD 142

Query: 97  GTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQCTHQ 153
             I VWD V    + +   H   +  +     QGE  LIS  +DG I++WDL   QC   
Sbjct: 143 SNIIVWDLVGEVGLYKLRSHKDCITGIWC---QGEDWLISTSKDGMIKLWDLKTQQCIET 199

Query: 154 LTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE--MPNHTDASHLKPVTKFRAHS 207
                     SLS+  D  +L    T     +W+  M N      L  V  F   S
Sbjct: 200 HIAHTG-ECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQS 252

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633

Query: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           S+D  +K WD  +   I + Y H + V  + I  N   ++S   D +IRIW+  E+Q 
Sbjct: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 59/145 (40%), Gaps = 13/145 (8%)

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           DG I++WDL               ++  L   S G+ L + +   N  VW++        
Sbjct: 100 DGVIKVWDLMSKTVLLNFNGHK-AAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVG--- 155

Query: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256
              + K R+H   IT I    +   L + S D   ++W    D K +  ++ H     +C
Sbjct: 156 ---LYKLRSHKDCITGIWCQGE-DWLISTSKDGMIKLW----DLKTQQCIETHIAHTGEC 207

Query: 257 -AFSADSAYLVTASSDHYVRLWDLS 280
            + S     L+T  +D  V++W L+
Sbjct: 208 WSLSVKDDLLITTGTDSQVKIWKLN 232

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 9/91 (9%)

Query: 189 PNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248
           P  +DA   KP     A  TY+    +  D   LA   AD   +VW +     L    +G
Sbjct: 69  PGASDARGSKP-----AECTYLE---VHEDTDLLAVGYADGVIKVWDLMSKTVL-LNFNG 119

Query: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           H+  +    F +    L++ S D  + +WDL
Sbjct: 120 HKAAITLLQFDSTGTRLISGSRDSNIIVWDL 150

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 137/307 (44%), Gaps = 34/307 (11%)

Query: 26  RTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI-------RTTNPNPVASFEGHRGN- 77
           ++++H+ S V  ++ +ND + LAT  ++  +++ +       R ++ N  +   G  G+ 
Sbjct: 310 KSLEHT-SVVCCVKFSNDGQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSD 368

Query: 78  -------VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQG 129
                  + SV F  D +++ T +ED  I++WD+    I    + H+  V  +   P+  
Sbjct: 369 SGSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGD 428

Query: 130 ELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMP 189
           +L+S   D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+  
Sbjct: 429 KLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSE 487

Query: 190 NHTDASHLKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSID---------DD 239
                  L    +    H   +  ++ + D   + + S D + ++W++          D+
Sbjct: 488 TGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADN 547

Query: 240 FK------LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
            K       E T  GH+ +V     +A+  ++++ S D  V  WD +T   +    GH  
Sbjct: 548 NKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRN 607

Query: 294 GAVCVAL 300
             + VA+
Sbjct: 608 SVISVAV 614

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 99/246 (40%), Gaps = 48/246 (19%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 430 LVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 489

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
                  + N + +  GHR +V SV F +D   +V+SS D ++K+W++R      N K N
Sbjct: 490 FLVERLDSENELGT--GHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRG----YNEKEN 543

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAA 176
           A  N    + +Q  ++                 C        D  L   + A+D  +L+ 
Sbjct: 544 AADN----NKSQSSVV-----------------CEVTYIGHKDFVLSVTTTANDEFVLSG 582

Query: 177 ANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL------LSSDVKHLATCSADHT 230
           +  +G  + W      D +   P+   + H   +  +       L  + +  AT S D  
Sbjct: 583 SKDRGVLF-W------DTNTGNPLLMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCR 635

Query: 231 ARVWSI 236
           AR+W  
Sbjct: 636 ARIWKF 641

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 80.1 bits (196), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 136/298 (45%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +LVSA  D T+  W+ LTG      V  R+ +  +  V    +T D    L+ +  + +R
Sbjct: 31  LLVSASRDKTLISWK-LTGDDQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKTLR 89

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+++ T        F GH+ +V SV+  +    +++ S D TIKVW ++   +     HN
Sbjct: 90  LWNVAT--GETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKGDCLATLLGHN 147

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             V++V + PN+ +      LIS   D  ++ W++ + Q        ++  + S++ + D
Sbjct: 148 DWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNY-INSITASPD 206

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHT 230
           GS++A+A   G+  +W +   T      P+    A        L  S  ++  T +    
Sbjct: 207 GSLVASAGKDGDIMLWNLKQKT------PLYTLSAQDEVFA--LAFSPNRYWLTAATATG 258

Query: 231 ARVWSIDDDF---KLETTLDGHQRWVWDCA----FSADSAYLVTASSDHYVRLWDLST 281
            +V+S++D+    +L+    G+ +     A    +SAD   L    +D  +R+W + T
Sbjct: 259 IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLFAGYTDSIIRVWQVMT 316

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 105/228 (46%), Gaps = 24/228 (10%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  +V++S D T+  W    D +   +P R++K HN  V 
Sbjct: 10  GTLEGHNGWVTSLATSAGQPNL-LVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQ 68

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +  +  +    +S   D  +R+W++   +   + T    + + S+++    SM+ + +  
Sbjct: 69  DCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHK-SDVMSVAIDRKASMIISGSRD 127

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKH------LATCSADHTARVW 234
               VW +     A+ L        H+ +++++ ++ + K       L +  +D   + W
Sbjct: 128 KTIKVWSIKGDCLATLL-------GHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAW 180

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +I+  F++E    GH  ++     S D + + +A  D  + LW+L  +
Sbjct: 181 NINQ-FQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQK 227

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 55/104 (52%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHL-ATCSADHTARVWSI---DDDFKLET-TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +   D  + +   +  GH   V DCA
Sbjct: 12  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCA 71

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            +AD AY ++AS D  +RLW+++T E  +++ GH    + VA++
Sbjct: 72  LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAID 115

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 70/193 (36%), Gaps = 51/193 (26%)

Query: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           V L+SAG D  ++ W                 +N+ +I  D                   
Sbjct: 166 VTLISAGSDKMVKAW----------------NINQFQIEAD------------------- 190

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
                   F GH   + S++   D   + ++ +DG I +W+++  +          V  +
Sbjct: 191 --------FVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFAL 242

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DDTSLQSLSMASDGSMLA 175
              PN+  L +    G I+++ L +     +L PE        +    SL+ ++DG  L 
Sbjct: 243 AFSPNRYWLTAATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLF 301

Query: 176 AANTKGNCYVWEM 188
           A  T     VW++
Sbjct: 302 AGYTDSIIRVWQV 314

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 124/286 (43%), Gaps = 37/286 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRTT------------- 63
           AL  VC  T  +++  +  L+ + D +L+A AG Q+  ++L+ +  +             
Sbjct: 474 ALPSVCMYTFHNTNGGMTSLQFSEDSRLVA-AGFQDSYIKLWSLDGSSLKQIQEKSADSI 532

Query: 64  -----NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNA 117
                N N   +  GH G V S SF  DNR++++ SED T+++W   + +   +YK HN 
Sbjct: 533 NTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNH 592

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSM 173
           PV +V   P      +   D   R+W      C H    ++     + +  +S   +G  
Sbjct: 593 PVWDVQFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDCVSFHPNGCY 647

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
           +   ++   C +W      D S    V  F  H+  +    +S D + LAT S D    +
Sbjct: 648 VFTGSSDKTCRMW------DISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINL 701

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           W I    +L+      +  +   ++  +   LV+  +DH VR+WDL
Sbjct: 702 WDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 98/231 (42%), Gaps = 29/231 (12%)

Query: 70  SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQG 129
           +F    G +TS+ F +D+R +    +D  IK+W +   S+                  Q 
Sbjct: 482 TFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSL-----------------KQI 524

Query: 130 ELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMP 189
           +  S D   +I   D+ +N  T  +      ++ S S + D   L + +      +W   
Sbjct: 525 QEKSAD---SINTGDMNDNTSTTLIG--HSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTD 579

Query: 190 NHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGH 249
            +T       +  ++ H+  +  +  S    + AT S D TAR+WS D  + L     GH
Sbjct: 580 TYTS------LVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRI-FAGH 632

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
              V   +F  +  Y+ T SSD   R+WD+ST + VR + GH    +C A+
Sbjct: 633 LSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAV 683

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 97/221 (43%), Gaps = 5/221 (2%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  ++ +      ATA H Q  RL+     
Sbjct: 564 LLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHI 623

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++WD+ +    R +  H APV   
Sbjct: 624 YP--LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCT 681

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +    +      ++ SLS   +G++L +     +
Sbjct: 682 AVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHS 741

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLA 223
             VW++   T     +P  +F  +   +T   ++ D+K   
Sbjct: 742 VRVWDLKKSTAEPGPEPEEQFVGYIGNLT-ASINQDIKDFG 781

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 111/250 (44%), Gaps = 32/250 (12%)

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS------PSIPRNYKHNAP 118
           P  V  +EGH   + S+    D  WM T+S+D T  VW   S      P + +   H+A 
Sbjct: 376 PINVEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYV-KFIGHSAT 434

Query: 119 VNEVVIHPN---QGE---LISCDRDGNIRIWDLG------ENQCTHQLTPE-----DDTS 161
           V  V + PN   +G    L++   D  I+ W +       E  C      E      +  
Sbjct: 435 VTAVGL-PNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKD 493

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKH 221
           + +L+++ + S+ A A+    C +W++ N    + L        H   +  +      K 
Sbjct: 494 INALAISPNDSIFATASYDKTCKIWDLENGELTATLS------NHKRGLWDVAFCQYDKL 547

Query: 222 LATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST 281
           +ATCS D T ++WS+D  F +  TL+GH   V  C F      LV++ +D  +++WD ST
Sbjct: 548 IATCSGDKTIKIWSLDT-FSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCST 606

Query: 282 REIVRQYGGH 291
            + ++   GH
Sbjct: 607 GDCLKTLDGH 616

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 93/198 (46%), Gaps = 17/198 (8%)

Query: 4   ILVSAGYDHTIRFWE------------ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG 51
            L++A  D TI+ W+             +  V   T +  +  +N L I+ +  + ATA 
Sbjct: 451 FLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATAS 510

Query: 52  H-QNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIP 110
           + +  +++D+   N    A+   H+  +  V+F Q ++ + T S D TIK+W + + S+ 
Sbjct: 511 YDKTCKIWDLE--NGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVM 568

Query: 111 RNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMAS 169
           +  + H   V   +    Q +L+S   DG I+IWD     C   L   D+  + +L+  +
Sbjct: 569 KTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDN-RIWALTEIN 627

Query: 170 DGSMLAAANTKGNCYVWE 187
           DG M+ +A+  G    W+
Sbjct: 628 DGDMIVSADADGVFQFWK 645

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 101/266 (37%), Gaps = 33/266 (12%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF-----QQD 86
           +N L+ T+D   +ATA   +  +   Y+       P   F GH   VT+V       +  
Sbjct: 389 LNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGY 448

Query: 87  NRWMVTSSEDGTIKVWDVRSPSIP-------------RNYKHNAPVNEVVIHPNQGELIS 133
             +++T+S D TIK W +  PS                   H   +N + I PN     +
Sbjct: 449 PEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFAT 508

Query: 134 CDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD 193
              D   +IWDL   + T  L+      L  ++      ++A  +      +W +   + 
Sbjct: 509 ASYDKTCKIWDLENGELTATLS-NHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSV 567

Query: 194 ASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW--SIDDDFKLETTLDGHQR 251
              L+       H+  + R +  +    L +  AD   ++W  S  D  K   TLDGH  
Sbjct: 568 MKTLE------GHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLK---TLDGHDN 618

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLW 277
            +W      D   +V+A +D   + W
Sbjct: 619 RIWALTEINDGDMIVSADADGVFQFW 644

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 64/149 (42%), Gaps = 18/149 (12%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYIT-----RILLS 216
           L SL    DG  +A A+      VW+   ++  +  +P  KF  HS  +T      ++L 
Sbjct: 389 LNSLDTTDDGLWMATASKDHTAIVWKY--NSIINKFQPYVKFIGHSATVTAVGLPNVMLR 446

Query: 217 SDVKHLATCSADHTARVWSI-------DDDFKL----ETTLDGHQRWVWDCAFSADSAYL 265
              + L T S D T + W I       ++D ++    E T   H++ +   A S + +  
Sbjct: 447 GYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIF 506

Query: 266 VTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            TAS D   ++WDL   E+      H +G
Sbjct: 507 ATASYDKTCKIWDLENGELTATLSNHKRG 535

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 8/112 (7%)

Query: 96  DGTIKVWDVRSPSIPRNYK-HNAPVNEVVI----HPNQGELISCDRDGNIRIWDLGENQC 150
           DG+I V D+ +  I  + K H A ++ +      + N   L S D +G +++WDL + +C
Sbjct: 127 DGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKC 186

Query: 151 THQLTPEDDTSLQSLSMASDGS--MLAAANTKGNCYVWEMPNHTDASHLKPV 200
            H +  E   +++ L +   G    L +      C +W        + LK +
Sbjct: 187 LHTM-QEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTI 237

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 128/287 (44%), Gaps = 38/287 (13%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLY------------------ 58
           AL  VC  T Q+++  ++ L+ ++D ++ A AG Q+  ++++                  
Sbjct: 451 ALPSVCMYTFQNTNKDMSCLDFSDDCRI-AAAGFQDSYIKIWSLDGSSLNNPNIMPNINN 509

Query: 59  -DIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HN 116
            D +  +     +  GH G V + SF  DN+++++ SED T+++W + + +   +YK HN
Sbjct: 510 SDHKDADDPTCKTLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 569

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGS 172
            PV +V   P      +   D   R+W      C H    ++       +  +S   +G 
Sbjct: 570 HPVWDVNFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGC 624

Query: 173 MLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTAR 232
            +   ++   C +W      D S    V  F  H+  +  I +S D + L+T S D    
Sbjct: 625 YVFTGSSDKTCRMW------DVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIIN 678

Query: 233 VWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +W I    +L+      +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 679 IWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 90/201 (44%), Gaps = 4/201 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  +  +      ATA H Q  RL+     
Sbjct: 542 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 601

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++WDV +    R +  H APV  +
Sbjct: 602 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICI 659

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I IWD+G  +   Q+      ++ SLS + +G++L +     +
Sbjct: 660 AVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 719

Query: 183 CYVWEMPNHTDASHLKPVTKF 203
             VW++   T     +P   F
Sbjct: 720 VRVWDLKKATTEPSAEPEEPF 740

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 7/135 (5%)

Query: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225
           S + D   L + +      +W M  HT       +  ++ H+  +  +  S    + AT 
Sbjct: 534 SFSPDNKYLLSGSEDKTVRLWSMDTHT------ALVSYKGHNHPVWDVNFSPLGHYFATA 587

Query: 226 SADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S D TAR+WS D  + L     GH   V   +F  +  Y+ T SSD   R+WD+ST + V
Sbjct: 588 SHDQTARLWSCDHIYPLRI-FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSV 646

Query: 286 RQYGGHHKGAVCVAL 300
           R + GH    +C+A+
Sbjct: 647 RLFLGHTAPVICIAV 661

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           TL GH   V+  +FS D+ YL++ S D  VRLW + T   +  Y GH+
Sbjct: 522 TLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 569

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 102/237 (43%), Gaps = 15/237 (6%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+    I    + H   +  +   P+  +L+S   
Sbjct: 439 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 498

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S+  DG  +AA +      VW+         
Sbjct: 499 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLG-DGKYIAAGSLDRAVRVWDAETGFLVER 557

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD------------FKLE 243
           L    +    H   +  ++ + D   + + S D + ++W++                  E
Sbjct: 558 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQNNTNAETKPAPGTCE 617

Query: 244 TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    + VA+
Sbjct: 618 VTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 674

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 65/157 (41%), Gaps = 17/157 (10%)

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           N GE ++   +   +++ + +     +L+  DD + Q     S G+     N   N +  
Sbjct: 372 NDGEYLATGCNKTTQVFRVSDGALVARLS--DDNATQGPQGPSGGTSDDDYNNDANSFAN 429

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                         T+  +   YI  +  S D K LAT + D   R+W I    K+   L
Sbjct: 430 --------------TRTASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQK-KIVMVL 474

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
            GH++ ++   +      LV+ S D  VR+WDL T +
Sbjct: 475 QGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQ 511

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 493 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETG 552

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106
                  + N + +  GH+ +V SV F +D   +V+ S D ++K+W++ S
Sbjct: 553 FLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSS 600

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD++ ++IV    GH +
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQ 479

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 16/92 (17%)

Query: 5   LVSAGYDHTIRFW-------------EALTGVCSRTIQ-HSDSQVNRLEITNDKKLLATA 50
           +VS   D +++ W             +   G C  T   H D  ++     ND+ +L+ +
Sbjct: 584 VVSGSLDRSVKLWNLSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGS 643

Query: 51  GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVS 82
             + V  +D ++   NP+   +GHR +V SV+
Sbjct: 644 KDRGVLFWDTKSG--NPLLMLQGHRNSVISVA 673

>TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON}
           Anc_7.231 YIL046W
          Length = 574

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 126/300 (42%), Gaps = 41/300 (13%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  +G   R +      +  L   ++ KL+  +  + +R++D +  
Sbjct: 252 LLFTGSYDSTIAIWDLYSGKLIRRLNGHSDGIKTLYF-DENKLITGSLDKTIRVWDYK-- 308

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               +++++GH  ++ SV   +  + +V+ S D ++KVW +   +      H   VN V 
Sbjct: 309 GGRCISTYKGHSDSILSVDCYK--KLIVSGSADCSVKVWHIERRTCYTLKGHTEWVNCVK 366

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMASDGSM 173
           +HP      S   D  IR+WDL  N+C            ++ P     ++ L +  +   
Sbjct: 367 LHPTSFSCFSASDDCTIRMWDLRSNKCLKVFKGHVGQVQKVIPLSIKDIEGLVVDDEVQS 426

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
            A+A +             D     P+     + T            HL +CS D+T ++
Sbjct: 427 SASAQSTA-----------DEPCDDPLDTSIPYPT------------HLLSCSLDNTIKL 463

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           W +     + T   GH   VWD A  AD+  +V+ S D  V++WDL +      + G  +
Sbjct: 464 WDVYTGKCVRTQF-GHVEGVWDIA--ADNFRIVSGSHDGCVKVWDLQSGRCTNSFQGTQR 520

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 88/227 (38%), Gaps = 62/227 (27%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V ++ F  + R + T S D TI +WD+ S  + R    H+  +  +    
Sbjct: 233 IREFKGHMDGVLTLQF--NYRLLFTGSYDSTIAIWDLYSGKLIRRLNGHSDGIKTLYFDE 290

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           N+  LI+   D  IR+WD    +C                                    
Sbjct: 291 NK--LITGSLDKTIRVWDYKGGRC------------------------------------ 312

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDV--KHLATCSADHTARVWSIDDDFKLET 244
                        ++ ++ HS  I    LS D   K + + SAD + +VW I+   +   
Sbjct: 313 -------------ISTYKGHSDSI----LSVDCYKKLIVSGSADCSVKVWHIER--RTCY 353

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           TL GH  WV        S    +AS D  +R+WDL + + ++ + GH
Sbjct: 354 TLKGHTEWVNCVKLHPTSFSCFSASDDCTIRMWDLRSNKCLKVFKGH 400

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
           LL+ +    ++L+D+ T     V +  GH   V  ++   DN  +V+ S DG +KVWD++
Sbjct: 452 LLSCSLDNTIKLWDVYTGKC--VRTQFGHVEGVWDIA--ADNFRIVSGSHDGCVKVWDLQ 507

Query: 106 SPSIPRNYKHNAPVNE 121
           S     +++    V E
Sbjct: 508 SGRCTNSFQGTQRVEE 523

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/336 (24%), Positives = 146/336 (43%), Gaps = 58/336 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +++   D+T R W+  T     T++   + V  +  + D +L+AT    N +RL++    
Sbjct: 159 MITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQ--------QDNRWMVTSSEDGTIKVWDV-RSPSIPRNYK 114
            P   A   GH   +TS+S++        Q  R + ++S+DGTIK+WD  R   +     
Sbjct: 219 QPVGDA-LRGHGKWITSLSWEPIHLVKPGQKPR-LASASKDGTIKIWDTTRRVCLITLSG 276

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDLG-ENQCTHQL------------------- 154
           H + V+  +    QG L S   D  IR WD+    +C + L                   
Sbjct: 277 HTSSVS-CIKWGGQGVLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALR 335

Query: 155 ------------TPED--DTSLQSLSMASDGS-----MLAAANTKGNCYVWEMPNHTDAS 195
                       TPE+    +L++    +  +     ++  A+     Y+W     T   
Sbjct: 336 IGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKST--- 392

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
             KP+T+   H   +  +  S D +H+ + S D++ ++W+   D K  +T  GH   V+ 
Sbjct: 393 --KPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWN-GRDGKFISTFRGHVASVYQ 449

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            A+S+D   LV+ S D  +++WD+ T+++     GH
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGH 485

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 109/280 (38%), Gaps = 63/280 (22%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           +L S  +D TIR W+  L G C   ++     VN L ++ D  L   A       +D  +
Sbjct: 291 VLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGA-------FDHTS 343

Query: 63  TNPN-PVASFEGHRGNVTSVSFQQDN--RWMVTSSEDGTIKVWDVRSPSIP--RNYKHNA 117
             P+ P  + +    N   ++ +       MVT+S+D T+ +W+    + P  R   H  
Sbjct: 344 EKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQK 403

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAA 177
            VN V   P+   ++S   D +I++W+                         DG      
Sbjct: 404 LVNHVAFSPDGRHIVSASFDNSIKLWN-----------------------GRDG------ 434

Query: 178 NTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID 237
                               K ++ FR H   + ++  SSD + L +CS D T +VW + 
Sbjct: 435 --------------------KFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 474

Query: 238 DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
              KL   L GH+  V+   +S D   + +   D  VRLW
Sbjct: 475 TK-KLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV----W 254
           P++  + H  ++  +  S D + +AT S D+T R+W  +    +   L GH +W+    W
Sbjct: 178 PMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSW 237

Query: 255 D---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +            L +AS D  +++WD + R  +    GH     C+
Sbjct: 238 EPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCI 284

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 6/87 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+   A + + + IL S+   H    + T + D+TAR+W  +    + +TL GH  
Sbjct: 129 VKPVTRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPM-STLKGHFN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWD 278
           WV   ++S D   + T S D+ +RLW+
Sbjct: 188 WVLCVSWSPDGELIATGSMDNTIRLWE 214

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 7/93 (7%)

Query: 214 LLSSDVKHLATCSADHTARVWSIDDDFKLE------TTLDGHQRWVWDCAFSA-DSAYLV 266
           L +S +K     + D    V++    FK++      + + GH   +   AF+   S+ ++
Sbjct: 101 LYNSILKPGLKTTEDFITLVYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMI 160

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           T + D+  R+WD +T+  +    GH    +CV+
Sbjct: 161 TGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVS 193

>KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {ON}
           Anc_2.663 YKL021C
          Length = 381

 Score = 80.1 bits (196), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 129/273 (47%), Gaps = 30/273 (10%)

Query: 35  VNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQD----NRWM 90
           V  L+I+  + L++ +  +++R+YD++      + +   H+G++T++ F ++    N+W+
Sbjct: 44  VKTLDISK-RYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITALKFSKNEASTNKWL 100

Query: 91  VTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149
           +++SED  I +W V+        K H   +N++ IHP+    IS   D +IR+W+L    
Sbjct: 101 LSASEDKKIIIWRVKDWENYGTLKGHTGRINDLDIHPSSRIAISVSEDHSIRLWNL---- 156

Query: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNH-----TDASHLKPVTKFR 204
               +T +    L+    + +G  +    + G+ +   + N      T  + +     F+
Sbjct: 157 ----MTVKKAAVLKLRGYSQNGQFVRWLGSSGDFFAVALLNKVLIYTTATAKVHSEIDFK 212

Query: 205 AHSTYITRILLSSDVKHLATCSADHTARVWSID-------DDFKLETTLDGHQRWVWDCA 257
               ++ +++L ++ ++L    +D     +          +DFK E +L GH   V D  
Sbjct: 213 KTIMHMEKVVLDNEKEYLCIGLSDGNIEFYETGLLCKEGAEDFKPEFSLLGHTNRVKDFK 272

Query: 258 FSAD--SAYLVTASSDHYVRLWDLSTREIVRQY 288
           F  +    YLV+  SD  + +WD+  +E +  Y
Sbjct: 273 FYQNEFGIYLVSIGSDGKIVVWDMKKQEQLAVY 305

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 106/237 (44%), Gaps = 15/237 (6%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+ +  I    + H   +  +   P+  +L+S   
Sbjct: 381 IRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 440

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   +G  +AA +      VW+         
Sbjct: 441 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGEGKFIAAGSLDRTLRVWDSETGFLVER 499

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSI-------DDDFK-----LE 243
           L    +    H   +  ++ + D + + + S D + ++W++        +D K      E
Sbjct: 500 LDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATCE 559

Query: 244 TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    + VA+
Sbjct: 560 VTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAV 616

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH--QNVRLYDIRT 62
           LVS   D T+R W+  TG CS T+   D  V  + ++  +     AG   + +R++D  T
Sbjct: 435 LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGEGKFIAAGSLDRTLRVWDSET 493

Query: 63  T-------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
                   + N + +  GH+ +V SV F +D + +V+ S D ++K+W++
Sbjct: 494 GFLVERLDSENELGT--GHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WDLST+ IV    GH +
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQ 421

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 56/157 (35%), Gaps = 13/157 (8%)

Query: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA 205
           GEN  +   T   D  ++S+  + DG  LA         +W      D S  + V   + 
Sbjct: 365 GENAVSSASTSSSDLYIRSVCFSPDGKFLATGAEDKLIRIW------DLSTKRIVMTLQG 418

Query: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYL 265
           H   I  +        L + S D T R+W +    +   TL              +  ++
Sbjct: 419 HEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGEGKFI 477

Query: 266 VTASSDHYVRLWDLSTREIVR------QYGGHHKGAV 296
              S D  +R+WD  T  +V       + G  HK +V
Sbjct: 478 AAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSV 514

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 129/286 (45%), Gaps = 38/286 (13%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLY------------------ 58
           AL  VC  T  +++  +  LE ++D +L A AG Q+  ++L+                  
Sbjct: 469 ALPTVCMYTFHNTNRDMTSLEFSDDSRL-AAAGFQDSYIKLWSLDGSSLISNKIPSYKRK 527

Query: 59  DIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNA 117
           ++ TT+P   ++  GH G+V S SF  D+R++++ SED T+++W + + +   +YK HN 
Sbjct: 528 EMETTDPA-TSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNH 586

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSM 173
           PV +V   P      +   D   R+W      C H    ++     + + ++S   +G  
Sbjct: 587 PVWDVKFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDTVSFHPNGCY 641

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
           +   ++   C +W      D S    V  F  H+  I   +++ D + L T S D    +
Sbjct: 642 VFTGSSDKTCRMW------DISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINL 695

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           W I    +++      +  V     + +   L++  +DH VR+WDL
Sbjct: 696 WDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 104/224 (46%), Gaps = 5/224 (2%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDI 60
           S  L+S   D T+R W   T     + +  +  V  ++ +      ATA H Q  RL+  
Sbjct: 555 SRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSC 614

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPV 119
              +  P+  F GH  +V +VSF  +  ++ T S D T ++WD+ +    R +  H AP+
Sbjct: 615 --DHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPI 672

Query: 120 NEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
              V+ P+   L +   DG I +WD+G  +   Q+      ++ SL++  +G++L +   
Sbjct: 673 LSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGA 732

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLA 223
             +  VW++   T+   L+P   F  H   +T   ++ DVK   
Sbjct: 733 DHSVRVWDLKKATNEPGLEPEQPFIGHIGDVT-ASINQDVKDFG 775

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 56/143 (39%), Gaps = 14/143 (9%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFR-------------AHST 208
           + SL  + D  + AA        +W +   +  S+  P  K +              HS 
Sbjct: 485 MTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHSG 544

Query: 209 YITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTA 268
            +     S D + L + S D T R+WS+D    L  +  GH   VWD  FS    Y  TA
Sbjct: 545 SVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTAL-VSYKGHNHPVWDVKFSPLGHYFATA 603

Query: 269 SSDHYVRLWDLSTREIVRQYGGH 291
           S D   RLW       +R + GH
Sbjct: 604 SHDQTARLWSCDHIYPLRIFAGH 626

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 18/101 (17%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDDDF------------KLETT------LDGHQR 251
           +T +  S D +  A    D   ++WS+D               ++ETT      L GH  
Sbjct: 485 MTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHSG 544

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
            V+  +FS DS +L++ S D  VRLW L T   +  Y GH+
Sbjct: 545 SVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHN 585

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 113/266 (42%), Gaps = 47/266 (17%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSFQQDN---- 87
           +N L+ T D   +ATA   N  +   Y+  T      + + GH   VT+V   +      
Sbjct: 391 LNSLDATEDGLWIATASKDNSAIVWKYNENTRKFEVYSKYIGHSSAVTAVGLPKIMPKGY 450

Query: 88  -RWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++T+S D TIK W +  P+ P + +    V+E   H ++ ++               
Sbjct: 451 PEFLLTASNDLTIKKWKIPKPTFPFDVQ-TIKVSEYTRHAHEKDI--------------- 494

Query: 147 ENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAH 206
                            +LS++ + S+ A A+    C +W + N    + L        H
Sbjct: 495 ----------------NALSISPNDSIFATASYDKTCKIWNLENGELEATLS------NH 532

Query: 207 STYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLV 266
              +  +      K LATCS D T ++WS+D  F +  TL+GH   V  C+F      LV
Sbjct: 533 KRGLWDVTFCQYDKLLATCSGDKTVKIWSLDT-FSVMKTLEGHTNAVQRCSFINKQKQLV 591

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHH 292
           +  +D  +++WD S+ E ++   GH+
Sbjct: 592 SCGADGLIKIWDCSSGECLKTLDGHN 617

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           I  +A YD T + W    G    T+ +    +  +      KLLAT +G + V+++ + T
Sbjct: 505 IFATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDT 564

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
              + + + EGH   V   SF    + +V+   DG IK+WD  S    +    HN  +  
Sbjct: 565 F--SVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWA 622

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           +    +   ++S D DG  + W
Sbjct: 623 LNTMNDGDIIVSADADGVFQFW 644

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 127/333 (38%), Gaps = 51/333 (15%)

Query: 5   LVSAGYDHTIRFWEA-LTGVC----SRTIQHSDSQVNRLEITNDKKLLATAGHQNV-RLY 58
           L+S G D  I  W+  +   C    +  +         L   +DK L+ TAG   + +L 
Sbjct: 211 LLSGGRDDIINIWDFNMKKTCKLIKTLPVNQQVESCGFLRYHDDKHLIYTAGGDAIFQLI 270

Query: 59  D------IRTTNPN----------PVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVW 102
           D      I+ TN            P+ S       ++  + Q  N   V  SE+  I+V 
Sbjct: 271 DLESGIMIKKTNKPIEELFIIGVLPIVSSSKMFLVMSDQTLQLINVEEVIKSENEIIEV- 329

Query: 103 DVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED---- 158
              S +I  N  H    +   + P   +L       ++RI  + +   T    P D    
Sbjct: 330 ---SSTIAGN--HGIIADMRFVGPELNKLALATNSPSLRIIPIPDLAGTTASLPLDVEIY 384

Query: 159 ---DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYIT---- 211
              +  L SL    DG  +A A+   +  VW+   +T     +  +K+  HS+ +T    
Sbjct: 385 EGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNENT--RKFEVYSKYIGHSSAVTAVGL 442

Query: 212 -RILLSSDVKHLATCSADHTARVWSIDDD---FKLET------TLDGHQRWVWDCAFSAD 261
            +I+     + L T S D T + W I      F ++T      T   H++ +   + S +
Sbjct: 443 PKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKDINALSISPN 502

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            +   TAS D   ++W+L   E+      H +G
Sbjct: 503 DSIFATASYDKTCKIWNLENGELEATLSNHKRG 535

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 64/142 (45%), Gaps = 17/142 (11%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTTNPNPVASFEGHRGNVTSV 81
           +  R     + ++  L++T D + L      Q ++++ ++T     V S +     ++S 
Sbjct: 52  IIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKV--VRSMK-----ISSP 104

Query: 82  SFQQD----NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGE----LI 132
           S+  D    +  +     DG+I V D+ +  I  ++K H   ++ +  +         L 
Sbjct: 105 SYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLA 164

Query: 133 SCDRDGNIRIWDLGENQCTHQL 154
           S D +G +++WDL + +C H L
Sbjct: 165 SGDTNGMVKVWDLVKRKCLHTL 186

>TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.231
           YIL046W
          Length = 687

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 133/301 (44%), Gaps = 39/301 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R    S   V  L   + +KL+  +  + +++++  T 
Sbjct: 352 LLFTGSYDSTVAAWDLYTGKLIRRFVGSFDGVKTLHF-DGQKLVTGSLDKTIKVWNYLT- 409

Query: 64  NPNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
               ++++ GH  +V SV SF+   + +V+ S D T+KVW V S S      H   VN V
Sbjct: 410 -GECISTYRGHTDSVMSVDSFK---KIIVSGSADKTVKVWHVESRSCYTLRGHTEWVNSV 465

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMASDGS 172
            +HP    L SC  D  IR+WD+  N C            ++ P     +++L +  D  
Sbjct: 466 KLHPKSFCLFSCSDDTTIRMWDIRTNVCLKVFRGHVGQVQKVIPLTIIDIENLVV--DPK 523

Query: 173 MLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKH---LATCSADH 229
           ++               +  + +      +   +      I L S + +   L +CS D+
Sbjct: 524 IIV--------------DEENNNENNENNENNENREGNESITLDSSLSYPTHLLSCSLDN 569

Query: 230 TARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYG 289
           T ++W +     + T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + 
Sbjct: 570 TIKLWDVQTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFQ 626

Query: 290 G 290
           G
Sbjct: 627 G 627

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 85/224 (37%), Gaps = 56/224 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           V  F+GH  +V ++ F    R + T S D T+  WD+ +  + R +  +       +H +
Sbjct: 333 VQEFKGHMDSVLTLQFTH--RLLFTGSYDSTVAAWDLYTGKLIRRFVGSFD-GVKTLHFD 389

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
             +L++   D  I++W+    +C                                     
Sbjct: 390 GQKLVTGSLDKTIKVWNYLTGEC------------------------------------- 412

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
                       ++ +R H+  +  +   S  K + + SAD T +VW ++   +   TL 
Sbjct: 413 ------------ISTYRGHTDSVMSV--DSFKKIIVSGSADKTVKVWHVES--RSCYTLR 456

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH  WV        S  L + S D  +R+WD+ T   ++ + GH
Sbjct: 457 GHTEWVNSVKLHPKSFCLFSCSDDTTIRMWDIRTNVCLKVFRGH 500

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 77/185 (41%), Gaps = 15/185 (8%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNR---LEITNDKKLLATAGHQNVRLY 58
           S  L S   D TIR W+  T VC +  +    QV +   L I + + L+           
Sbjct: 471 SFCLFSCSDDTTIRMWDIRTNVCLKVFRGHVGQVQKVIPLTIIDIENLVVDPKIIVDEEN 530

Query: 59  DIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPR-NYKHNA 117
           +      N          ++T  S       +++ S D TIK+WDV++    R  + H  
Sbjct: 531 NNENNENNENNENREGNESITLDSSLSYPTHLLSCSLDNTIKLWDVQTGKCIRTQFGHVE 590

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAA 177
            V ++    +   +IS   DG+I+IWDL   +C H        + Q +S+ + G+    A
Sbjct: 591 GVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMH--------TFQGMSLYT-GAGANVA 639

Query: 178 NTKGN 182
           N  G+
Sbjct: 640 NNNGD 644

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 107/236 (45%), Gaps = 14/236 (5%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+ +  I    + H   +  +   P+  +L+S   
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDD-----DFKL------ET 244
           L    +    H   +  ++ + D + + + S D + ++W++ +     D K       E 
Sbjct: 565 LDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEV 624

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           T  GH+ +V   A + +  Y+++ S D  V  WD ++   +    GH    + VA+
Sbjct: 625 TYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHRNSVISVAV 680

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 69/159 (43%), Gaps = 19/159 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 500 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 559

Query: 64  N-----PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK---- 114
                  +   S  GH+ +V SV F +D + +V+ S D ++K+W++++ +   + K    
Sbjct: 560 FLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNS 619

Query: 115 ---------HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
                    H   V  V    N   ++S  +D  +  WD
Sbjct: 620 GTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 486

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 54/148 (36%), Gaps = 13/148 (8%)

Query: 155 TPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL 214
           +P  D  ++S+  + DG  LA         +W++ N       K V   + H   I  + 
Sbjct: 439 SPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENR------KIVMILQGHEQDIYSLD 492

Query: 215 LSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
                  L + S D T R+W +    +   TL              D  Y+   S D  V
Sbjct: 493 YFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAV 551

Query: 275 RLWDLSTREIVR------QYGGHHKGAV 296
           R+WD  T  +V       + G  HK +V
Sbjct: 552 RVWDSETGFLVERLDSENESGTGHKDSV 579

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 129/276 (46%), Gaps = 32/276 (11%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLY-------DIRTTNPNPV------A 69
           VC  T  +++  +  +E ++D +L A AG Q+  +         +++  P+        A
Sbjct: 489 VCMYTFHNTNGNMTCVEFSDDARLTA-AGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSA 547

Query: 70  SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQ 128
           +  GH G V SV+F  DNR+++++SED T+++W + + +    YK HN PV  V   P  
Sbjct: 548 TLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLG 607

Query: 129 GELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAANTKGNCY 184
              I+   D   R+W      C H    ++       +   +   +G  +   ++   C 
Sbjct: 608 HYFITASHDQTARLW-----SCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCR 662

Query: 185 VWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLET 244
           +W++    D+  L     F  H++ +T + +S D + L T S D T  VW I    +++ 
Sbjct: 663 MWDI-QTGDSVRL-----FLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQ 716

Query: 245 TLDGHQR-WVWDCAFSADSAYLVTASSDHYVRLWDL 279
            + GH +  ++   F+ +   LVT  +D  VR+WD+
Sbjct: 717 -MKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 100/221 (45%), Gaps = 5/221 (2%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+SA  D T+R W   T  C    +  +  V  ++ +       TA H Q  RL+     
Sbjct: 568 LLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHI 627

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V   +F  +  ++ T S D T ++WD+++    R +  H +PV  +
Sbjct: 628 YP--LRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTAL 685

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +   Q+       + S++   +G+ L       +
Sbjct: 686 EVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQS 745

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLA 223
             VW++   T+   ++P  +F  +S  +  + +++D+K   
Sbjct: 746 VRVWDIKRFTNEPGMEPEQQFNTYSGDM-ELSVNNDIKEFG 785

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 106/258 (41%), Gaps = 23/258 (8%)

Query: 54  NVRLYDIRTTNPNP-VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV-RSPS--- 108
           +++L +++T+ P+  + +F    GN+T V F  D R      +D TIKVW +  SP    
Sbjct: 476 SIQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSI 535

Query: 109 IPRNYK----------HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
           +P   K          H+ PV  V   P+   L+S   D  +R+W L    C       +
Sbjct: 536 LPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHN 595

Query: 159 DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSD 218
              +  +  +  G     A+      +W         H+ P+  F  H   +       +
Sbjct: 596 H-PVWYVKFSPLGHYFITASHDQTARLWS------CDHIYPLRIFSGHLNDVDCSTFHPN 648

Query: 219 VKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
             ++ T S+D T R+W I     +   L GH   V     S D  +L T S D  + +WD
Sbjct: 649 GCYVFTGSSDKTCRMWDIQTGDSVRLFL-GHTSPVTALEVSPDGRWLTTGSEDGTIIVWD 707

Query: 279 LSTREIVRQYGGHHKGAV 296
           + T + ++Q  GH K  +
Sbjct: 708 IGTGKRIKQMKGHGKNPI 725

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 57/144 (39%), Gaps = 16/144 (11%)

Query: 165 LSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA-----------HSTYITRI 213
           +  + D  + AA        VW    + D S L+ +   +A           HS  +  +
Sbjct: 504 VEFSDDARLTAAGFQDSTIKVW----YLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSV 559

Query: 214 LLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHY 273
             S D ++L + S D T R+WS+D  F       GH   VW   FS    Y +TAS D  
Sbjct: 560 AFSPDNRYLLSASEDKTVRLWSLDT-FTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQT 618

Query: 274 VRLWDLSTREIVRQYGGHHKGAVC 297
            RLW       +R + GH     C
Sbjct: 619 ARLWSCDHIYPLRIFSGHLNDVDC 642

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 106/236 (44%), Gaps = 14/236 (5%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+ +  I    + H   +  +   P+  +L+S   
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDD-----DFKL------ET 244
           L    +    H   +  ++ + D + + + S D + ++W++ +     D K       E 
Sbjct: 565 LDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEV 624

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    + VA+
Sbjct: 625 TYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 680

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 69/159 (43%), Gaps = 19/159 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 500 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 559

Query: 64  N-----PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK---- 114
                  +   S  GH+ +V SV F +D + +V+ S D ++K+W++++ +   + K    
Sbjct: 560 FLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNS 619

Query: 115 ---------HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
                    H   V  V    N   ++S  +D  +  WD
Sbjct: 620 GTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 486

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 54/148 (36%), Gaps = 13/148 (8%)

Query: 155 TPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL 214
           +P  D  ++S+  + DG  LA         +W++ N       K V   + H   I  + 
Sbjct: 439 SPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENR------KIVMILQGHEQDIYSLD 492

Query: 215 LSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
                  L + S D T R+W +    +   TL              D  Y+   S D  V
Sbjct: 493 YFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAV 551

Query: 275 RLWDLSTREIVR------QYGGHHKGAV 296
           R+WD  T  +V       + G  HK +V
Sbjct: 552 RVWDSETGFLVERLDSENESGTGHKDSV 579

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 50/120 (41%), Gaps = 21/120 (17%)

Query: 5   LVSAGYDHTIRFWEAL------------TGVCSRT-IQHSDSQVNRLEITNDKKLLATAG 51
           +VS   D +++ W               +G C  T I H D  ++     ND+ +L+ + 
Sbjct: 591 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 650

Query: 52  HQNVRLYDIRTTNPNPVASFEGHRGNVTSVS------FQQDNRWMVTSSEDGTIKVWDVR 105
            + V  +D ++   NP+   +GHR +V SV+         +     T S D   ++W  +
Sbjct: 651 DRGVLFWDKKSG--NPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYK 708

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 135/304 (44%), Gaps = 34/304 (11%)

Query: 26  RTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN---------------PNPVAS 70
           RT+ H DS V  ++ +N+ + LAT  ++  +++++ T N                N  +S
Sbjct: 313 RTLLH-DSVVCCVKFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASS 371

Query: 71  FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQG 129
            + +   + SV F  D +++ T +ED  I++WD+    I    + H   +  +    +  
Sbjct: 372 ADLY---IRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGN 428

Query: 130 ELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMP 189
           +L+S   D  IRIWDL   QC+  L+ ED  +  ++S   +G+ +AA +      VW+  
Sbjct: 429 KLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVS-PGNGNYVAAGSLDRTVRVWDSN 487

Query: 190 NHTDASHLKPVTKFR-AHSTYITRILLSSDVKHLATCSADHTARVWSIDD---------- 238
           +      L    +    H   +  ++ + D K++ + S D + ++W++ +          
Sbjct: 488 SGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQP 547

Query: 239 --DFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 296
             +   E T  GH+ +V     + +  Y+++ S D  V  WD  +   +    GH    +
Sbjct: 548 KTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVI 607

Query: 297 CVAL 300
            VA+
Sbjct: 608 SVAV 611

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 101/260 (38%), Gaps = 24/260 (9%)

Query: 43  DKKLLATAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKV 101
           D K LAT      +R++DI       V    GH  ++ S+ + Q    +V+ S D TI++
Sbjct: 384 DGKFLATGAEDKLIRIWDI--AQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRI 441

Query: 102 WDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDR-DGNIRIWDLGENQCTHQLTPEDDT 160
           WD+ +            V  V + P  G  ++    D  +R+WD        +L  E +T
Sbjct: 442 WDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGET 501

Query: 161 ------SLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS-HLKPVTK------FRAHS 207
                 S+ S+    DG  + + +   +  +W + N   AS   +P T+      +  H 
Sbjct: 502 GVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHK 561

Query: 208 TYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA------FSAD 261
            ++  +  + + +++ + S D     W       L   L GH+  V   A        A+
Sbjct: 562 DFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPL-LMLQGHRNSVISVAVANGKPLGAN 620

Query: 262 SAYLVTASSDHYVRLWDLST 281
                T S D   ++W   T
Sbjct: 621 YNVFATGSGDCKAKIWKFQT 640

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 72/161 (44%), Gaps = 22/161 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT--NDKKLLATAGHQNVRLYDIRT 62
           LVS   D TIR W+  TG CS T+   D  V  + ++  N   + A +  + VR++D  +
Sbjct: 430 LVSGSGDRTIRIWDLHTGQCSLTLSIEDG-VTTVAVSPGNGNYVAAGSLDRTVRVWDSNS 488

Query: 63  TNPNPVASFE-----GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS---------PS 108
                    E     GH+ +V SV F +D + +V+ S D ++K+W++R+         P 
Sbjct: 489 GFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPK 548

Query: 109 IPRNYK-----HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
              N +     H   V  V    N   ++S  +D  +  WD
Sbjct: 549 TEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWD 589

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/335 (21%), Positives = 136/335 (40%), Gaps = 54/335 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T      ++   + V  +  + D +L+AT    N +RL++ +  
Sbjct: 159 MVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
            P   A  +GH   +TS++++        D   + ++S+DGTIK+WD    +       +
Sbjct: 219 KPWGDA-MKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSGH 277

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL-GENQC----------THQLTPEDDTSLQSL 165
                 V    QG L +   D  IR+WD+    +C           + L+   D +++  
Sbjct: 278 TNSVSCVKWGGQGLLYTGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLSLSTDYAIRVG 337

Query: 166 SMASDGS----------------------------MLAAANTKGNCYVWEMPNHTDASHL 197
               DG                             ++  A+     ++W           
Sbjct: 338 PFGPDGKASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWN-----PLKSA 392

Query: 198 KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257
           KP+ +   H   +  +  S D +++ + S D++ ++W    D K   T  GH   V+  A
Sbjct: 393 KPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFIATFRGHVASVYQVA 451

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 452 WSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQ 486

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 107/279 (38%), Gaps = 61/279 (21%)

Query: 4   ILVSAGYDHTIRFWE-ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           +L +  +D TIR W+    G C   ++     VN L ++ D  +       + +      
Sbjct: 291 LLYTGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGK------ 344

Query: 63  TNPNPVASFEGHRGNVTSVSFQ--QDNRWMVTSSEDGTIKVWDVRSPSIP--RNYKHNAP 118
            +P+P  + +  + N   V  +  Q    MVT+S+D T+ +W+    + P  R   H   
Sbjct: 345 ASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKL 404

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN 178
           VN V   P+   ++S   D +I++WD                         DG  +A   
Sbjct: 405 VNHVAFSPDGRYIVSASFDNSIKLWD-----------------------GRDGKFIAT-- 439

Query: 179 TKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDD 238
                                   FR H   + ++  SSD + L +CS D T +VW +  
Sbjct: 440 ------------------------FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 475

Query: 239 DFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             KL   L GHQ  V+   +S D   + +   D  VRLW
Sbjct: 476 R-KLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDKMVRLW 513

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 193 DASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRW 252
           D +   P++  + HS ++  +  S D + +AT S D+T R+W           + GH +W
Sbjct: 172 DCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAGKPWGDAMKGHSKW 231

Query: 253 V----WD---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +    W+      + D   L +AS D  +++WD S R  +    GH     CV
Sbjct: 232 ITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSGHTNSVSCV 284

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 6/87 (6%)

Query: 197 LKPVTKFRA-----HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQR 251
           ++P+T+  A      ST +           + T + D+TAR+W       L + L GH  
Sbjct: 129 VRPITRSSAAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPL-SVLKGHSN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWD 278
           WV   A+S D   + T S D+ +RLW+
Sbjct: 188 WVLCVAWSPDGELIATGSMDNTIRLWE 214

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDDDFKLE------TTLDGHQRWVWDCAFSAD-S 262
           IT  L SS +K       D    V++    FK+         + GH   +   AF+ D S
Sbjct: 97  ITDNLWSSLLKPGYKTPEDQITLVFTPRAVFKVRPITRSSAAIAGHGSTILCSAFAPDTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + +VT + D+  R+WD +T+  +    GH    +CVA
Sbjct: 157 SRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVA 193

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 106/236 (44%), Gaps = 14/236 (5%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+ +  I    + H   +  +   P+  +L+S   
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 510 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDD-----DFKL------ET 244
           L    +    H   +  ++ + D + + + S D + ++W++ +     D K       E 
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEV 628

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    + VA+
Sbjct: 629 TYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 684

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 68/159 (42%), Gaps = 19/159 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 504 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 563

Query: 64  N-----PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK---- 114
                  +   S  GH+ +V SV F +D   +V+ S D ++K+W++++ +   + K    
Sbjct: 564 FLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNS 623

Query: 115 ---------HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
                    H   V  V    N   ++S  +D  +  WD
Sbjct: 624 GTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 662

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 490

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 54/148 (36%), Gaps = 13/148 (8%)

Query: 155 TPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL 214
           TP  D  ++S+  + DG  LA         +W++ N       K V   + H   I  + 
Sbjct: 443 TPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENR------KIVMILQGHEQDIYSLD 496

Query: 215 LSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
                  L + S D T R+W +    +   TL              D  Y+   S D  V
Sbjct: 497 YFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAV 555

Query: 275 RLWDLSTREIVR------QYGGHHKGAV 296
           R+WD  T  +V       + G  HK +V
Sbjct: 556 RVWDSETGFLVERLDSENESGTGHKDSV 583

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 15/91 (16%)

Query: 5   LVSAGYDHTIRFWEAL------------TGVCSRT-IQHSDSQVNRLEITNDKKLLATAG 51
           +VS   D +++ W               +G C  T I H D  ++     ND+ +L+ + 
Sbjct: 595 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 654

Query: 52  HQNVRLYDIRTTNPNPVASFEGHRGNVTSVS 82
            + V  +D ++   NP+   +GHR +V SV+
Sbjct: 655 DRGVLFWDKKSG--NPLLMLQGHRNSVISVA 683

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 104/236 (44%), Gaps = 14/236 (5%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+ +  I    + H   +  +   P+  +L+S   
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG ++AA +      +W+         
Sbjct: 511 DRTVRIWDLRAGQCSLTLSIEDGVTTVAVS-PGDGKLIAAGSLDRTVRIWDSETGFLVER 569

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSI-----------DDDFKLET 244
           L    +    H   +  ++ + D   + + S D + ++W++            +    E 
Sbjct: 570 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTAASEV 629

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           T  GH+ +V   A + +  ++++ S D  V  WD  +   +    GH    + VA+
Sbjct: 630 TYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAV 685

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+   G CS T+   D          D KL+A     + VR++D  T 
Sbjct: 505 LVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETG 564

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106
                  + N + +  GH+ +V SV F +D   +V+ S D ++K+W++RS
Sbjct: 565 FLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRS 612

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 209 YITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTA 268
           YI  +  S D K LAT + D   R+W +    ++  TL GH++ ++   +      LV+ 
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTR-RIVMTLQGHEQDIYSLDYFPSGDKLVSG 508

Query: 269 SSDHYVRLWDL 279
           S D  VR+WDL
Sbjct: 509 SGDRTVRIWDL 519

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 110/275 (40%), Gaps = 36/275 (13%)

Query: 38  LEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDG 97
           +  +ND + LAT  ++  ++Y + T             G + +   +        +S DG
Sbjct: 382 VRFSNDGEYLATGCNKTTQVYKVST-------------GELVARLSEDAASAPSGNSGDG 428

Query: 98  TIKVWDV-RSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTP 156
                +  ++P++  +   +  +  V   P+   L +   D  IRIWDL   +    L  
Sbjct: 429 ASGAENAEQTPAVSTSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQG 488

Query: 157 EDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLS 216
            +   + SL     G  L + +      +W++     +  L       +    +T + +S
Sbjct: 489 HEQ-DIYSLDYFPSGDKLVSGSGDRTVRIWDLRAGQCSLTL-------SIEDGVTTVAVS 540

Query: 217 -SDVKHLATCSADHTARVWSIDDDFKLETTLD-------GHQRWVWDCAFSADSAYLVTA 268
             D K +A  S D T R+W  +  F +E  LD       GH+  V+   F+ D   +V+ 
Sbjct: 541 PGDGKLIAAGSLDRTVRIWDSETGFLVE-RLDSENELGTGHKDSVYSVVFTRDGHGVVSG 599

Query: 269 SSDHYVRLWDLSTREIVRQYGGHHKGAVCVALNDV 303
           S D  V+LW+L +       GG  +G    A ++V
Sbjct: 600 SLDRSVKLWNLRSAN-----GGSTEGKANTAASEV 629

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 76/165 (46%), Gaps = 26/165 (15%)

Query: 5   LVSAG-YDHTIRFWEALTGVCSRTIQ--------HSDSQVNRLEITNDKKLLATAGHQNV 55
           L++AG  D T+R W++ TG     +         H DS  + +   +   +++ +  ++V
Sbjct: 546 LIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSV 605

Query: 56  RLYDIRTTN-------PNPVAS---FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
           +L+++R+ N        N  AS   + GH+  V SV+  Q++ ++++ S+D  +  WD  
Sbjct: 606 KLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTP 665

Query: 106 S--PSIPRNYKHNAPVNEVV-----IHPNQGELISCDRDGNIRIW 143
           S  P +      N+ ++  V     + P  G   +   D   RIW
Sbjct: 666 SGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 98/212 (46%), Gaps = 16/212 (7%)

Query: 73  GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGEL 131
           GH G V S SF  DN+++++ SED T+++W + + +   +YK HN PV +V   P     
Sbjct: 584 GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYF 643

Query: 132 ISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
            +   D   R+W      C H    ++     + +  +S   +G  +   ++   C +W 
Sbjct: 644 ATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW- 697

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
                D S    V  F  H+  +    +S D + L+T S D    VW I    +L+    
Sbjct: 698 -----DVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRG 752

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
             +  ++  ++S +   LV++ +DH VR+WDL
Sbjct: 753 HGKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 91/204 (44%), Gaps = 4/204 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  ++ +      ATA H Q  RL+     
Sbjct: 601 LISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHI 660

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEV 122
            P  +  F GH  +V  VSF  +  ++ T S D T ++WDV +    R +  H APV   
Sbjct: 661 YP--LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIST 718

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
            + P+   L +   DG I +WD+G  +    +      ++ SLS + +G++L ++    +
Sbjct: 719 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHS 778

Query: 183 CYVWEMPNHTDASHLKPVTKFRAH 206
             VW++   T     +P   F  +
Sbjct: 779 VRVWDLKKATAEPSAEPEEPFVGY 802

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 45/100 (45%), Gaps = 1/100 (1%)

Query: 201 TKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSA 260
           T    HS  +     S D K+L + S D T R+WS+D +  L  +  GH   VWD  FS 
Sbjct: 580 TTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTL-VSYKGHNHPVWDVKFSP 638

Query: 261 DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
              Y  TAS D   RLW       +R + GH     CV+ 
Sbjct: 639 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSF 678

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 112/266 (42%), Gaps = 32/266 (12%)

Query: 37  RLEITNDKKLLATAGHQNVRLYDIRTTNPNP-VASFEGHRGNVTSVSFQQDNRWMVTSSE 95
           +LEI   K+       +++RL +++   P+  + +F     ++TS+ F +D+R      +
Sbjct: 485 KLEIQKVKE-----SRESIRLNNLQAALPSVCLYTFHNTNRDMTSLDFSEDSRLAAGGFQ 539

Query: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155
           D  IK+W +   S+    K+    +         +  S D      I   G         
Sbjct: 540 DSYIKLWSLDGSSL---KKYGDVSSSPSPSATTADKYSKDFTNTTLIGHSG--------- 587

Query: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215
                ++ S S + D   L + +      +W +  +T       +  ++ H+  +  +  
Sbjct: 588 -----AVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTT------LVSYKGHNHPVWDVKF 636

Query: 216 SSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC-AFSADSAYLVTASSDHYV 274
           S    + AT S D TAR+WS D  + L     GH   V DC +F  +  Y+ T SSD   
Sbjct: 637 SPLGHYFATASHDQTARLWSCDHIYPLRI-FAGHLSDV-DCVSFHPNGCYVFTGSSDKTC 694

Query: 275 RLWDLSTREIVRQYGGHHKGAVCVAL 300
           R+WD+ST + VR + GH    +  A+
Sbjct: 695 RMWDVSTGDSVRLFLGHTAPVISTAV 720

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 143/336 (42%), Gaps = 58/336 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++AT    N +RL+D ++ 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
                A   GH   +TS+S++            + +SS+DGTIK+WD  S      Y  +
Sbjct: 219 QCLGDA-LRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC--QYTMS 275

Query: 117 APVNEV--VIHPNQGELISCDRDGNIRIWDL-GENQCTHQL------------------- 154
              N V  V    QG L S   D  +R+WD+  + +C + L                   
Sbjct: 276 GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALR 335

Query: 155 ------------TPED--DTSLQSLSM-----ASDGSMLAAANTKGNCYVWEMPNHTDAS 195
                       TPE+    +L++         +   M+  A+     ++W     T   
Sbjct: 336 IGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKST--- 392

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
             KP+ +   H   +  +  S D +++ + S D++ ++W    D K  +T  GH   V+ 
Sbjct: 393 --KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFISTFRGHVASVYQ 449

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            A+S+D   LV+ S D  +++WD+ TR++     GH
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 118/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L S+  D TI+ W+ ++ VC  T+    + V+ ++      L + +  + VR++DI +  
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQG 310

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              +   + H   V  +S   D    + + +    K      PS P   +  A  N   I
Sbjct: 311 -RCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKK------PSTPEEAQKKALENYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
               G     +++   D  + +W+ L   +   ++T      +  ++ + DG  + +A+ 
Sbjct: 364 CKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H   + ++  SSD + L +CS D T +VW +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 74/144 (51%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D+T+  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 MMVTASDDYTMFLWNPLKSTKPIARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+   A + + + IL S+   H    + T + D+TAR+W  D    +  TL GH  
Sbjct: 129 VKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMH-TLKGHYN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWD 278
           WV   ++S D   + T S D+ +RLWD
Sbjct: 188 WVLCVSWSPDGEVIATGSMDNTIRLWD 214

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAF 258
           P+   + H  ++  +  S D + +AT S D+T R+W       L   L GH +W+   ++
Sbjct: 178 PMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSW 237

Query: 259 S-------ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
                        L ++S D  +++WD  +R       GH     CV
Sbjct: 238 EPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCV 284

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDDDFKLE------TTLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    FK++      + + GH   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + +VT + D+  R+WD  T+  +    GH+   +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVS 193

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 105/254 (41%), Gaps = 33/254 (12%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+    I      H   +  +   P+  +++S   
Sbjct: 369 IRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSG 428

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC   L+ ED   + +++++ DG  +AA +      VW+         
Sbjct: 429 DRTVRIWDLNTGQCLLTLSIED--GVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVER 486

Query: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI-------DDDFKL------- 242
           L        H   +  ++ + D K++ + S D T ++W++       +D  K+       
Sbjct: 487 LDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQTTSSNDASKINQNSNSH 546

Query: 243 ----------------ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVR 286
                           E T  GH+ +V   A + D   +++ S D  V  WD  +   + 
Sbjct: 547 LDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGSKDRSVLFWDTKSGNPLL 606

Query: 287 QYGGHHKGAVCVAL 300
              GH    + VA+
Sbjct: 607 MLQGHRNSVISVAV 620

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRT- 62
           +VS   D T+R W+  TG C  T+   D  V  + ++ D K +A     + VR++D  T 
Sbjct: 423 IVSGSGDRTVRIWDLNTGQCLLTLSIEDG-VTTVAVSPDGKFIAAGSLDRAVRVWDAETG 481

Query: 63  -----TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN 112
                 + N + +  GH  +V SV F +D + +V+ S D T+K+W+++  +   N
Sbjct: 482 FLVERLDSNELGT--GHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQTTSSN 534

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 209 YITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTA 268
           YI  +  S D K LAT + D   R+W I    K+   L+GH++ ++   +      +V+ 
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLK-KIVMILNGHEQDIYSLDYFPSGDKIVSG 426

Query: 269 SSDHYVRLWDLST 281
           S D  VR+WDL+T
Sbjct: 427 SGDRTVRIWDLNT 439

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD++ ++IV    GH +
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQ 409

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 122/277 (44%), Gaps = 26/277 (9%)

Query: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 352 ELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS- 410

Query: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155
           +G++K+W+V++    R ++    +    + P    +I   R G ++++DL  +     + 
Sbjct: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRSGELQLFDLASSSLLDTIE 469

Query: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208
              D ++ SL + SDG  L   +       W+       +P   D     P+ K    +T
Sbjct: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKD--KFVPMLKLNHDTT 527

Query: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263
                 I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586

Query: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/309 (19%), Positives = 127/309 (41%), Gaps = 68/309 (22%)

Query: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87
           +Q   + V  +++++D KLLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 387 LQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442

Query: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502

Query: 146 G---------ENQCTHQLTPEDDTSLQ------SLSMASDGSMLAAANTKGNCYVWEMPN 190
                     +++    L    DT+L+      S+ ++ D   LA +       V+ + +
Sbjct: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562

Query: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID------------- 237
                 +K       H   +  I +S D K + T SAD   ++W +D             
Sbjct: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616

Query: 238 ----------------------------DDFKLETTLDGHQRWVWDCAFSADSAYLVTAS 269
                                       + F+    L  HQ  VW  A S D +++V++S
Sbjct: 617 SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSS 676

Query: 270 SDHYVRLWD 278
            DH +R+W+
Sbjct: 677 HDHSIRIWE 685

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 94/224 (41%), Gaps = 23/224 (10%)

Query: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDI---RTTNPNPVASFEGH-----------RG 76
           D+ +  L++T+D K+L+  +  + V+ +D    +T  P     F                
Sbjct: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELND 532

Query: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 92/224 (41%), Gaps = 17/224 (7%)

Query: 38  LEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSED 96
           LE+  D  LLA      V +++D+   +   + +F GH+  +T + F      +++ S+D
Sbjct: 85  LEVHQDTNLLAVGYADGVIKVWDL--VSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKD 142

Query: 97  GTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQCTHQL 154
             I VWD+        YK  +  + +     QGE  L+S  +DG I+IWDL   QC    
Sbjct: 143 SNIIVWDLVGEV--GLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETH 200

Query: 155 TPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE--MPNHTDASHLKPVTKFRAHSTY--- 209
                 + +   +A    +L   +T     +W+  M N      L  +  F   S     
Sbjct: 201 IAH---TGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGL 257

Query: 210 -ITRILLSSD-VKHLATCSADHTARVWSIDDDFKLETTLDGHQR 251
            I  I  +SD V      +AD T   + I  + ++   L   ++
Sbjct: 258 KIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKREK 301

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633

Query: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q 
Sbjct: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 71/149 (47%), Gaps = 9/149 (6%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62
           L++ GY D  I+ W+ ++           + +  ++  +   +L++ +   N+ ++D+  
Sbjct: 93  LLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-- 150

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNE 121
                +     H+  +T    Q ++ W+V++S+DG IK+WD+++   I  +  H      
Sbjct: 151 VGEVGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWG 209

Query: 122 VVIHPNQGELISCDRDGNIRIWDLG-ENQ 149
           + +  +   LI+   D  ++IW L  EN+
Sbjct: 210 LAVKDDL--LITTSTDSQVKIWKLNMENE 236

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 81/204 (39%), Gaps = 25/204 (12%)

Query: 90  MVTSSEDGTIKVWDVRS-----------PSIPRNYKHNAPVN--EVVIHPNQGELISCDR 136
           ++TS+ +  + +WD+++           P    + K + P     + +H +   L     
Sbjct: 41  LITSALEN-VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYA 99

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           DG I++WDL               ++  +   S G+ L + +   N  VW++        
Sbjct: 100 DGVIKVWDLVSKTVLLNFNGHK-AAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVG--- 155

Query: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256
              + K R+H   IT      +   L + S D   ++W +     +ET +  H    W  
Sbjct: 156 ---LYKLRSHKDAITGFWCQGE-DWLVSTSKDGLIKIWDLKTQQCIETHI-AHTGECWGL 210

Query: 257 AFSADSAYLVTASSDHYVRLWDLS 280
           A   D   L+T S+D  V++W L+
Sbjct: 211 AVKDD--LLITTSTDSQVKIWKLN 232

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 122/286 (42%), Gaps = 37/286 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--------------------VRLY 58
           +L  VC  T  +++  ++ LE ++D +L AT G Q+                     +  
Sbjct: 466 SLPSVCMYTFHNTNKDMSCLEFSDDCRLAAT-GFQDSFIKIWSLDGSSLVTNKLPSYKKE 524

Query: 59  DIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNA 117
           +I TT     +   GH G V S SF  DN+++++ SED T+++W + + +   +YK HN 
Sbjct: 525 EILTTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNH 584

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSM 173
           PV +V   P      +   D   R+W      C H    ++       ++++S   +G  
Sbjct: 585 PVWDVKFSPMGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVETVSFHPNGCY 639

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
           +   +    C +W      D S    V  F  H+  +    ++ D + L T   D    V
Sbjct: 640 VFTGSADKTCRMW------DISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINV 693

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           W I    +L+      +  +   +F+ +   L++  +DH VR+WDL
Sbjct: 694 WDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDL 739

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 105/247 (42%), Gaps = 30/247 (12%)

Query: 55  VRLYDIRTTNPNP-VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY 113
           +RL +I+T+ P+  + +F     +++ + F  D R   T  +D  IK+W +   S+  N 
Sbjct: 458 IRLDNIQTSLPSVCMYTFHNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNK 517

Query: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSM 173
             +    E+        L + D   ++ I   G              ++ S S + D   
Sbjct: 518 LPSYKKEEI--------LTTGDETSSLLIGHSG--------------AVYSTSFSPDNKF 555

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARV 233
           L + +      +W M  HT       +  ++ H+  +  +  S    + AT S D TAR+
Sbjct: 556 LLSGSEDKTVRLWSMDTHTT------LVSYKGHNHPVWDVKFSPMGHYFATASHDQTARL 609

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           WS D  + L     GH   V   +F  +  Y+ T S+D   R+WD+ST + VR + GH  
Sbjct: 610 WSCDHIYPLRI-FAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTA 668

Query: 294 GAVCVAL 300
             +  A+
Sbjct: 669 PVLTTAV 675

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 97/222 (43%), Gaps = 5/222 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRT 62
            L+S   D T+R W   T     + +  +  V  ++ +      ATA H Q  RL+    
Sbjct: 555 FLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCDH 614

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNE 121
             P  +  F GH  +V +VSF  +  ++ T S D T ++WD+ +    R +  H APV  
Sbjct: 615 IYP--LRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLT 672

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKG 181
             + P+   L +   DG I +WD+G  +   Q+      ++ S S   +G++L +     
Sbjct: 673 TAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADH 732

Query: 182 NCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLA 223
           +  VW++   T     +P   F  +   +T   ++ D+K   
Sbjct: 733 SVRVWDLKKATPEPSAEPEQPFAGYVGDVTAS-VNQDIKEFG 773

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 43/99 (43%), Gaps = 9/99 (9%)

Query: 205 AHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAY 264
            HS  +     S D K L + S D T R+WS+D    L  +  GH   VWD  FS    Y
Sbjct: 539 GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTL-VSYKGHNHPVWDVKFSPMGHY 597

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALNDV 303
             TAS D   RLW       +R + GH        LNDV
Sbjct: 598 FATASHDQTARLWSCDHIYPLRIFAGH--------LNDV 628

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 104/236 (44%), Gaps = 14/236 (5%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+ +  I    + H   +  +   P+  +L+S   
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG ++AA +      +W+         
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKLIAAGSLDRTVRIWDSETGFLVER 591

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSI-----------DDDFKLET 244
           L    +    H   +  ++ + D   + + S D + ++W++            +    E 
Sbjct: 592 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEV 651

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           T  GH+ +V   A + +  ++++ S D  V  WD  +   +    GH    + VA+
Sbjct: 652 TYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAV 707

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D KL+A     + VR++D  T 
Sbjct: 527 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETG 586

Query: 64  -------NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106
                  + N + +  GH+ +V SV F +D   +V+ S D ++K+W++RS
Sbjct: 587 FLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRS 634

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 81/205 (39%), Gaps = 20/205 (9%)

Query: 106 SPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165
           SP++  +   +  +  V   P+   L +   D  IRIWDL   +    L   +   + SL
Sbjct: 460 SPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQ-DIYSL 518

Query: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225
                G  L + +      +W++   T    L             T  +   D K +A  
Sbjct: 519 DYFPSGDKLVSGSGDRTVRIWDL--RTGQCSL----TLSIEDGVTTVAVSPGDGKLIAAG 572

Query: 226 SADHTARVWSIDDDFKLETTLD-------GHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
           S D T R+W  +  F +E  LD       GH+  V+   F+ D   +V+ S D  V+LW+
Sbjct: 573 SLDRTVRIWDSETGFLVE-RLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 631

Query: 279 LSTREIVRQYGGHHKGAVCVALNDV 303
           L +       GG  +G    A ++V
Sbjct: 632 LRSAN-----GGTAEGKANTAASEV 651

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 76/165 (46%), Gaps = 26/165 (15%)

Query: 5   LVSAG-YDHTIRFWEALTGVCSRTIQ--------HSDSQVNRLEITNDKKLLATAGHQNV 55
           L++AG  D T+R W++ TG     +         H DS  + +   +   +++ +  ++V
Sbjct: 568 LIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSV 627

Query: 56  RLYDIRTTN-------PNPVAS---FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVR 105
           +L+++R+ N        N  AS   + GH+  V SV+  Q++ ++++ S+D  +  WD  
Sbjct: 628 KLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTP 687

Query: 106 S--PSIPRNYKHNAPVNEVV-----IHPNQGELISCDRDGNIRIW 143
           S  P +      N+ ++  V     + P  G   +   D   RIW
Sbjct: 688 SGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 141/337 (41%), Gaps = 58/337 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++AT    N +RL+D +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVAWSPDGEVIATGSMDNTIRLWDPKTG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
                A   GH   +TS+S++            + +SS+DGTIK+WD  S      Y  +
Sbjct: 219 ECLGDA-LRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC--QYTMS 275

Query: 117 APVNEV--VIHPNQGELISCDRDGNIRIWDL-GENQC----------THQLTPEDDTSL- 162
              N V  V    QG L S   D  +R+WD+  + +C           + L+   D +L 
Sbjct: 276 GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYALR 335

Query: 163 --------QSLSMASDGSMLAAANTKGNC-------------------YVWEMPNHTDAS 195
                   Q  +   D    A AN +  C                   ++W     T   
Sbjct: 336 VGAFDHTGQKPTSPEDAQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKST--- 392

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
             KP+ +   H   +  +  S D +++ + S D++ ++W    D K  +T  GH   V+ 
Sbjct: 393 --KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFISTFRGHVASVYQ 449

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
            A+S+D   LV+ S D  +++WD+ T ++     GH 
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVRTGKLSVDLPGHQ 486

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L S+  D TI+ W+ ++ VC  T+    + V+ ++      L + +  + VR++D+ +  
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQG 310

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              +   + H   V  +S   D    V + +    K      P+ P + +  A  N   I
Sbjct: 311 -RCINILKSHAHWVNHLSLSTDYALRVGAFDHTGQK------PTSPEDAQKKALANYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
               G     +++   D  I +W+ L   +   ++T      +  ++ + DG  + +A+ 
Sbjct: 364 CKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H   + ++  SSD + L +CS D T +VW +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTG 476

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHQDEVYTVDWSVDGKRVCSGGRDKMVRLW 513

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D TI  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 MMVTASDDFTIFLWNPLKSTKPIARMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTGKLSVDLPGHQDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  RD  +R+W
Sbjct: 490 YTVDWSVDGKRVCSGGRDKMVRLW 513

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 6/94 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+   A + + + IL S+   H    + T + D+TAR+W  D    +  TL GH  
Sbjct: 129 VKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMH-TLKGHFN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           WV   A+S D   + T S D+ +RLWD  T E +
Sbjct: 188 WVLCVAWSPDGEVIATGSMDNTIRLWDPKTGECL 221

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAF 258
           P+   + H  ++  +  S D + +AT S D+T R+W       L   L GH +W+   ++
Sbjct: 178 PMHTLKGHFNWVLCVAWSPDGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSW 237

Query: 259 S-------ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
                        L ++S D  +++WD  +R       GH     CV
Sbjct: 238 EPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCV 284

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDDDFKLE------TTLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    FK++      + + GH   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGHNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + +VT + D+  R+WD  T+  +    GH    +CVA
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVA 193

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 104/236 (44%), Gaps = 14/236 (5%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + SV F  D +++ T +ED  I++WD+    I    + H   +  +   P+  +L+S   
Sbjct: 442 IRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 501

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           D  +RIWDL   QC+  L+ ED  +  ++S   DG  +AA +      VW+         
Sbjct: 502 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 560

Query: 197 LKPVTKF-RAHSTYITRILLSSDVKHLATCSADHTARVWSIDD-----DFKL------ET 244
           L    +    H   +  ++ + D   + + S D + ++W++ +     D K       E 
Sbjct: 561 LDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEV 620

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    + VA+
Sbjct: 621 TYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 676

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 68/159 (42%), Gaps = 19/159 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K +A     + VR++D  T 
Sbjct: 496 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 555

Query: 64  N-----PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK---- 114
                  +   S  GH+ +V SV F +D   +V+ S D ++K+W++++ +   + K    
Sbjct: 556 FLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNS 615

Query: 115 ---------HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
                    H   V  V    N   ++S  +D  +  WD
Sbjct: 616 GTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 654

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQ 482

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 52/148 (35%), Gaps = 13/148 (8%)

Query: 155 TPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL 214
           +P  D  ++S+  + DG  LA         +W      D    K V   + H   I  + 
Sbjct: 435 SPSSDLYIRSVCFSPDGKFLATGAEDRLIRIW------DIEKRKIVMILQGHEQDIYSLD 488

Query: 215 LSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
                  L + S D T R+W +    +   TL              D  Y+   S D  V
Sbjct: 489 YFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAV 547

Query: 275 RLWDLSTREIVR------QYGGHHKGAV 296
           R+WD  T  +V       + G  HK +V
Sbjct: 548 RVWDSETGFLVERLDSENESGTGHKDSV 575

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 50/120 (41%), Gaps = 21/120 (17%)

Query: 5   LVSAGYDHTIRFWEAL------------TGVCSRT-IQHSDSQVNRLEITNDKKLLATAG 51
           +VS   D +++ W               +G C  T I H D  ++     ND+ +L+ + 
Sbjct: 587 VVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 646

Query: 52  HQNVRLYDIRTTNPNPVASFEGHRGNVTSVS------FQQDNRWMVTSSEDGTIKVWDVR 105
            + V  +D ++   NP+   +GHR +V SV+         +     T S D   ++W  +
Sbjct: 647 DRGVLFWDKKSG--NPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYK 704

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 139/336 (41%), Gaps = 56/336 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T   W+  T     T+Q   + V     + D +L+AT    N +RL++    
Sbjct: 159 MVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSIPRNYKH 115
            P   A   GH   +TS+S++        D   + T+S+DGTIK+WD  R   +     H
Sbjct: 219 KPYGDA-LRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGH 277

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSM-L 174
            + V+  V    +  L S   D  IR WD+  N     +       +  LS+++D ++ L
Sbjct: 278 TSSVS-CVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRL 336

Query: 175 AAANTKGNC--------------------------------------YVWEMPNHTDASH 196
            A + KG                                        Y+W     T    
Sbjct: 337 GAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKST---- 392

Query: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256
            KP+T+   H   +  +  S D +++ + S D++ ++W    D K  +T  GH   V+  
Sbjct: 393 -KPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFLSTFRGHVASVYQV 450

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           A+S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 451 AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQ 486

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 110/280 (39%), Gaps = 63/280 (22%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           +L S  +D TIR W+  L G C   ++     VN L ++ D  L   A       +D + 
Sbjct: 291 VLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGA-------FDHKG 343

Query: 63  TNP-NPVASFEGHRGNVTSVSFQQDN--RWMVTSSEDGTIKVWDVRSPSIP--RNYKHNA 117
             P +P  + +    N   V+ ++ +    MVT+S+D T+ +W+    + P  R   H  
Sbjct: 344 ETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQK 403

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAA 177
            VN V   P+   ++S   D +I++WD                         DG  L+  
Sbjct: 404 LVNHVAFSPDGRYIVSASFDNSIKLWD-----------------------GRDGKFLST- 439

Query: 178 NTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID 237
                                    FR H   + ++  SSD + L +CS D T +VW + 
Sbjct: 440 -------------------------FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 474

Query: 238 DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
              KL   L GHQ  V+   +S D   + +   D  VR+W
Sbjct: 475 TR-KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 9/103 (8%)

Query: 197 LKPVTKFRA-----HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+  +      ST +      +    + T + D+TA +W  D   ++  TL GH  
Sbjct: 129 VKPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRM-CTLQGHHN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
           WV  C++S D   + T S D+ +RLW+ S     + YG   +G
Sbjct: 188 WVLCCSWSPDGELIATGSMDNTIRLWESSKG---KPYGDALRG 227

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 43/103 (41%), Gaps = 7/103 (6%)

Query: 203 FRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFS--- 259
            + H  ++     S D + +AT S D+T R+W           L GH +W+   ++    
Sbjct: 182 LQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIH 241

Query: 260 ----ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
                D   L TAS D  +++WD + R  +    GH     CV
Sbjct: 242 LVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCV 284

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 138/301 (45%), Gaps = 30/301 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+  R W+  T     T++   + V  +  + D +++AT    N +RL+D +T 
Sbjct: 186 MVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWSADGEVIATGSMDNTIRLWDAQTG 245

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWD-VRSPSIPRNYKH 115
           +    A   GH   +TS+S++        +   + ++S+DGTIKVWD VR   I     H
Sbjct: 246 DSKGDA-LRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCILTLSGH 304

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLA 175
            + V+  +    QG + +   D  IR WD+        +       +  LS+++D ++  
Sbjct: 305 TSSVS-CIKWGGQGVIYTGSHDRTIRCWDMNAGGKCINILKSHAHWVNHLSLSTDYALKV 363

Query: 176 AANTKGNCYVWEMPNHTDASHLKPVT----KFRAHSTYITRILLSSDVKHL-ATCSADHT 230
            A               D ++ +P T    + RA   Y      +  ++ L AT S D T
Sbjct: 364 GA--------------FDHTYSRPATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFT 409

Query: 231 ARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
             +W+     K  T + GHQ+ V   AFS D  Y+V+AS D+ ++LW+ S+ + +  + G
Sbjct: 410 MYLWNPLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWEGSSGKFISTFRG 469

Query: 291 H 291
           H
Sbjct: 470 H 470

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 118/280 (42%), Gaps = 24/280 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           + SA  D TI+ W+ +   C  T+    S V+ ++      +   +  + +R +D+    
Sbjct: 278 IASASKDGTIKVWDTVRRQCILTLSGHTSSVSCIKWGGQGVIYTGSHDRTIRCWDMNAGG 337

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMV-----TSSEDGTIKVWDVRSPSIPRNYKHNAPV 119
              +   + H   V  +S   D    V     T S   T +    R+    +NY+  A  
Sbjct: 338 -KCINILKSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAEEAQKRAL---KNYEKVAKR 393

Query: 120 NEVVIHPNQGELIS-CDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAA 177
           N V+      ELI+    D  + +W+ L   +   ++T      +  ++ + DG  + +A
Sbjct: 394 NGVL-----EELIATASDDFTMYLWNPLKGTKPLTRMTGHQKL-VNHVAFSPDGRYIVSA 447

Query: 178 NTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID 237
           +   +  +WE       S  K ++ FR H   + ++  SSD + L +CS D T +VW + 
Sbjct: 448 SFDNSIKLWE------GSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR 501

Query: 238 DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
              KL   L GH   V+   +SAD   + +   D  VRLW
Sbjct: 502 TR-KLAVDLPGHNDEVYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEALTGV--CSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++ +A  D T+  W  L G    +R   H    VN +  + D + + +A   N ++L++ 
Sbjct: 400 LIATASDDFTMYLWNPLKGTKPLTRMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWE- 457

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
             ++   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   HN  V
Sbjct: 458 -GSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLAVDLPGHNDEV 516

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 517 YTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 17/136 (12%)

Query: 172 SMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTA 231
           S +   +   N  +W+    T      P+   + H+ ++  +  S+D + +AT S D+T 
Sbjct: 184 SRMVTGSGDNNARIWDCDTQT------PIYTLKGHTNWVLCVAWSADGEVIATGSMDNTI 237

Query: 232 RVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVT---------ASSDHYVRLWDLSTR 282
           R+W           L GH +W+   + S +  +LVT         AS D  +++WD   R
Sbjct: 238 RLWDAQTGDSKGDALRGHSKWI--TSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRR 295

Query: 283 EIVRQYGGHHKGAVCV 298
           + +    GH     C+
Sbjct: 296 QCILTLSGHTSSVSCI 311

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           S+ +VT S D+  R+WD  T+  +    GH    +CVA
Sbjct: 183 SSRMVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVA 220

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 125/282 (44%), Gaps = 29/282 (10%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           L +AG+ D  I+ W +L G    T+  +++     + T D  L +   HQ          
Sbjct: 502 LAAAGFQDSYIKIW-SLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQE--------- 551

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEV 122
           + N      GH G V S SF  DN+ +++ SED T+++W + + S   +YK HN PV +V
Sbjct: 552 HVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDV 611

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSMLAAAN 178
              P      +   D   R+W      C H    ++     + +  ++   +G  +   +
Sbjct: 612 AFSPMGHYFATASHDQTARLW-----SCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGS 666

Query: 179 TKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDD 238
           +   C +W      D S  + V  F  H+  +  + +S D + LA+ S D    VW I  
Sbjct: 667 SDKTCRMW------DVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGS 720

Query: 239 DFKLETTLDGHQR-WVWDCAFSADSAYLVTASSDHYVRLWDL 279
             +L+  + GH R  V    FS +   +++  +D+ VR+WD+
Sbjct: 721 GKRLK-QMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 87/193 (45%), Gaps = 16/193 (8%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRL----- 57
           +L+S   D T+R W   T     + +  +  V  +  +      ATA H Q  RL     
Sbjct: 577 LLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCDH 636

Query: 58  -YDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KH 115
            Y +R         F GH  +V  V+F  +  ++ T S D T ++WDV +    R +  H
Sbjct: 637 IYSLRI--------FAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGH 688

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLA 175
            APV  + + P+   L S   DG I +WD+G  +   Q+      ++ S+  + +G+++ 
Sbjct: 689 TAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVII 748

Query: 176 AANTKGNCYVWEM 188
           +  T  +  VW+M
Sbjct: 749 SGGTDNSVRVWDM 761

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 75/180 (41%), Gaps = 11/180 (6%)

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNC 183
            H    E++S D   + R+   G      ++   D +SL +L+ +++ +     NT  N 
Sbjct: 484 FHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLT-STNNTHFTKKNTADNN 542

Query: 184 YVWEMPNHTDASHLKPV---TKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
                  H+   H + V   TK   HS  +     S D K L + S D T R+W++D   
Sbjct: 543 L------HSKKKHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQS 596

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            L  +  GH   VWD AFS    Y  TAS D   RLW       +R + GH     CV  
Sbjct: 597 TL-VSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTF 655

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 63/138 (45%), Gaps = 9/138 (6%)

Query: 164 SLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLA 223
           S S + D  +L + +      +W M   +       +  ++ H+  +  +  S    + A
Sbjct: 568 STSFSPDNKLLISGSEDKTVRLWAMDTQS------TLVSYKGHNHPVWDVAFSPMGHYFA 621

Query: 224 TCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA-FSADSAYLVTASSDHYVRLWDLSTR 282
           T S D TAR+WS D  + L     GH   V DC  F  +  Y+ T SSD   R+WD+ST 
Sbjct: 622 TASHDQTARLWSCDHIYSLRI-FAGHLSDV-DCVTFHPNGCYVFTGSSDKTCRMWDVSTG 679

Query: 283 EIVRQYGGHHKGAVCVAL 300
           E VR + GH    V + +
Sbjct: 680 ETVRLFLGHTAPVVSLGV 697

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 64/149 (42%), Gaps = 7/149 (4%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYD 59
           M     +A +D T R W        R      S V+ +    N   +   +  +  R++D
Sbjct: 616 MGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWD 675

Query: 60  IRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS---IPRNYKHN 116
           + T     V  F GH   V S+    D RW+ + SEDG I VWD+ S       R +  N
Sbjct: 676 VSTGET--VRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRN 733

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL 145
           A VN +V       +IS   D ++R+WD+
Sbjct: 734 A-VNSIVFSQEGTVIISGGTDNSVRVWDM 761

>Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa]
           {ON} YCR057C (PWP2) - regulatory protein [contig 16]
           FULL
          Length = 913

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 21/221 (9%)

Query: 77  NVTSVSFQQDNRWMVTSSEDGT---------IKVWD-VRSPSIPRNYKHNAPVNEVVIHP 126
           N+    ++Q N   +  SEDGT         + V+D + + S    Y+H   V  V ++P
Sbjct: 9   NLLGTVYRQGN---ILFSEDGTQLISPVGNRVSVFDLIHNKSYTFEYEHRKNVQCVALNP 65

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
               L+S D DG   + +       H    ++  S   L  + DG + A A  +    VW
Sbjct: 66  QGTLLLSVDEDGRAILVNFRAKTVLHHFNFKEPVS--DLKFSPDGKVFAIACGR-FVQVW 122

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILL---SSDVKHLATCSADHTARVWSIDDDFK-- 241
           + P+  +     P  + R H+ + + I+    S D + L + S D TAR+WS+D   K  
Sbjct: 123 KTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGL 182

Query: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
              T  GH+ +V    FSAD   + T S D  V  W+ + R
Sbjct: 183 ASVTFAGHRDYVMGAFFSADQERIYTVSKDGAVFQWEYTPR 223

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 104/246 (42%), Gaps = 16/246 (6%)

Query: 42  NDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM-VTSSEDGTIK 100
           N   L+    +   RLY++       +      +  V +V       W+   SS+ G + 
Sbjct: 267 NSNTLVVGFNNGEFRLYEL--PEFTLIQQLSMGQNAVNTVCVNDSGEWLAFGSSKLGQLL 324

Query: 101 VWDVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD 159
           V++ +S S I +   H    N V   P+   +++   DG I+IWD+    C      E  
Sbjct: 325 VYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQ-EHT 383

Query: 160 TSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV 219
            ++ +L+ A  G +L +A+  G    W++  + +        + + +        L++D 
Sbjct: 384 AAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNC-------LAADP 436

Query: 220 KHLATCSAD---HTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
                C+         VWS+    +L  TLDGH+  V   +FS +++ L +AS D  +R+
Sbjct: 437 SGEVVCAGSVDSFAVHVWSVQTG-QLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRI 495

Query: 277 WDLSTR 282
           W +  R
Sbjct: 496 WSIFGR 501

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 103/260 (39%), Gaps = 34/260 (13%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVA-SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWD- 103
           L++T+     R++ + +      + +F GHR  V    F  D   + T S+DG +  W+ 
Sbjct: 161 LISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQERIYTVSKDGAVFQWEY 220

Query: 104 -----VRSPS----------------IPRNYKH--NAPVNEVVIHPNQGELISCDRDGNI 140
                  SP                   +NY +   A V  V  H N   L+    +G  
Sbjct: 221 TPRPGFESPEQDEETEIDPSLYSWRITKKNYFYASQARVKCVTFHANSNTLVVGFNNGEF 280

Query: 141 RIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK-GNCYVWEMPNHTDASHLKP 199
           R+++L E     QL+   + ++ ++ +   G  LA  ++K G   V+E  + +       
Sbjct: 281 RLYELPEFTLIQQLSMGQN-AVNTVCVNDSGEWLAFGSSKLGQLLVYEWQSES------Y 333

Query: 200 VTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFS 259
           + K + H      +  S D   + T S D   ++W +   F L  T   H   V   AF+
Sbjct: 334 ILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCL-VTFQEHTAAVSALAFA 392

Query: 260 ADSAYLVTASSDHYVRLWDL 279
                L +AS D  VR WDL
Sbjct: 393 KRGQVLFSASLDGTVRAWDL 412

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 103/237 (43%), Gaps = 28/237 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           +L SA  D T+R W+ +     RT   ++  Q N L      +++      +  ++    
Sbjct: 397 VLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSV 456

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV--RSPSIPRNYKHNAPVN 120
                V + +GH G V+ +SF Q+N  + ++S D TI++W +  RS  +    +  A V 
Sbjct: 457 QTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQV-EPLEVYADVL 515

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDT-------------------S 161
            + + P+  E+ +   DG I  +D+ E +  + +  + D                     
Sbjct: 516 SLSVRPDGNEVAAATLDGQILFFDVHEGKQVNAIDGKKDILSGRHLEDRFTSQNSARSKH 575

Query: 162 LQSLSMASDG-SMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSS 217
             ++  + DG S++AA N    C ++++PN      LK  T  R  S   T+ +L+S
Sbjct: 576 FTTIDYSFDGLSIVAAGNNNSIC-LYDIPNSV---LLKRFTVSRNMSLNGTQQMLNS 628

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 124/286 (43%), Gaps = 32/286 (11%)

Query: 5   LVSAGY-DHTIRFWEALTGVC----SRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYD 59
           L +AG+ D  I+ W +L G      +  IQ S SQ   L    D K+      Q   +  
Sbjct: 489 LAAAGFKDSYIKVW-SLDGTTLESKATKIQPSKSQA-ALRAGLDNKINEKTRSQETPITT 546

Query: 60  IRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAP 118
           ++           GH G + S SF  DN+ +V++SED TI++W + + +    YK HN P
Sbjct: 547 VKLV---------GHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHP 597

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDDTSLQSLSMASDGSML 174
           V +V   P      +   D   R+W      C H    ++     + +  ++   +G  +
Sbjct: 598 VWDVQFSPVGHYFATASHDQTARLW-----SCDHIFPLRIFSGHISDVDCVTFHPNGCYI 652

Query: 175 AAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW 234
              ++   C +W      D +  + V  F  H+  I  + ++ D   LAT S D    +W
Sbjct: 653 FTGSSDKTCRMW------DITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIW 706

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
            I     L+  +   +  V   +++ +S  LV+  SD+ VR+WDL+
Sbjct: 707 DIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 90/187 (48%), Gaps = 4/187 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGH-QNVRLYDIRT 62
           +LVSA  D TIR W   T     T +  +  V  ++ +      ATA H Q  RL+    
Sbjct: 567 LLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWS--C 624

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNE 121
            +  P+  F GH  +V  V+F  +  ++ T S D T ++WD+ +    R +  H AP+  
Sbjct: 625 DHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILS 684

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKG 181
           V + P+   L +   DG I IWD+G  +   +L     +++ SLS   + ++L +  +  
Sbjct: 685 VAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDN 744

Query: 182 NCYVWEM 188
           +  +W++
Sbjct: 745 SVRIWDL 751

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 109/256 (42%), Gaps = 32/256 (12%)

Query: 55  VRLYDIRTTNPNP-VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY 113
           V LYD++T  P+  + +F      + S+S+  D R      +D  IKVW +   ++    
Sbjct: 454 VPLYDLKTALPSVCMFTFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLESKA 513

Query: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH-QLTPEDDTSL-------QSL 165
                     I P++ +  +  R G     D   N+ T  Q TP     L        S 
Sbjct: 514 TK--------IQPSKSQ--AALRAG----LDNKINEKTRSQETPITTVKLVGHSGAIYST 559

Query: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225
           S + D  +L +A+      +W M   T       +  ++ H+  +  +  S    + AT 
Sbjct: 560 SFSPDNKLLVSASEDKTIRLWSMDTRTT------LVTYKGHNHPVWDVQFSPVGHYFATA 613

Query: 226 SADHTARVWSIDDDFKLETTLDGHQRWVWDCA-FSADSAYLVTASSDHYVRLWDLSTREI 284
           S D TAR+WS D  F L     GH   V DC  F  +  Y+ T SSD   R+WD++T E 
Sbjct: 614 SHDQTARLWSCDHIFPLRI-FSGHISDV-DCVTFHPNGCYIFTGSSDKTCRMWDITTGES 671

Query: 285 VRQYGGHHKGAVCVAL 300
           VR + GH    + VA+
Sbjct: 672 VRLFIGHTAPILSVAV 687

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 118/274 (43%), Gaps = 46/274 (16%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF-----QQD 86
           +N ++ T D   +ATA   +  +   Y+         A F GH  +VT+V       +  
Sbjct: 360 LNAIDSTEDGLWIATASKDHSAIVWKYNTIKQKFTQYARFSGHSSSVTAVGLPNVMPKSY 419

Query: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++T+S D TIK W +  PS        A   EV  H                  D+ 
Sbjct: 420 PEYLLTASNDLTIKKWKIPKPS--------AGDEEVEFH------------------DVK 453

Query: 147 ENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAH 206
            ++ T +   +D   + +LS++ + S+ A A+    C +W++         + V     H
Sbjct: 454 ISEYTRRAHEKD---INALSISPNDSIFATASYDKTCKIWDLETG------ESVATLSNH 504

Query: 207 STYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLV 266
              +  +      K +ATCS D T ++WS+D  F +  TL+GH   V  C+F      LV
Sbjct: 505 KRGLWDVSFCQFDKIIATCSGDKTIKIWSLDT-FSVIKTLEGHTNAVQKCSFINKQNQLV 563

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG--AVCV 298
           +  +D  +++WD+S  E +    GH+    A+CV
Sbjct: 564 STGADGLIKIWDISNGECISTLDGHNNRIWALCV 597

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 73/184 (39%), Gaps = 45/184 (24%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           I  +A YD T + W+  TG                                         
Sbjct: 477 IFATASYDKTCKIWDLETG----------------------------------------- 495

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEV 122
               VA+   H+  +  VSF Q ++ + T S D TIK+W + + S+ +  + H   V + 
Sbjct: 496 --ESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKC 553

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
                Q +L+S   DG I+IWD+   +C   L   ++  + +L + +DG ++ +A+  G 
Sbjct: 554 SFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNN-RIWALCVQNDGDLIVSADADGV 612

Query: 183 CYVW 186
              W
Sbjct: 613 FQFW 616

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 67/137 (48%), Gaps = 18/137 (13%)

Query: 27  TIQHSDSQ-VNRLEITNDKK-LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQ 84
           TI ++D Q +  L++T D K L+  +  Q +++ ++ T     + S +     V+S S+ 
Sbjct: 23  TISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKI--IKSMK-----VSSPSYI 75

Query: 85  QD----NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVV----IHPNQGELISCD 135
            D    +  +     DG++ V D+ +  I  + K H   ++ +     ++ N   L S D
Sbjct: 76  IDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSGD 135

Query: 136 RDGNIRIWDLGENQCTH 152
            +G ++IWDL + +C H
Sbjct: 136 TNGMVKIWDLVKRKCIH 152

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 117/254 (46%), Gaps = 22/254 (8%)

Query: 45  KLLATAGHQNVRLYDI-----RTTNPNPVA----SFEGHRGNVTSVSFQQDNRWMVTSSE 95
           +L+ T  + ++  Y I       T P P+        G R ++ S S   DN+ + T+S 
Sbjct: 349 ELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS- 407

Query: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155
           +G++K+W++++    R+++    +    + P    ++   R+G ++++D+  +       
Sbjct: 408 NGSLKIWNIKTKRCIRSFECGYALTCKFL-PGGALVVVGTRNGELQLFDIASSTMLDNKE 466

Query: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVW-----EMPNHTDASHLKPVTKFRAHSTY- 209
              D ++ SL + SDG  L   +       W     E+P   +++   P+ +    +T  
Sbjct: 467 GAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLE 526

Query: 210 ----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYL 265
               I  +++S D K +A    D+T +V+ +D   K   +L GH+  V     S DS  +
Sbjct: 527 LDDDILSVVISPDDKFIAVSLLDNTVKVFFLDS-MKFFLSLYGHKLPVLSMDISYDSKLI 585

Query: 266 VTASSDHYVRLWDL 279
           VT S+D  +++W L
Sbjct: 586 VTCSADKNIKIWGL 599

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 59/287 (20%), Positives = 125/287 (43%), Gaps = 28/287 (9%)

Query: 33  SQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVT 92
           + +    I++D KLLATA + ++++++I+T     + SFE   G   +  F      +V 
Sbjct: 389 TDIRSTSISDDNKLLATASNGSLKIWNIKTK--RCIRSFEC--GYALTCKFLPGGALVVV 444

Query: 93  SSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN-- 148
            + +G ++++D+ S ++  N +  H+A +  + +  +  +L++   D  +R W    +  
Sbjct: 445 GTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV 504

Query: 149 -------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
                        Q  H  T E D  + S+ ++ D   +A +       V+ + +     
Sbjct: 505 PVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDS----- 559

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
            +K       H   +  + +S D K + TCSAD   ++W +D       +L  HQ  + +
Sbjct: 560 -MKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFG-DCHKSLFAHQDSIMN 617

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
             F  +S    + S D  V+ WD    E +++   H      +++++
Sbjct: 618 VKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSN 664

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 96/226 (42%), Gaps = 27/226 (11%)

Query: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTNPNPVASFEGHR--------------- 75
           D+ +  L++T+D +KL+  +  + VR +    +   PV+  E ++               
Sbjct: 470 DAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV-PVSD-ESNKTMPMLQLFHDTTLEL 527

Query: 76  -GNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELIS 133
             ++ SV    D++++  S  D T+KV+ + S     + Y H  PV  + I  +   +++
Sbjct: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVT 587

Query: 134 CDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD 193
           C  D NI+IW L    C   L    D S+ ++    +     + +       W      D
Sbjct: 588 CSADKNIKIWGLDFGDCHKSLFAHQD-SIMNVKFLPESYNFFSCSKDATVKYW------D 640

Query: 194 ASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
               + + K  AH + +  I +S+D   + +   DH+ RVW   +D
Sbjct: 641 GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETED 686

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 49/194 (25%), Positives = 78/194 (40%), Gaps = 24/194 (12%)

Query: 99  IKVWDVRS-----------PSIPRNYKHNAPVNEVVI--HPNQGELISCDRDGNIRIWDL 145
           I VWD+++           P    + K + P     +  HP    L +   DG I+IWDL
Sbjct: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108

Query: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA 205
                         +++  L+  + G+ L +A+   +  VW++   +       + K R+
Sbjct: 109 ISKTVLISFNGHK-SAITVLAFDTTGTRLISASKDSDIIVWDLVGESG------LYKLRS 161

Query: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYL 265
           H   IT  L   D   L + S D   ++W +     +ET L  H    W      D A  
Sbjct: 162 HKDAITG-LWCEDENWLISTSKDGLVKIWDLKSQQCVETHL-AHTGECWSLGIIEDMA-- 217

Query: 266 VTASSDHYVRLWDL 279
           VT S+D  V+LW L
Sbjct: 218 VTCSADSQVKLWKL 231

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 55/106 (51%), Gaps = 4/106 (3%)

Query: 47  LATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
           L  AG+ +  ++++D+   +   + SF GH+  +T ++F      ++++S+D  I VWD+
Sbjct: 93  LLAAGYADGVIKIWDL--ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL 150

Query: 105 RSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
              S     + +      +   ++  LIS  +DG ++IWDL   QC
Sbjct: 151 VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQC 196

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 82/199 (41%), Gaps = 21/199 (10%)

Query: 50  AGHQNVRLYDIRTTN----------PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTI 99
            G +N+ ++DI+T            P    +        T + +  +   +     DG I
Sbjct: 44  GGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVI 103

Query: 100 KVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
           K+WD+ S ++  ++  H + +  +        LIS  +D +I +WDL      ++L    
Sbjct: 104 KIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHK 163

Query: 159 DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSD 218
           D ++  L    D + L + +  G   +W++ +       + V    AH+     + +  D
Sbjct: 164 D-AITGL-WCEDENWLISTSKDGLVKIWDLKSQ------QCVETHLAHTGECWSLGIIED 215

Query: 219 VKHLATCSADHTARVWSID 237
           +    TCSAD   ++W +D
Sbjct: 216 MA--VTCSADSQVKLWKLD 232

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/144 (20%), Positives = 71/144 (49%), Gaps = 8/144 (5%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62
           L++AGY D  I+ W+ ++     +     S +  L   T   +L++ +   ++ ++D+  
Sbjct: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL-- 150

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNE 121
              + +     H+  +T + + +D  W++++S+DG +K+WD++S   +  +  H      
Sbjct: 151 VGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWS 209

Query: 122 VVIHPNQGELISCDRDGNIRIWDL 145
           + I  +    ++C  D  +++W L
Sbjct: 210 LGIIEDMA--VTCSADSQVKLWKL 231

 Score = 42.4 bits (98), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/147 (23%), Positives = 70/147 (47%), Gaps = 11/147 (7%)

Query: 38  LEITNDKKLLAT-AGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSED 96
           ++I+ D KL+ T +  +N++++ +   + +   S   H+ ++ +V F  ++    + S+D
Sbjct: 576 MDISYDSKLIVTCSADKNIKIWGLDFGDCH--KSLFAHQDSIMNVKFLPESYNFFSCSKD 633

Query: 97  GTIKVWDVRS-PSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC----- 150
            T+K WD +    I +   H + V  + +  +   +IS   D +IR+W+  E+Q      
Sbjct: 634 ATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEE 693

Query: 151 --THQLTPEDDTSLQSLSMASDGSMLA 175
                    +DT L SL   +   ML+
Sbjct: 694 REKEMDEQYEDTLLTSLEGGAGDEMLS 720

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 118/276 (42%), Gaps = 53/276 (19%)

Query: 30  HSDSQVNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF--- 83
           H+D  +N L  T D + LATA   +  +   Y   T+     A F GH  +VT+V     
Sbjct: 421 HTD-LLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSVTAVGLPNV 479

Query: 84  --QQDNRWMVTSSEDGTIKVWDVRSPSIPR------NYKHNAPVNEVVIHPNQGELISCD 135
             +    +++T+S D TIK W + +PS  R      +  H   V+E   H +       D
Sbjct: 480 LLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAH-------D 532

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
           +D N                        S+S++ + S++A  +   +C +W +    D+ 
Sbjct: 533 KDIN------------------------SISISPNDSLIATGSYDKSCKLWNL----DSG 564

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
            L  V     H   I  +      K +ATCS D T ++WS+D  F +  T  GH   V  
Sbjct: 565 EL--VATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDT-FAVLKTFAGHTNAVQR 621

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           C F      LV++ +D  +++WD +T + ++   GH
Sbjct: 622 CTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGH 657

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 8/151 (5%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           ++ +  YD + + W   +G    T+ +    +  +      KL+AT +G + ++L+ + T
Sbjct: 546 LIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDT 605

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
                + +F GH   V   +F    + +V+S  DG IK+WD  +    +    +      
Sbjct: 606 F--AVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWA 663

Query: 123 VIHPNQGELI-SCDRDGNIRIWDLGENQCTH 152
           +   N GELI S D DG ++ W    N CT 
Sbjct: 664 LTTWNDGELIVSADADGVLQFW----NDCTE 690

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 65/154 (42%), Gaps = 23/154 (14%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYIT-----RILLS 216
           L SL+   DG  LA A+      +W+  + T  S      KF  HS+ +T      +LL 
Sbjct: 425 LNSLAATEDGQWLATASKDHTSILWKYSSET--SRFFAYAKFIGHSSSVTAVGLPNVLLR 482

Query: 217 SDVKHLATCSADHTARVWSI--------DDDFKLET--------TLDGHQRWVWDCAFSA 260
              + L T S D T + W I        DD+ K +T        T   H + +   + S 
Sbjct: 483 GYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINSISISP 542

Query: 261 DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
           + + + T S D   +LW+L + E+V     H +G
Sbjct: 543 NDSLIATGSYDKSCKLWNLDSGELVATLNNHKRG 576

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 69/146 (47%), Gaps = 18/146 (12%)

Query: 27  TIQHSDSQ-VNRLEITNDKKLLATAGHQN--VRLYDI-----RTTNPNPVASFEGHRG-N 77
           TI ++D Q +  L++T D K L +   Q+  +++Y++      TT      S +  +   
Sbjct: 57  TITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTLK 116

Query: 78  VTSVSFQQD----NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGE-- 130
           ++S S+  D    +  +     DG+I V D+ +  I  ++K H   ++ V  + N     
Sbjct: 117 LSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNC 176

Query: 131 --LISCDRDGNIRIWDLGENQCTHQL 154
             L S D +G ++IWDL +  C H L
Sbjct: 177 WLLCSGDTNGMVKIWDLVKRSCIHTL 202

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 120/276 (43%), Gaps = 26/276 (9%)

Query: 46  LLATAGHQNVRLYDIR-----TTNPNPVA----SFEGHRGNVTSVSFQQDNRWMVTSSED 96
           L+ T  +  V  Y I+      T P+P         GHR +V ++    DN+ + T+S +
Sbjct: 347 LVVTTANNTVDYYSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATAS-N 405

Query: 97  GTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTP 156
           GT+K+W++++ S  R ++    +      P    ++   + G++ ++DL  +   + +  
Sbjct: 406 GTLKIWNIKTNSCIRTFECGYAL-ACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEG 464

Query: 157 EDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTKFRAHSTY 209
               ++ SL M +DG  L   +       W+       +P  TD     P  K    +T 
Sbjct: 465 AHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTD--KFNPKLKMFHDTTL 522

Query: 210 -----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAY 264
                +  + +S D + LA    D+T +V+ +D   K   +L GH+  V     S DS  
Sbjct: 523 ELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDS-MKFFLSLYGHKLPVLSIDISFDSKL 581

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           L+T+S+D  +++W L   +  R    H+   + V  
Sbjct: 582 LITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVF 617

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 119/291 (40%), Gaps = 29/291 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L++   + T++ W   T  C RT +   +   +        +L T    ++ LYD+ ++ 
Sbjct: 399 LLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVVLGTKTG-DLHLYDLASST 457

Query: 65  PNPVASFEG-HRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIP------------- 110
              + + EG H G + S+    D + +VT S D T+  WD +    P             
Sbjct: 458 L--LNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLK 515

Query: 111 ----RNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLS 166
                  + N  V  V I P+   L     D  ++++ +   +    L       L S+ 
Sbjct: 516 MFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVL-SID 574

Query: 167 MASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCS 226
           ++ D  +L  ++   N  +W + +  D           AH+  I +++   +  +  +CS
Sbjct: 575 ISFDSKLLITSSADKNIKIWGL-DFGDCHR-----SLFAHNDSIMKVVFVPESHNFFSCS 628

Query: 227 ADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            D   + W   D F+    L  HQ+ VW  A S+D  ++V+AS D  +R+W
Sbjct: 629 KDALVKYWD-GDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135
           +V +V    DNR +  S  D T+KV+ + S     + Y H  PV  + I  +   LI+  
Sbjct: 527 DVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSS 586

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            D NI+IW L    C   L   +D+ ++ + +    +  +       C    +  + D  
Sbjct: 587 ADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFS-------CSKDALVKYWDGD 639

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             + + K  AH   +  + +SSD + + + S D + RVWS  DD
Sbjct: 640 KFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVWSETDD 683

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 7/123 (5%)

Query: 33  SQVNRLEITNDKKLLATAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91
           ++ + L+   + +LLA   +   ++++D+   + + + SF GH+  +T ++F Q    ++
Sbjct: 76  AETSYLQYHPETRLLAVGYNDGAIKIWDL--LSKSVLISFNGHKSAITILTFDQTGTRLI 133

Query: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149
           + S D  I VWD+        YK  +  + +     +GE  LIS  +DG I++WDL   Q
Sbjct: 134 SGSRDSDIIVWDLVGEV--GLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQ 191

Query: 150 CTH 152
           C  
Sbjct: 192 CVE 194

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 95/225 (42%), Gaps = 21/225 (9%)

Query: 76  GNVTSVSFQQDNRWMVTSSE-DGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGELIS 133
           G V + + +  N W + S E  GT+   D   P ++       A  + +  HP    L  
Sbjct: 35  GQVLTGALENVNCWSMKSGELIGTLT--DGLPPGAVDAKSTKPAETSYLQYHPETRLLAV 92

Query: 134 CDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD 193
              DG I+IWDL              +++  L+    G+ L + +   +  VW++     
Sbjct: 93  GYNDGAIKIWDLLSKSVLISFNGHK-SAITILTFDQTGTRLISGSRDSDIIVWDLVGEVG 151

Query: 194 ASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV 253
                 + K R+H   IT +    + + L + S D   +VW    D K++  ++ H   V
Sbjct: 152 ------LYKLRSHKDSITGLWCEGE-EWLISTSKDGLIKVW----DLKVQQCVETHVAHV 200

Query: 254 WDC-AFSADSAYLVTASSDHYVRLWDLSTRE----IVRQYGGHHK 293
            +C +       ++TA +D+ ++LW+L+  E    ++ + G H K
Sbjct: 201 GECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLIEKGTHEK 245

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 49/102 (48%), Gaps = 3/102 (2%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60
           S +L+++  D  I+ W    G C R++  H+DS +  + +       + +    V+ +D 
Sbjct: 579 SKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWD- 637

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVW 102
                  +     H+  V +++   D R++V++S D +I+VW
Sbjct: 638 -GDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 116/265 (43%), Gaps = 45/265 (16%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSFQQDN---- 87
           +N L+ T D   LAT    +  +   +++ T    P A F GH  +VT+V+         
Sbjct: 384 LNSLDATEDGLWLATCSKDSSAILWRFNVETAKFFPYAKFTGHSASVTAVALPNVMLRGW 443

Query: 88  -RWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++T+S D T+K W V  P+       N  +++++                     + 
Sbjct: 444 PEFLITASNDLTVKRWKVPKPA-------NEDISDLLT--------------------IK 476

Query: 147 ENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAH 206
           +++ T  +  +D   + +LS+A + S+ A A+    C +W++      + L        H
Sbjct: 477 QSEYTFHVHAKD---INALSLAPNDSLFATASYDKTCKIWDVETGESKATLA------GH 527

Query: 207 STYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLV 266
              +  +      K LAT S D T ++W++D  F    TL+GH   V  CAF      LV
Sbjct: 528 KRGLWDVSFCQYDKLLATSSGDKTIKIWNLDT-FSCVKTLEGHTNAVQRCAFMNKQKQLV 586

Query: 267 TASSDHYVRLWDLSTREIVRQYGGH 291
           ++ +D  +++WD  T + ++   GH
Sbjct: 587 SSGADGLIKIWDCITGDCLKTLDGH 611

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 8/157 (5%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           +  +A YD T + W+  TG    T+      +  +      KLLAT +G + ++++++ T
Sbjct: 500 LFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKTIKIWNLDT 559

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
              + V + EGH   V   +F    + +V+S  DG IK+WD  +    +    +      
Sbjct: 560 F--SCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWA 617

Query: 123 VIHPNQGEL-ISCDRDGNIRIWDLGENQCTHQLTPED 158
           +   N G+L IS D DG  + W      CT +   +D
Sbjct: 618 MNVCNDGDLIISADADGVFQFW----RDCTEEQREQD 650

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 62/149 (41%), Gaps = 18/149 (12%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV-- 219
           L SL    DG  LA  +   +  +W    + + +   P  KF  HS  +T + L + +  
Sbjct: 384 LNSLDATEDGLWLATCSKDSSAILWRF--NVETAKFFPYAKFTGHSASVTAVALPNVMLR 441

Query: 220 ---KHLATCSADHTARVWSI----DDDF-------KLETTLDGHQRWVWDCAFSADSAYL 265
              + L T S D T + W +    ++D        + E T   H + +   + + + +  
Sbjct: 442 GWPEFLITASNDLTVKRWKVPKPANEDISDLLTIKQSEYTFHVHAKDINALSLAPNDSLF 501

Query: 266 VTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            TAS D   ++WD+ T E      GH +G
Sbjct: 502 ATASYDKTCKIWDVETGESKATLAGHKRG 530

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 24/142 (16%)

Query: 27  TIQHSDSQ-VNRLEITNDKKLLATAGH-QNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQ 84
           TI++ D Q +  L +T D + L      Q ++++ + +               ++S S+ 
Sbjct: 54  TIENDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKIT-------RSMKISSPSYV 106

Query: 85  QDN----RWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGEL-------I 132
            D+      +     DG+I V DV +  I  ++K H   ++ +  H   GEL        
Sbjct: 107 MDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFH---GELNGDKWLLA 163

Query: 133 SCDRDGNIRIWDLGENQCTHQL 154
           S D +G  ++WDL + +C H +
Sbjct: 164 SGDTNGVAKVWDLVKRRCLHTM 185

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 108/247 (43%), Gaps = 26/247 (10%)

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVW----DVRSPSIPRNYKHNAPVN 120
           P  V  +EGH   + S+   +D  W+ T+S+D +  VW    D     I   Y  ++   
Sbjct: 379 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAV 438

Query: 121 EVVIHPN---QGE---LISCDRDGNIRIWDLGENQCTHQLTP---------EDDTSLQSL 165
             V  PN   +G    L++   D  I+ W + +   T+ +             +  + +L
Sbjct: 439 TAVGLPNVMPKGYPEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINAL 498

Query: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225
           S++ + S+ A A+    C +W + N    + L        H   +  +      K LATC
Sbjct: 499 SVSPNDSIFATASYDKTCKIWNLENGELEATLA------NHKRGLWDVSFCQYDKLLATC 552

Query: 226 SADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S D T ++WS++  F +  TL+GH   V  C+F      LV+  +D  +++WD  + E +
Sbjct: 553 SGDKTVKIWSLET-FSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECL 611

Query: 286 RQYGGHH 292
           +   GH+
Sbjct: 612 KTLDGHN 618

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 103/262 (39%), Gaps = 27/262 (10%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF-----QQD 86
           +N L+ T D   +ATA   N  +   Y+  T+  +  A + GH   VT+V       +  
Sbjct: 392 LNSLDATEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAVTAVGLPNVMPKGY 451

Query: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYK-----------HNAPVNEVVIHPNQGELISCD 135
             +++T+S D TIK W +  P+   + +           H   +N + + PN     +  
Sbjct: 452 PEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATAS 511

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            D   +IW+L EN             L  +S      +LA  +      +W +   +   
Sbjct: 512 YDKTCKIWNL-ENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMK 570

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
            L+       H+  + R    +  K L +C AD   ++W       L+T LDGH   +W 
Sbjct: 571 TLE------GHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKT-LDGHNNRLWA 623

Query: 256 CAFSADSAYLVTASSDHYVRLW 277
                D   +V+A +D   + W
Sbjct: 624 LNTMNDGDTIVSADADGIFQFW 645

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           I  +A YD T + W    G    T+ +    +  +      KLLAT +G + V+++ + T
Sbjct: 506 IFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLET 565

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
              + + + EGH   V   SF    + +V+   DG IK+WD  S    +    HN  +  
Sbjct: 566 F--SVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWA 623

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           +    +   ++S D DG  + W
Sbjct: 624 LNTMNDGDTIVSADADGIFQFW 645

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 16/147 (10%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV-- 219
           L SL    DG  +A A+   +  VW+  N  D S      K+  HS+ +T + L + +  
Sbjct: 392 LNSLDATEDGLWIATASKDNSAIVWKYNN--DTSKFDIYAKYIGHSSAVTAVGLPNVMPK 449

Query: 220 ---KHLATCSADHTARVWSID-----DDFKL----ETTLDGHQRWVWDCAFSADSAYLVT 267
              + L T S D T + W I      +D ++    E T   H++ +   + S + +   T
Sbjct: 450 GYPEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 509

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHKG 294
           AS D   ++W+L   E+      H +G
Sbjct: 510 ASYDKTCKIWNLENGELEATLANHKRG 536

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 60/310 (19%), Positives = 121/310 (39%), Gaps = 36/310 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT----NDK----KLLATAGHQNV 55
           +L S   +  ++ W+ +   C  T+Q   S V  L+IT    ND     KL++      V
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIV 221

Query: 56  RLYDIRTTNPNPVASFEGHRGNVTSVSF--QQDNRWMV-TSSEDGTIKVWDVRSPSIPRN 112
             +D        +         V S  F   +D + ++ T+  D   ++ D+ S S+ + 
Sbjct: 222 NFWDFDMKKKCKLIKTLPVNQQVESCGFLNTRDGKHIIYTAGGDAIFQLIDLESGSMLK- 280

Query: 113 YKHNAPVNEVVIHP-----NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQS--- 164
            + N P+ E+ I       +  ++     D  +++ ++ E   + +   + ++S+     
Sbjct: 281 -RTNKPIEELYIIGVLPIMSDSKMFLVMSDQTLQLINIEEALESKEEIIQAESSIAGNHG 339

Query: 165 -----LSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKP--VTKFRAHSTYITRILLSS 217
                  +  + + LA A       +  +P+ T      P  V  +  H   +  +  + 
Sbjct: 340 IIADMRFVGPELNKLALATNSPALRIIPIPDLTSTESSLPLDVEIYEGHEDLLNSLDATE 399

Query: 218 DVKHLATCSADHTARVWSIDDD---FKLETTLDGHQRWVWDCAF-----SADSAYLVTAS 269
           D   +AT S D++A VW  ++D   F +     GH   V               +L+TAS
Sbjct: 400 DGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFLLTAS 459

Query: 270 SDHYVRLWDL 279
           +D  ++ W +
Sbjct: 460 NDLTIKKWKI 469

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 60/283 (21%), Positives = 113/283 (39%), Gaps = 70/283 (24%)

Query: 25  SRTIQHS-----DSQVNRLEITNDKKLLATAGH-QNVRLYDIRTTNPNPVASFEGHRGNV 78
           SR I H      + ++  L++T D + L      Q ++++ ++T     V S +     +
Sbjct: 49  SRKILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGKV--VRSMK-----I 101

Query: 79  TSVSFQQD----NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGE--- 130
           +S S+  D    +  +     DG+I V D+ +  I  + K H   ++ +  +        
Sbjct: 102 SSPSYILDTDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVW 161

Query: 131 -LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMP 189
            L S D +G +++WDL + +C H L  E  ++++ L +                   E+ 
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQ-EHTSAVRGLDIT------------------EVE 202

Query: 190 NHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID--DDFKLETTLD 247
           N+   SHLK ++  R                       D     W  D     KL  TL 
Sbjct: 203 NNDGPSHLKLISGGR-----------------------DDIVNFWDFDMKKKCKLIKTLP 239

Query: 248 GHQRWVWDCAF--SADSAYLV-TASSDHYVRLWDLSTREIVRQ 287
            +Q+ V  C F  + D  +++ TA  D   +L DL +  ++++
Sbjct: 240 VNQQ-VESCGFLNTRDGKHIIYTAGGDAIFQLIDLESGSMLKR 281

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 77.0 bits (188), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 140/332 (42%), Gaps = 48/332 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D +++AT    N +RL++    
Sbjct: 158 MVTGAGDNTARLWDCDTQTPMATLSGHSNWVLCVAWSPDAEVIATGSMDNTIRLWN--GI 215

Query: 64  NPNPVA-SFEGHRGNVTSVSFQ--------QDNRWMVTSSEDGTIKVWDVRSPSIPRNYK 114
           N  P+  S  GH   +TS++++        Q  R + ++S+DGTIKVWD           
Sbjct: 216 NGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPR-LASASKDGTIKVWDTTGRVCLYTLS 274

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN-QC----------THQLTPEDDTSLQ 163
            +      V    Q  L +   D  IR+WD+  N +C           + L+   D +L+
Sbjct: 275 GHTSSVSCVRWGGQNMLYTGSHDKTIRVWDMNSNGRCINILKSHAHWVNHLSLSTDYALR 334

Query: 164 SLSMASDGSMLAAAN-------------TKGNCYVWE-MPNHTDASHL---------KPV 200
                  G+  A A               K N +  E M   +D   +         KP+
Sbjct: 335 IGPFDHSGAKPAIAEEARDKALKNYEKIVKKNGHTEELMVTASDDFTMFLWNPLKSTKPL 394

Query: 201 TKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSA 260
            +   H   +  +  S D +H+ + S D++ ++W    D K  +T  GH   V+  A+S+
Sbjct: 395 ARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWD-GRDGKFISTFRGHVASVYQVAWSS 453

Query: 261 DSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           D   LV+ S D  +++WD+ T+++     GH 
Sbjct: 454 DCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHQ 485

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 117/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    S V+ +       L   +  + +R++D+  +N
Sbjct: 250 LASASKDGTIKVWDTTGRVCLYTLSGHTSSVSCVRWGGQNMLYTGSHDKTIRVWDM-NSN 308

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN-EVV 123
              +   + H   V  +S   D    +   +    K      P+I    +  A  N E +
Sbjct: 309 GRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAK------PAIAEEARDKALKNYEKI 362

Query: 124 IHPN---QGELISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
           +  N   +  +++   D  + +W+ L   +   ++T      +  ++ + DG  + +A+ 
Sbjct: 363 VKKNGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKL-VNHVAFSPDGRHIVSASF 421

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H   + ++  SSD + L +CS D T +VW +   
Sbjct: 422 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK 475

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  VRLW
Sbjct: 476 -KLSVDLPGHQDEVFTVDWSVDGKRVCSGGKDKMVRLW 512

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D T+  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 372 LMVTASDDFTMFLWNPLKSTKPLARMTGH-QKLVNHVAFSPDGRHIVSASFDNSIKLWDG 430

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 431 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHQDEV 488

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 489 FTVDWSVDGKRVCSGGKDKMVRLW 512

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAF 258
           P+     HS ++  +  S D + +AT S D+T R+W+  +   +  +L GH +W+   A+
Sbjct: 177 PMATLSGHSNWVLCVAWSPDAEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAW 236

Query: 259 S-------ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
                        L +AS D  +++WD + R  +    GH     CV
Sbjct: 237 EPLHLVKVGQKPRLASASKDGTIKVWDTTGRVCLYTLSGHTSSVSCV 283

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLE------T 244
           +T +  ++P     A +  IT  L SS +K     + D    +++    FK++      +
Sbjct: 77  YTFSCSIQPKKNEPAKTIDITDNLYSSLLKPGYNTTEDIITLIYTPRAVFKVKPVTRSSS 136

Query: 245 TLDGHQRWVWDCAFSADSA-YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
            + GH   +   AF+ +S+  +VT + D+  RLWD  T+  +    GH    +CVA
Sbjct: 137 AIAGHGSTILCSAFAPNSSSRMVTGAGDNTARLWDCDTQTPMATLSGHSNWVLCVA 192

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 100/215 (46%), Gaps = 13/215 (6%)

Query: 74  HRGNVTSVSFQQDNRWMVTSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELI 132
            +GN+T   F  D + ++ S     + V+D + + S    Y+H   +  + ++     LI
Sbjct: 16  RQGNLT---FSDDGKQLI-SPVGNRVSVFDLINNKSFTFEYEHRKNIAAIDLNKQGTLLI 71

Query: 133 SCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT 192
           S D DG   + +       H    ++  S  ++  + DG + A A+ +    +W+ P+  
Sbjct: 72  SIDEDGRAILVNFKARNVLHHFNFKERCS--AVKFSPDGRLFALASGRF-LQIWKTPDVN 128

Query: 193 DASHLKPVTKFRAHSTY---ITRILLSSDVKHLATCSADHTARVWSIDDDFK--LETTLD 247
                 P  ++R H+ +   IT +  S D + + T S D +A++WS+D + K    TT +
Sbjct: 129 RDRQFAPFVRYRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKSLAATTFN 188

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           GH+ +V    FS D   + T S D  V +W+ + R
Sbjct: 189 GHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKR 223

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 88/204 (43%), Gaps = 8/204 (3%)

Query: 35  VNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSS 94
           VN + + N  + LA    +  +L      + + +   +GH  +  S+++  D   +VT+S
Sbjct: 303 VNTVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTAS 362

Query: 95  EDGTIKVWDVRSPSIPRNY-KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQ 153
           +DG IKVWD+ S      + +H + V  V        + S   DG +R WDL   +    
Sbjct: 363 DDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRT 422

Query: 154 LTPEDDTSLQSLSMASDGSMLAAANTKG-NCYVWEMPNHTDASHLKPVTKFRAHSTYITR 212
            T  +      L++   G ++ A +    + +VW +         + +     H   ++ 
Sbjct: 423 FTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTG------QLLDALSGHEGPVSC 476

Query: 213 ILLSSDVKHLATCSADHTARVWSI 236
           +  S +   LA+ S D T R+WSI
Sbjct: 477 LSFSQENSVLASASWDKTIRIWSI 500

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 111/285 (38%), Gaps = 37/285 (12%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVAS-FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
           +L T+   + +++ + +   +  A+ F GHR  V    F  D   + T S+DG + VW+ 
Sbjct: 161 ILTTSKDLSAKIWSVDSEEKSLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEF 220

Query: 105 --------------------------RSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDG 138
                                     R  S    Y + + V  V  HP    L      G
Sbjct: 221 TKRSTNDDESEDDDEEEEVDISKYSWRITSKHFFYANQSKVKCVTFHPATRLLAVGFTTG 280

Query: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK-GNCYVWEMPNHTDASHL 197
             R++D+ +     QL+   +  + ++S+ + G  LA  ++K G   V+E  + +     
Sbjct: 281 EFRLYDMPDFTLIQQLSMGQN-PVNTVSVNNTGEWLAFGSSKLGQLLVYEWQSES----- 334

Query: 198 KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257
             + K + H      +  S D   + T S D   +VW I   F L  T + H   V    
Sbjct: 335 -YILKQQGHFDSTNSLAYSPDGSRVVTASDDGKIKVWDITSGFCL-ATFEEHTSSVTAVQ 392

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV-CVALN 301
           F+     + ++S D  VR WDL      R + G  +    C+A++
Sbjct: 393 FAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD 437

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 100/232 (43%), Gaps = 16/232 (6%)

Query: 56  RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM-VTSSEDGTIKVWDVRSPS-IPRNY 113
           RLYD+   +   +      +  V +VS      W+   SS+ G + V++ +S S I +  
Sbjct: 283 RLYDM--PDFTLIQQLSMGQNPVNTVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQ 340

Query: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSM 173
            H    N +   P+   +++   DG I++WD+    C      E  +S+ ++  A  G +
Sbjct: 341 GHFDSTNSLAYSPDGSRVVTASDDGKIKVWDITSGFCLATF-EEHTSSVTAVQFAKRGQV 399

Query: 174 LAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSA---DHT 230
           + +++  G    W++  + +        + + +        L+ D      C+    +  
Sbjct: 400 MFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNC-------LAVDPSGEVVCAGSLDNFD 452

Query: 231 ARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
             VWS+    +L   L GH+  V   +FS +++ L +AS D  +R+W +  R
Sbjct: 453 IHVWSVQTG-QLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGR 503

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/302 (17%), Positives = 118/302 (39%), Gaps = 49/302 (16%)

Query: 38  LEITNDKKLLATAGHQNVRLYDIRTTNPN----PVASFE---GHRGNVTSVSFQQDNRWM 90
           ++ + D +L A A  + ++++     N +    P   +    GH  ++TS+++ QD+R++
Sbjct: 102 VKFSPDGRLFALASGRFLQIWKTPDVNRDRQFAPFVRYRVHAGHFQDITSLTWSQDSRFI 161

Query: 91  VTSSEDGTIKVWDV----RSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
           +T+S+D + K+W V    +S +      H   V       +Q ++ +  +DG + +W+  
Sbjct: 162 LTTSKDLSAKIWSVDSEEKSLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFT 221

Query: 147 ENQC------------------------THQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
           +                           +      + + ++ ++      +LA   T G 
Sbjct: 222 KRSTNDDESEDDDEEEEVDISKYSWRITSKHFFYANQSKVKCVTFHPATRLLAVGFTTGE 281

Query: 183 CYVWEMPNHTDASHL----KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDD 238
             +++MP+ T    L     PV     ++T       SS +  L        + +     
Sbjct: 282 FRLYDMPDFTLIQQLSMGQNPVNTVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQG 341

Query: 239 DFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
            F    +L          A+S D + +VTAS D  +++WD+++   +  +  H      V
Sbjct: 342 HFDSTNSL----------AYSPDGSRVVTASDDGKIKVWDITSGFCLATFEEHTSSVTAV 391

Query: 299 AL 300
             
Sbjct: 392 QF 393

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 79/190 (41%), Gaps = 7/190 (3%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYD-IRT 62
           +V+A  D  I+ W+  +G C  T +   S V  ++     +++ ++     VR +D IR 
Sbjct: 358 VVTASDDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRY 417

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
            N       E  + N  +V           S ++  I VW V++  +      H  PV+ 
Sbjct: 418 RNFRTFTGTERIQFNCLAVD-PSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSC 476

Query: 122 VVIHPNQGELISCDRDGNIRIWDL-GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +        L S   D  IRIW + G +Q    L    D  + +LSM  DG  +A +  K
Sbjct: 477 LSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVYSD--VLALSMRPDGKEVAVSTLK 534

Query: 181 GNCYVWEMPN 190
           G   ++ + +
Sbjct: 535 GQISIFNIED 544

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 67/145 (46%), Gaps = 4/145 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           ++ S+  D T+R W+ +     RT   ++  Q N L +    +++      N  ++    
Sbjct: 399 VMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 458

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV--RSPSIPRNYKHNAPVN 120
                + +  GH G V+ +SF Q+N  + ++S D TI++W +  RS  +    +  + V 
Sbjct: 459 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQV-EPLEVYSDVL 517

Query: 121 EVVIHPNQGELISCDRDGNIRIWDL 145
            + + P+  E+      G I I+++
Sbjct: 518 ALSMRPDGKEVAVSTLKGQISIFNI 542

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/330 (23%), Positives = 146/330 (44%), Gaps = 46/330 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +    + +++AT    N +RL+D +  
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSIPRNYKH 115
            P   A   GH   +TS++++        ++  + ++S+DGTI++WD+ R   +     H
Sbjct: 219 KPLGDA-LRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGH 277

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDL-GENQC----------THQLTPEDDTSLQS 164
              V+  +    QG + S   D  +R+WD+  + +C           + L+   D +L+ 
Sbjct: 278 TNSVS-CIKWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRV 336

Query: 165 LSMASDGSMLAAAN-------------TKGNCYVWE-MPNHTDASHL---------KPVT 201
            +    G+  A+A               K N  + E M   +D   +         KP+ 
Sbjct: 337 GAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIA 396

Query: 202 KFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSAD 261
           +   H   +  +  S D +++ + S D++ ++W    D K  +T  GH   V+  A+SAD
Sbjct: 397 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFISTFRGHVASVYQVAWSAD 455

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
              LV+ S D  +++WD+ TR++     GH
Sbjct: 456 CRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 73.2 bits (178), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 122/295 (41%), Gaps = 57/295 (19%)

Query: 45  KLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
           +++  AG    R++D  T  P   A+  GH   V  VS+  +   + T S D TI++WD 
Sbjct: 158 RMVTGAGDNTARIWDCDTQTPK--ATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDS 215

Query: 105 R--SPSIPRNYKHNAPVNEVVIHP----NQGE---LISCDRDGNIRIWDLGENQCTHQLT 155
           +   P       H   +  +   P      GE   L S  +DG IRIWD+    C + ++
Sbjct: 216 KDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMS 275

Query: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215
              + S+  +  +  G + + ++ K    VW+M  + D    K +   ++H+ ++  + L
Sbjct: 276 GHTN-SVSCIKWSGQGIIYSGSHDK-TVRVWDM--NADG---KCINILKSHAHWVNHLSL 328

Query: 216 SSD--------------------------------VKH-------LATCSADHTARVWSI 236
           S+D                                VK        + T S D T  +W+ 
Sbjct: 329 STDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNP 388

Query: 237 DDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
               K    + GHQ+ V   AFS D  Y+V+AS D+ ++LWD    + +  + GH
Sbjct: 389 LKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGH 443

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 120/278 (43%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L SA  D TIR W+    VC  T+    + V+ ++ +    + + +  + VR++D+   +
Sbjct: 251 LASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDM-NAD 309

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              +   + H   V  +S   D    V + +    +      P+  ++ +  A  N   +
Sbjct: 310 GKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQ------PASAKDARDKALANYEKV 363

Query: 125 HPNQGEL----ISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
               G+L    ++   D  + +W+ L  N+   ++T      +  ++ + DG  + +A+ 
Sbjct: 364 VKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H   + ++  S+D + L +CS D T +VW +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VR+W
Sbjct: 477 -KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEALTG--VCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D T+  W  L      +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPIARMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +RIW
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAF 258
           P      H  ++  +    + + +AT S D+T R+W   D   L   L GH +W+   A+
Sbjct: 178 PKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAW 237

Query: 259 S-------ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
                    +S  L +AS D  +R+WD++ R  +    GH     C+
Sbjct: 238 EPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCI 284

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 197 LKPVTKFRA-----HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+  +      ST +      +    + T + D+TAR+W  D     + TL GH  
Sbjct: 129 VKPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTP-KATLTGHFN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWD 278
           WV   ++  +   + T S D+ +RLWD
Sbjct: 188 WVLCVSYCPNGEVIATGSMDNTIRLWD 214

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDDDFKLE------TTLDGHQRWVWDCAFSAD-S 262
           IT  L SS +K     + D    +++    FK++      + + GH   +   AF+ + S
Sbjct: 97  ITDNLYSSILKPGYRTTEDIITLIYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPNTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + +VT + D+  R+WD  T+       GH    +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVS 193

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 105/276 (38%), Gaps = 31/276 (11%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSFQQ--DNRW 89
           +N L+ T D   +ATA   N  +   ++         A F GH  +VTSVS     +N W
Sbjct: 333 LNSLDATEDGLWIATASKDNTAMLWRFNDSENKFKKYAQFIGHASSVTSVSLPNVINNGW 392

Query: 90  ---MVTSSEDGTIKVWDVRSPSIPRN---------------YKHNAPVNEVVIHPNQGEL 131
              ++TSS D T+K W V SP+   +                 H   +N + I PN    
Sbjct: 393 PEFIITSSNDFTVKKWKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIF 452

Query: 132 ISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNH 191
            +   D   +IWDL   +    L       L  +S       +A A+      +W +   
Sbjct: 453 ATASYDKTCKIWDLDSGELMATLANHK-RGLWDVSFCQYDKYIATASGDKTIKIWSLET- 510

Query: 192 TDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQR 251
                 K V     H+  + R    +  K + +  AD   ++W       L+T LDGH  
Sbjct: 511 -----FKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKT-LDGHAN 564

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQ 287
            +W      D   ++TA +D   + W   T E+  Q
Sbjct: 565 RIWALCVLRDGDMIITADADGVFQFWKDCTEEVKEQ 600

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 98/235 (41%), Gaps = 42/235 (17%)

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
           P  V  ++GH   + S+   +D  W+ T+S+D T  +W  R       +K  A   + + 
Sbjct: 320 PLGVELYDGHEDLLNSLDATEDGLWIATASKDNTAMLW--RFNDSENKFKKYA---QFIG 374

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCY 184
           H +    +S     N   W            PE                +  ++      
Sbjct: 375 HASSVTSVSLPNVIN-NGW------------PE---------------FIITSSNDFTVK 406

Query: 185 VWEMPNHTDAS------HLKPVTKF--RAHSTYITRILLSSDVKHLATCSADHTARVWSI 236
            W++P+ T  S      HL  V+++  RAH   I  + ++ +    AT S D T ++W +
Sbjct: 407 KWKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDL 466

Query: 237 DDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           D   +L  TL  H+R +WD +F     Y+ TAS D  +++W L T ++V    GH
Sbjct: 467 DSG-ELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGH 520

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 70/157 (44%), Gaps = 8/157 (5%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATA-GHQNVRLYDIRT 62
           I  +A YD T + W+  +G    T+ +    +  +      K +ATA G + ++++ + T
Sbjct: 451 IFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLET 510

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
                V + EGH   V   SF    + +V++  DG IK+WD  S    +    H   +  
Sbjct: 511 F--KVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWA 568

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
           + +  +   +I+ D DG  + W      CT ++  +D
Sbjct: 569 LCVLRDGDMIITADADGVFQFW----KDCTEEVKEQD 601

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 20/151 (13%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV-- 219
           L SL    DG  +A A+      +W   +  +    K   +F  H++ +T + L + +  
Sbjct: 333 LNSLDATEDGLWIATASKDNTAMLWRFNDSEN--KFKKYAQFIGHASSVTSVSLPNVINN 390

Query: 220 ---KHLATCSADHTARVWSI---------DDDFKL----ETTLDGHQRWVWDCAFSADSA 263
              + + T S D T + W +         DDD  L    E T   H++ +   + + + +
Sbjct: 391 GWPEFIITSSNDFTVKKWKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDS 450

Query: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
              TAS D   ++WDL + E++     H +G
Sbjct: 451 IFATASYDKTCKIWDLDSGELMATLANHKRG 481

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 94/241 (39%), Gaps = 44/241 (18%)

Query: 71  FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE 130
           F+    NV+          + T SEDG+I    + +P +         +N V +  N G 
Sbjct: 3   FKSSYSNVSLSPIYASTGAVATISEDGSI----LATPVVDE-------INIVALEDNAGN 51

Query: 131 ---LISCDRD--------GNIRIWDLGENQCTHQLTPEDDT--SLQSLSMASDGSMLAAA 177
              L + + D        G + + D+ EN  TH L     T  SL+    + D   L A+
Sbjct: 52  GTLLTTVENDDEQDXXXGGPVSVLDI-ENYITHSLKGHGATISSLKFYGESEDSVWLLAS 110

Query: 178 NTKGNCYVWEMPN----HTDASHLKPV--TKFRAHSTYITRILLSSDVKHLATCSADHTA 231
                  VW++      HT   H   V    F+  ST        SD+ HL T   D+  
Sbjct: 111 GDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSST-------DSDIIHLVTGGRDNII 163

Query: 232 RVWSID--DDFKLETTLDGHQRWVWDCAF---SADSAYLVTASSDHYVRLWDLSTREIVR 286
             W+I    +FKL  T   HQ+ V  C F   + D   + TA  D   ++  LS   +++
Sbjct: 164 NHWTISGLKNFKLIRTFPVHQQ-VEACGFIKSTEDDNCIYTAGGDAVFQILSLSNGSVIK 222

Query: 287 Q 287
           +
Sbjct: 223 K 223

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 62/305 (20%), Positives = 111/305 (36%), Gaps = 72/305 (23%)

Query: 70  SFEGHRGNVTSVSF---QQDNRWMVTSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIH 125
           S +GH   ++S+ F    +D+ W++ S +   +KVWD V+   I    +H++ V  +   
Sbjct: 84  SLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFK 143

Query: 126 PNQGE-----LISCDRDGNIRIWDLGE----------------NQCTHQLTPEDDTSL-- 162
            +  +     L++  RD  I  W +                    C    + EDD  +  
Sbjct: 144 QSSTDSDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQQVEACGFIKSTEDDNCIYT 203

Query: 163 -------QSLSMASDGSMLAAAN-------------TKGNCYVWEMPNHTDASHLKPVTK 202
                  Q LS+ S+GS++                  K    ++ + +      +  +  
Sbjct: 204 AGGDAVFQILSL-SNGSVIKKTKKPTEELFIIGVLPIKNFTKLYLVLSDQTLQLIDLIDT 262

Query: 203 FRAHSTYIT--------------RILLSSDVKHLATCSADHTARVWS-IDDDFKLETTL- 246
           F   S  IT                L+  ++K +A  +   T R+   I +D K    L 
Sbjct: 263 FEEDSEIITIKSSIAGNHGTIADMRLVGPELKSIALATNSPTLRIIPVISEDNKNNIPLG 322

Query: 247 ----DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE----IVRQYGGHHKGAVCV 298
               DGH+  +     + D  ++ TAS D+   LW  +  E       Q+ GH      V
Sbjct: 323 VELYDGHEDLLNSLDATEDGLWIATASKDNTAMLWRFNDSENKFKKYAQFIGHASSVTSV 382

Query: 299 ALNDV 303
           +L +V
Sbjct: 383 SLPNV 387

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 75.5 bits (184), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 134/301 (44%), Gaps = 38/301 (12%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L+ +  + +R
Sbjct: 31  LLLSASRDKTLISWK-LTGNDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTLR 89

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+++ T        F GH+ +V SV+  +    +++ S D TIKVW ++   +     HN
Sbjct: 90  LWNVAT--GETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGDCLATMLGHN 147

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             V++V + PN+ E      LIS   D  ++ W++ + Q        ++  + +++ + D
Sbjct: 148 DWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNVNQFQIEADFVGHNNY-INTITASPD 206

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHT 230
           G+++A+A   G+  +W +   +      P+    A        L  S  ++  T +    
Sbjct: 207 GTLIASAGKDGDIMLWNLKEKS------PLYTLNAQDEVFA--LAFSPNRYWLTAATSSG 258

Query: 231 ARVWSID-----DDFKLETT-----LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
            +V+ ++     D+ K E T      D H       A+SAD   L    +D+ +R+W + 
Sbjct: 259 IKVFDLEEKKLIDELKPEFTGFNKAADPHAV---SLAWSADGQTLFAGYTDNVIRVWQVM 315

Query: 281 T 281
           T
Sbjct: 316 T 316

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 55/104 (52%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHLA-TCSADHTARVWSI---DDDFKLET-TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +   D  + +   +  GH   V DCA
Sbjct: 12  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQDCA 71

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            +AD AY ++AS D  +RLW+++T E  +++ GH    + VA++
Sbjct: 72  LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAID 115

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 103/228 (45%), Gaps = 24/228 (10%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVWDV----RSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  ++++S D T+  W +    +   +P R++K H+  V 
Sbjct: 10  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQ 68

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +  +  +    +S   D  +R+W++   + T+Q      + + S+++    SM+ + +  
Sbjct: 69  DCALTADGAYALSASWDKTLRLWNVATGE-TYQRFTGHKSDVMSVAIDRKASMIISGSRD 127

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSS------DVKHLATCSADHTARVW 234
               VW +     A+ L        H+ +++++ ++       +   L +   D   + W
Sbjct: 128 KTIKVWTIKGDCLATML-------GHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAW 180

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +++  F++E    GH  ++     S D   + +A  D  + LW+L  +
Sbjct: 181 NVNQ-FQIEADFVGHNNYINTITASPDGTLIASAGKDGDIMLWNLKEK 227

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 75/189 (39%), Gaps = 19/189 (10%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDLGENQCTHQLTPEDDTS----LQSLSMAS 169
           HN  V  +     Q  L+ S  RD  +  W L  N   + +           +Q  ++ +
Sbjct: 15  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQDCALTA 74

Query: 170 DGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADH 229
           DG+   +A+      +W +         +   +F  H + +  + +      + + S D 
Sbjct: 75  DGAYALSASWDKTLRLWNVATG------ETYQRFTGHKSDVMSVAIDRKASMIISGSRDK 128

Query: 230 TARVWSIDDDFKLETTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTRE 283
           T +VW+I  D     T+ GH  WV     +       ++  L++A  D  V+ W+++  +
Sbjct: 129 TIKVWTIKGD--CLATMLGHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNVNQFQ 186

Query: 284 IVRQYGGHH 292
           I   + GH+
Sbjct: 187 IEADFVGHN 195

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 140/339 (41%), Gaps = 62/339 (18%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++AT    N +RL++ +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVSWSPDGEVIATGSMDNTIRLWNPKTG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSIPR--NYK 114
                A   GH   +T +S++            + +SS+DGTIK+WD    S+ R   Y 
Sbjct: 219 ECLGDA-LRGHSKWITCLSWEPIHLVKPGSKPRLASSSKDGTIKIWD----SVNRVCQYT 273

Query: 115 HNAPVNEV--VIHPNQGELISCDRDGNIRIWDL-GENQCTHQLT---------------- 155
            +   N V  V    QG L S   D  +R+WD+  + +C + L                 
Sbjct: 274 LSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYA 333

Query: 156 ------------PEDDTSLQSLSM----------ASDGSMLAAANTKGNCYVWEMPNHTD 193
                       P      Q  ++           S   M+  A+     ++W     T 
Sbjct: 334 LRVGAFDHTGKKPATSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKST- 392

Query: 194 ASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV 253
               KP+ +   H   +  +  S D +++ + S D++ ++W    D K  +T  GH   V
Sbjct: 393 ----KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFISTFRGHVASV 447

Query: 254 WDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +  A+S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 448 YQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQ 486

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 117/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L S+  D TI+ W+++  VC  T+    + V+ ++      L + +  + VR++D+ +  
Sbjct: 251 LASSSKDGTIKIWDSVNRVCQYTLSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQG 310

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              +   + H   V  +S   D    V + +    K      P+     +  A  N   I
Sbjct: 311 -RCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKK------PATSEEAQKKALENYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
               G     +++   D  + +W+ L   +   ++T      +  ++ + DG  + +A+ 
Sbjct: 364 CKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H   + ++  SSD + L +CS D T +VW +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D T+  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 MMVTASDDFTMFLWNPLKSTKPIARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 7/109 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+   A + + + IL S+   H    + T + D+TAR+W  D    +  TL GH  
Sbjct: 129 VKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMH-TLKGHFN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQ-YGGHHKGAVCVA 299
           WV   ++S D   + T S D+ +RLW+  T E +     GH K   C++
Sbjct: 188 WVLCVSWSPDGEVIATGSMDNTIRLWNPKTGECLGDALRGHSKWITCLS 236

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV----W 254
           P+   + H  ++  +  S D + +AT S D+T R+W+      L   L GH +W+    W
Sbjct: 178 PMHTLKGHFNWVLCVSWSPDGEVIATGSMDNTIRLWNPKTGECLGDALRGHSKWITCLSW 237

Query: 255 D---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +            L ++S D  +++WD   R       GH     CV
Sbjct: 238 EPIHLVKPGSKPRLASSSKDGTIKIWDSVNRVCQYTLSGHTNSVSCV 284

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDDDFKLE------TTLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    FK++      + + GH   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGFNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + +VT + D+  R+WD  T+  +    GH    +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVS 193

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 76.3 bits (186), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 141/334 (42%), Gaps = 54/334 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +    + +++AT    N +RL++ ++ 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHTNWVLCVSWCPNGEVIATGSMDNTIRLWEGKSG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
            P   A   GH   +TS++++        +   + ++S+DGTIK+WD            +
Sbjct: 219 KPVGDA-LRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDTSRRVCLYTLSGH 277

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL-GENQCTHQL--------------------- 154
                 +    QG L S   D  +R WD+  E +C + L                     
Sbjct: 278 TNSVSCIKWGGQGILYSGSHDKTVRAWDMNSEGRCINVLKSHAHWVNHLSLSTDYALRVG 337

Query: 155 ----------TPED--DTSLQSLS--MASDG---SMLAAANTKGNCYVWEMPNHTDASHL 197
                     +PED  D +L++    +  +G    ++  A+     ++W     T     
Sbjct: 338 PFDHTGVEPTSPEDARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKST----- 392

Query: 198 KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257
           KP+ +   H   +  +  S D +++ + S D++ ++W    D K  +T  GH   V+  A
Sbjct: 393 KPLGRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFISTFRGHVASVYQVA 451

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           +SAD   LV+ S D  +++WD+ TR++     GH
Sbjct: 452 WSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 118/295 (40%), Gaps = 57/295 (19%)

Query: 45  KLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
           +++  AG    R++D  T  P   A+  GH   V  VS+  +   + T S D TI++W+ 
Sbjct: 158 RMVTGAGDNTARIWDCDTQTPK--ATLTGHTNWVLCVSWCPNGEVIATGSMDNTIRLWEG 215

Query: 105 RS--PSIPRNYKHNAPVNEVVIHP-------NQGELISCDRDGNIRIWDLGENQCTHQLT 155
           +S  P       H   +  +   P        Q  L S  +DG I+IWD     C + L+
Sbjct: 216 KSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDTSRRVCLYTLS 275

Query: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215
              + S+  +     G + + ++ K     W+M      S  + +   ++H+ ++  + L
Sbjct: 276 GHTN-SVSCIKWGGQGILYSGSHDK-TVRAWDM-----NSEGRCINVLKSHAHWVNHLSL 328

Query: 216 SSD--------------------------------VKH-------LATCSADHTARVWSI 236
           S+D                                VK        + T S D T  +W+ 
Sbjct: 329 STDYALRVGPFDHTGVEPTSPEDARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNP 388

Query: 237 DDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
               K    + GHQ+ V   AFS D  Y+V+AS D+ ++LWD    + +  + GH
Sbjct: 389 LKSTKPLGRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGH 443

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/278 (21%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    + V+ ++      L + +  + VR +D+ +  
Sbjct: 251 LASASKDGTIKIWDTSRRVCLYTLSGHTNSVSCIKWGGQGILYSGSHDKTVRAWDMNSEG 310

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN-EVV 123
              +   + H   V  +S   D    V   +   ++      P+ P + +  A  N E V
Sbjct: 311 -RCINVLKSHAHWVNHLSLSTDYALRVGPFDHTGVE------PTSPEDARDKALKNYEKV 363

Query: 124 IHPN---QGELISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
           +  N   +  +++   D  + +W+ L   +   ++T      +  ++ + DG  + +A+ 
Sbjct: 364 VKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H   + ++  S+D + L +CS D T +VW +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VR+W
Sbjct: 477 -KLSVDLPGHKDEVFTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D T+  W  L  T    R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 LMVTASDDFTMFLWNPLKSTKPLGRMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +RIW
Sbjct: 490 FTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 46/107 (42%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAF 258
           P      H+ ++  +    + + +AT S D+T R+W       +   L GH +W+   A+
Sbjct: 178 PKATLTGHTNWVLCVSWCPNGEVIATGSMDNTIRLWEGKSGKPVGDALRGHLKWITSLAW 237

Query: 259 -------SADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
                  + +   L +AS D  +++WD S R  +    GH     C+
Sbjct: 238 EPIHLVKAGEQPRLASASKDGTIKIWDTSRRVCLYTLSGHTNSVSCI 284

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 7/103 (6%)

Query: 197 LKPVTKFRA-----HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQR 251
           ++PVT+  +      ST +      +    + T + D+TAR+W  D     + TL GH  
Sbjct: 129 VRPVTRSSSAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARIWDCDTQTP-KATLTGHTN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWD-LSTREIVRQYGGHHK 293
           WV   ++  +   + T S D+ +RLW+  S + +     GH K
Sbjct: 188 WVLCVSWCPNGEVIATGSMDNTIRLWEGKSGKPVGDALRGHLK 230

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 116/256 (45%), Gaps = 26/256 (10%)

Query: 45  KLLATAGHQNVRLYDI-----RTTNPNPVASF----EGHRGNVTSVSFQQDNRWMVTSSE 95
           +L+ T     +  Y I        NP+P   +    +GHR ++ S+    DN+ ++ S+ 
Sbjct: 348 ELVVTTSSNTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNK-LLASAS 406

Query: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155
           +G +K+W++++ S  R +     +    + P+    +   R+G I+++DL  +     + 
Sbjct: 407 NGLLKIWNLKTKSCIRTFDCGYALTCKFL-PSGTLCVIGTREGQIQLFDLVTSTLIESID 465

Query: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208
              + ++ SL +  DG  L   +   +   W        +P  TD     PV K    +T
Sbjct: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD--KFVPVMKLIHDTT 523

Query: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263
                 I  + +S + K+LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDS-MKFFLSLYGHKLPVLSIDISFDSK 582

Query: 264 YLVTASSDHYVRLWDL 279
            ++T+S+D  +++W L
Sbjct: 583 LIITSSADKNIKIWGL 598

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/283 (20%), Positives = 122/283 (43%), Gaps = 28/283 (9%)

Query: 35  VNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSS 94
           +  ++I++D KLLA+A +  +++++++T   + + +F+   G   +  F       V  +
Sbjct: 390 IRSIDISDDNKLLASASNGLLKIWNLKT--KSCIRTFDC--GYALTCKFLPSGTLCVIGT 445

Query: 95  EDGTIKVWDVRSPSIPR--NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ--- 149
            +G I+++D+ + ++    +  HNA +  + I  +   L++   D +I+ W+    Q   
Sbjct: 446 REGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLV 505

Query: 150 ------------CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHL 197
                         H  T E +  + S+ ++ +   LA +       V+ + +      +
Sbjct: 506 PGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDS------M 559

Query: 198 KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257
           K       H   +  I +S D K + T SAD   ++W +D       +L  HQ  + +  
Sbjct: 560 KFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG-DCHKSLFAHQDSIMNVC 618

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           F  +S    ++S D  V+ WD    E V++   H      +A+
Sbjct: 619 FLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI 661

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135
           ++ SV    +++++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 529 DILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            D NI+IW L    C   L    D S+ ++    +     +++  G    W      D  
Sbjct: 589 ADKNIKIWGLDFGDCHKSLFAHQD-SIMNVCFLPESHNFFSSSKDGLVKYW------DGD 641

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             + V K  AH + +  + ++SD   + + S DH+ RVW   DD
Sbjct: 642 KFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDD 685

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 11/125 (8%)

Query: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90
           ++V  LE  ++  LLA AG+ +  ++++D+ +     + SF GH+  VT + F      +
Sbjct: 78  AEVTYLEYHDETNLLA-AGYADGVIKIWDLMS--KTVLLSFSGHKSGVTILKFDSTGTRL 134

Query: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGE 147
           ++ S D  I +WD+ S   + +   H   +  +     +GE  L+S  +DG I++WDL  
Sbjct: 135 MSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC---EGEDWLVSTAKDGLIKLWDLKT 191

Query: 148 NQCTH 152
            QC  
Sbjct: 192 QQCVE 196

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 99/215 (46%), Gaps = 13/215 (6%)

Query: 74  HRGNVTSVSFQQDNRWMVTSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELI 132
            +GN+T   F  D + ++ S     + V+D + + S    Y+H   +  + ++     LI
Sbjct: 16  RQGNIT---FSDDGKQLL-SPVGNRVSVFDLINNKSFTFEYEHRKNIAAIDLNKQGTLLI 71

Query: 133 SCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT 192
           S D DG   + +       H    ++  S  ++  + DG + A A+ +    +W+ P+  
Sbjct: 72  SIDEDGRAILVNFKARNVLHHFNFKEKCS--AVKFSPDGRLFALASGRF-LQIWKTPDVN 128

Query: 193 DASHLKPVTKFRAHSTY---ITRILLSSDVKHLATCSADHTARVWSIDDDFK--LETTLD 247
                 P  + R H+ +   IT +  S D + + T S D +A++WS+D + K    TT +
Sbjct: 129 KDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFN 188

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           GH+ +V    FS D   + T S D  V +W+ + R
Sbjct: 189 GHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKR 223

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 112/287 (39%), Gaps = 39/287 (13%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVAS-FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
           +L T+   + +++ + +   N  A+ F GHR  V    F  D   + T S+DG + VW+ 
Sbjct: 161 ILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEF 220

Query: 105 -RSPSIPRN---------------------------YKHNAPVNEVVIHPNQGELISCDR 136
            + PS   +                           Y + A V  V  HP    L     
Sbjct: 221 TKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFT 280

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK-GNCYVWEMPNHTDAS 195
            G  R++DL +     QL+   +  + ++S+   G  LA  ++K G   V+E  + +   
Sbjct: 281 SGEFRLYDLPDFTLIQQLSMGQN-PVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSES--- 336

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
               + K + H      +  S D   + T S D   +VW I   F L  T + H   V  
Sbjct: 337 ---YILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCL-ATFEEHTSSVTA 392

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV-CVALN 301
             F+     + ++S D  VR WDL      R + G  +    C+A++
Sbjct: 393 VQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD 439

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 74/167 (44%), Gaps = 8/167 (4%)

Query: 72  EGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNEVVIHPNQGE 130
           +GH  +  S+++  D   +VT+SEDG IKVWD+ S      + +H + V  V        
Sbjct: 342 QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQV 401

Query: 131 LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKG-NCYVWEMP 189
           + S   DG +R WDL   +     T  +      L++   G ++ A +    + +VW + 
Sbjct: 402 MFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 461

Query: 190 NHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236
                   + +     H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 462 TG------QLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI 502

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 108/246 (43%), Gaps = 21/246 (8%)

Query: 45  KLLA---TAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM-VTSSEDGTIK 100
           +LLA   T+G    RLYD+   +   +      +  V +VS  Q   W+   SS+ G + 
Sbjct: 273 RLLAVGFTSGE--FRLYDL--PDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLL 328

Query: 101 VWDVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD 159
           V++ +S S I +   H    N +   P+   +++   DG I++WD+    C      E  
Sbjct: 329 VYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATF-EEHT 387

Query: 160 TSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV 219
           +S+ ++  A  G ++ +++  G    W++  + +        + + +        L+ D 
Sbjct: 388 SSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNC-------LAVDP 440

Query: 220 KHLATCSA---DHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
                C+    +    VWS+    +L   L GH+  V   +FS +++ L +AS D  +R+
Sbjct: 441 SGEVVCAGSLDNFDIHVWSVQTG-QLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRI 499

Query: 277 WDLSTR 282
           W +  R
Sbjct: 500 WSIFGR 505

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/238 (19%), Positives = 95/238 (39%), Gaps = 55/238 (23%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           +V+A  D  I+ W+  +G C                                        
Sbjct: 360 VVTASEDGKIKVWDITSGFC---------------------------------------- 379

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPV--NEV 122
              +A+FE H  +VT+V F +  + M +SS DGT++ WD+      R +     +  N +
Sbjct: 380 ---LATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCL 436

Query: 123 VIHPNQGELISCDRDGN--IRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
            + P+ GE++      N  I +W +   Q    L+  +   +  LS + + S+LA+A+  
Sbjct: 437 AVDPS-GEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEG-PVSCLSFSQENSVLASASWD 494

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDD 238
               +W +   +    ++P+  +    + +  + +  D K +A  +      +++I+D
Sbjct: 495 KTIRIWSIFGRS--QQVEPIEVY----SDVLALSMRPDGKEVAVSTLKGQISIFNIED 546

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 67/145 (46%), Gaps = 4/145 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           ++ S+  D T+R W+ +     RT   ++  Q N L +    +++      N  ++    
Sbjct: 401 VMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 460

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV--RSPSIPRNYKHNAPVN 120
                + +  GH G V+ +SF Q+N  + ++S D TI++W +  RS  +    +  + V 
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQV-EPIEVYSDVL 519

Query: 121 EVVIHPNQGELISCDRDGNIRIWDL 145
            + + P+  E+      G I I+++
Sbjct: 520 ALSMRPDGKEVAVSTLKGQISIFNI 544

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 124/319 (38%), Gaps = 68/319 (21%)

Query: 21  TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTS 80
           T +CS    H+ S+V           +   G    R++D  T  P    +  GHR  V  
Sbjct: 147 TILCSAFAPHTSSRV-----------VTGGGDNTARIWDCDTQTPK--VTLNGHRNWVLC 193

Query: 81  VSFQQDNRWMVTSSEDGTIKVWDVRS--PSIPRNYKHNAPVNEVVIHP-------NQGEL 131
           VS+  D   + T S D TI++WD  S  P       H+  +  +   P       ++  L
Sbjct: 194 VSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRL 253

Query: 132 ISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNH 191
            S  +DG IRIWD     C   L    + S+  +    +G + + ++ K     W+M  +
Sbjct: 254 ASASKDGTIRIWDSSRRVCLMTLGGHTN-SVSCVKWGGEGILYSGSHDK-TVRAWDMKQN 311

Query: 192 TDASHLKPVTKFRAHSTYITRILLSSDV-------------------------------- 219
                 K +   ++H+ ++  + LS+D                                 
Sbjct: 312 G-----KCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVA 366

Query: 220 ----KH---LATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDH 272
               KH   + T S D T  +W+     K  + + GHQ+ V   AFS D  Y+V+AS D+
Sbjct: 367 RKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDN 426

Query: 273 YVRLWDLSTREIVRQYGGH 291
            ++LWD      +  + GH
Sbjct: 427 SIKLWDGKEGTFLSTFRGH 445

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/335 (22%), Positives = 140/335 (41%), Gaps = 54/335 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+ G D+T R W+  T     T+    + V  +  + D +++AT    N +RL+D  + 
Sbjct: 161 VVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESG 220

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
            P   A   GH   +TS++++            + ++S+DGTI++WD            +
Sbjct: 221 KPLGDA-LRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGH 279

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGEN-QCTHQLT-------------------- 155
                 V    +G L S   D  +R WD+ +N +C + L                     
Sbjct: 280 TNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVG 339

Query: 156 --------PED-----DTSLQSLSMASDGS-----MLAAANTKGNCYVWEMPNHTDASHL 197
                   P +     D +LQ+    +  +     ++  A+     ++W     T     
Sbjct: 340 AFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGT----- 394

Query: 198 KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257
           KP+++   H   +  +  S D K++ + S D++ ++W   +   L +T  GH   V+  A
Sbjct: 395 KPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFL-STFRGHVASVYQVA 453

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 454 WSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQ 488

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 108/279 (38%), Gaps = 61/279 (21%)

Query: 4   ILVSAGYDHTIRFWE-ALTGVCSRTIQHSDSQVNRLEITNDKKLLATA-GHQNVRLYDIR 61
           IL S  +D T+R W+    G C   ++     VN L ++ D  L   A  +  V+  + +
Sbjct: 293 ILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAK 352

Query: 62  TTNPNPVASFEG-HRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIP--RNYKHNAP 118
                 + ++E   R N       +    MVT+S+D T+ +W+    + P  R   H   
Sbjct: 353 EARDKALQNYEKVARKN------GKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKL 406

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN 178
           VN V   P+   ++S   D +I++WD                         +G+ L+   
Sbjct: 407 VNHVAFSPDGKYIVSASFDNSIKLWD-----------------------GKEGTFLST-- 441

Query: 179 TKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDD 238
                                   FR H   + ++  SSD + L +CS D T +VW +  
Sbjct: 442 ------------------------FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 477

Query: 239 DFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             KL   L GHQ  V+   +S D   + +   D  +RLW
Sbjct: 478 R-KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV----W 254
           P      H  ++  +  S+D + +AT S D+T R+W  +    L   L GH +W+    W
Sbjct: 180 PKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTW 239

Query: 255 D---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +            L +AS D  +R+WD S R  +   GGH     CV
Sbjct: 240 EPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCV 286

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 107/247 (43%), Gaps = 26/247 (10%)

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-----IPRNYKHNAPV 119
           P  V  +EGH   + S+   +D  W+ T+S+D T  VW     S       +   H+A V
Sbjct: 378 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAV 437

Query: 120 NEV----VIHPNQGE-LISCDRDGNIRIW---------DLGENQCTHQLTPEDDTSLQSL 165
             V    ++     E L++   D  I+ W         D+   + +       +  + +L
Sbjct: 438 TAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINAL 497

Query: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225
           S++ + S+ A A+    C +W + N    + L        H   +  +      K LAT 
Sbjct: 498 SVSPNDSIFATASYDKTCKIWNLENGELEATLA------NHKRGLWDVSFCQYDKLLATS 551

Query: 226 SADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S D T ++WS+D  F +  TL+GH   V  C+F      L++  +D  +++WD S+ E +
Sbjct: 552 SGDKTVKIWSLDT-FSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECL 610

Query: 286 RQYGGHH 292
           +   GH+
Sbjct: 611 KTLDGHN 617

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 104/262 (39%), Gaps = 27/262 (10%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF-----QQD 86
           +N L+ T D   +ATA   N  +   Y+  +   +  A + GH   VT+V       +  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGY 450

Query: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYK-----------HNAPVNEVVIHPNQGELISCD 135
             +++T+S D TIK W +  P+   + +           H   +N + + PN     +  
Sbjct: 451 PEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATAS 510

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            D   +IW+L EN             L  +S      +LA ++      +W +   +   
Sbjct: 511 YDKTCKIWNL-ENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMK 569

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWD 255
            L+       H+  + R    +  K L +C AD   ++W       L+T LDGH   +W 
Sbjct: 570 TLE------GHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKT-LDGHNNRLWA 622

Query: 256 CAFSADSAYLVTASSDHYVRLW 277
            +   D   +V+A +D   + W
Sbjct: 623 LSTMNDGDMIVSADADGVFQFW 644

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 76/378 (20%), Positives = 131/378 (34%), Gaps = 91/378 (24%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT----NDK---KLLATAGHQNVR 56
           +L S   +  ++ W+ +   C  T+Q   S V  L+I     ND+    LL+      + 
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIIN 221

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQD---NRWMVTSSEDGTIKVWDVRSPSIPRNY 113
           L+D        +         V S  F +D    R + T+  D   ++ D  S S+ +  
Sbjct: 222 LWDFNMKKKCKLLKTLPVNQQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLK-- 279

Query: 114 KHNAPVNEV----------------VIHPNQGELISCDRD---------------GN--- 139
           + N P+ E+                V+     +LI+ + D               GN   
Sbjct: 280 RTNKPIEELFIIGVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGI 339

Query: 140 ----------IRIWDLGENQCTHQLTPEDDTS-------------------LQSLSMASD 170
                     +    L  N  + ++ P  D S                   L SL    D
Sbjct: 340 IADMRYVGPELNKLALATNSPSLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATED 399

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV-----KHLATC 225
           G  +A A+      VW    + ++       K+  HS  +T + L + V     + L T 
Sbjct: 400 GLWIATASKDNTAIVWRY--NENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTA 457

Query: 226 SADHTARVWSIDD-----DFKL----ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
           S D T + W I       D ++    E T   H++ +   + S + +   TAS D   ++
Sbjct: 458 SNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKI 517

Query: 277 WDLSTREIVRQYGGHHKG 294
           W+L   E+      H +G
Sbjct: 518 WNLENGELEATLANHKRG 535

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 66/145 (45%), Gaps = 22/145 (15%)

Query: 25  SRTIQHS-----DSQVNRLEITNDKKLLATAGH-QNVRLYDIRTTNPNPVASFEGHRGNV 78
           SR I H      + ++  L++T D + L      Q ++++ ++T     V S +     +
Sbjct: 49  SRKILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKV--VRSMK-----I 101

Query: 79  TSVSFQQD----NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGE--- 130
           +S S+  D    +  +     DG+I V D+ +  I  ++K H   ++ +  +        
Sbjct: 102 SSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIW 161

Query: 131 -LISCDRDGNIRIWDLGENQCTHQL 154
            L S D +G +++WDL + +C H L
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTL 186

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 27/51 (52%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNV 55
           L+S G D  I+ W+  +G C +T+   ++++  L   ND  ++ +A    V
Sbjct: 590 LISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGV 640

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 131/291 (45%), Gaps = 52/291 (17%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRL-------YDIRTTNP---NPV 68
           +L  V   T  ++   +  LE +N+ KL A +G Q+  +       Y +   +    NP+
Sbjct: 505 SLPSVSIYTFHNTQKNMTSLEFSNNYKL-AASGFQDSYIKIWSLDGYPLSENDEMPNNPI 563

Query: 69  AS----FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVV 123
           +S    F GH G V S SF   + +++++SED T+++W V+      +YK H  PV +V 
Sbjct: 564 SSTCKTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVE 623

Query: 124 IHPNQGELI------------SCDRDGNIRIWD--LGENQCTHQLTPEDDTSLQSLSMAS 169
             P+   L             SCDR   +R+    L +  C              +S  S
Sbjct: 624 FSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDC--------------VSFHS 669

Query: 170 DGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADH 229
           +G  +   ++     +W++ N  D+  L     F  H++ +T + +S D K ++T S D 
Sbjct: 670 NGRYIFTGSSDKTVRMWDI-NTGDSVRL-----FMGHNSTVTSLSVSPDGKWISTGSDDG 723

Query: 230 TARVWSIDDDFKLETTLDGHQRW-VWDCAFSADSAYLVTASSDHYVRLWDL 279
              +W I    KL+  + GH +  +   +++ +   LV+  +D  VR+WDL
Sbjct: 724 IITIWDIGSGRKLKN-MRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 92/198 (46%), Gaps = 5/198 (2%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITND-KKLLATAGH-QNVRLYDIRT 62
           L+SA  D T+R W         + +  +  V  +E +     L ATA + Q  RL+    
Sbjct: 589 LLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDR 648

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
             P  V +  GH  +V  VSF  + R++ T S D T+++WD+ +    R +  HN+ V  
Sbjct: 649 VYPLRVMA--GHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTS 706

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKG 181
           + + P+   + +   DG I IWD+G  +    +     +S+ SLS   +G++L +     
Sbjct: 707 LSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQ 766

Query: 182 NCYVWEMPNHTDASHLKP 199
           +  VW++   T    L P
Sbjct: 767 SVRVWDLNKGTFEPSLTP 784

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62
           +  +A  D T R W        R +    + V+ +   +N + +   +  + VR++DI T
Sbjct: 631 LFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINT 690

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVN 120
            +   V  F GH   VTS+S   D +W+ T S+DG I +WD+ S    +N +    + ++
Sbjct: 691 GDS--VRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIH 748

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
            +  +P    L+S   D ++R+WDL +      LTPE+
Sbjct: 749 SLSYNPEGTLLVSGGADQSVRVWDLNKGTFEPSLTPEE 786

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 102/235 (43%), Gaps = 38/235 (16%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127
           + +F   + N+TS+ F  + +   +  +D  IK+W +             P++E    PN
Sbjct: 511 IYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSL----------DGYPLSENDEMPN 560

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
                +C            +    H  T      + S S ++    L +A+      +W 
Sbjct: 561 NPISSTC------------KTFIGHSGT------VYSTSFSAGDEYLLSASEDKTVRLWS 602

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHL-ATCSADHTARVWSIDDDFKLETTL 246
           + +       KP+  ++ H   +  +  S    +L AT S D TAR+WS D  + L   +
Sbjct: 603 VQDD------KPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRV-M 655

Query: 247 DGHQRWVWDC-AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
            GH   V DC +F ++  Y+ T SSD  VR+WD++T + VR + GH+     +++
Sbjct: 656 AGHLNDV-DCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSV 709

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 17/113 (15%)

Query: 197 LKPVTKFRAHSTY--ITRILLSSDVKHLATCSADHTARVWSIDDDFKLE----------- 243
           L  V+ +  H+T   +T +  S++ K  A+   D   ++WS+D  + L            
Sbjct: 506 LPSVSIYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSLDG-YPLSENDEMPNNPIS 564

Query: 244 ---TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
               T  GH   V+  +FSA   YL++AS D  VRLW +   + +  Y GH K
Sbjct: 565 STCKTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEK 617

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 113/265 (42%), Gaps = 46/265 (17%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSFQQDN---- 87
           +N ++ T D   LATA      +   YD  T    P A F GH  +VT+V          
Sbjct: 425 LNAVDATEDGLWLATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSVTAVGLPNVMLRHW 484

Query: 88  -RWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++T+S D TIK W++  PS                          D+   I +  + 
Sbjct: 485 PEFLLTASNDLTIKKWNIPKPS--------------------------DKMEGIHL--IK 516

Query: 147 ENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAH 206
            ++ T +   +D   + +LS++ + S+ A A+      +W++      + L        H
Sbjct: 517 GSEYTRRAHEKD---INALSVSPNDSVFATASYDKTSKIWDLETGELTATLA------NH 567

Query: 207 STYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLV 266
              +  +      K LATCS D T ++WS+D  F +  TL+GH   V  C F      LV
Sbjct: 568 KRGLWDVSFCQYDKLLATCSGDKTIKIWSLDT-FSVVRTLEGHTNAVQRCHFINKQTQLV 626

Query: 267 TASSDHYVRLWDLSTREIVRQYGGH 291
           ++ +D  +++WD S+ E V+   GH
Sbjct: 627 SSGADGLIKIWDCSSGECVKTLDGH 651

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 95/232 (40%), Gaps = 39/232 (16%)

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
           P  V  +EGH   + +V   +D  W+ T+S+D T  VW  R       +K   P  + + 
Sbjct: 412 PIDVDMYEGHEDLLNAVDATEDGLWLATASKDKTAIVW--RYDDETAKFK---PYAKFIG 466

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCY 184
           H +    +    +  +R W            PE                L  A+      
Sbjct: 467 HSSSVTAVGLP-NVMLRHW------------PE---------------FLLTASNDLTIK 498

Query: 185 VWEMPNHTD---ASHLKPVTKF--RAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
            W +P  +D     HL   +++  RAH   I  + +S +    AT S D T+++W ++  
Sbjct: 499 KWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETG 558

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            +L  TL  H+R +WD +F      L T S D  +++W L T  +VR   GH
Sbjct: 559 -ELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGH 609

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 74/167 (44%), Gaps = 5/167 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           +  +A YD T + W+  TG  + T+ +    +  +      KLLAT +G + ++++ + T
Sbjct: 540 VFATASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDT 599

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
              + V + EGH   V    F      +V+S  DG IK+WD  S    +    +A     
Sbjct: 600 F--SVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWA 657

Query: 123 VIHPNQGELI-SCDRDGNIRIW-DLGENQCTHQLTPEDDTSLQSLSM 167
           +     GELI S D DG  + W D  E Q    L  E +   Q  S+
Sbjct: 658 LTIQRDGELIASADADGVFQFWTDCSEQQREQDLEREKELVEQEQSL 704

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 64/148 (43%), Gaps = 17/148 (11%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV-- 219
           L ++    DG  LA A+      VW   + T  +  KP  KF  HS+ +T + L + +  
Sbjct: 425 LNAVDATEDGLWLATASKDKTAIVWRYDDET--AKFKPYAKFIGHSSSVTAVGLPNVMLR 482

Query: 220 ---KHLATCSADHTARVWSI---DDDFK-------LETTLDGHQRWVWDCAFSADSAYLV 266
              + L T S D T + W+I    D  +        E T   H++ +   + S + +   
Sbjct: 483 HWPEFLLTASNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFA 542

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG 294
           TAS D   ++WDL T E+      H +G
Sbjct: 543 TASYDKTSKIWDLETGELTATLANHKRG 570

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 73/170 (42%), Gaps = 31/170 (18%)

Query: 26  RTIQHSDSQ-VNRLEITNDKKLLA-TAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSF 83
           +TI + D Q +  L++T D K L  T+  Q +++ ++ T               ++S S+
Sbjct: 83  QTISNEDEQEITALKLTADGKYLCFTSQAQLLKIVEVATGKVM-------RSMKISSPSY 135

Query: 84  QQDNR----WMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI----HPNQGELISC 134
             D+      +     DG+I V D+ +  +  ++K H   ++ +      + N   L S 
Sbjct: 136 IMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASG 195

Query: 135 DRDGNIRIWDLGENQCTHQL-------------TPEDDTSLQSLSMASDG 171
           D +G I++W+L   +CTH +             +  DDT    L M S G
Sbjct: 196 DTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGG 245

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 98/222 (44%), Gaps = 21/222 (9%)

Query: 77  NVTSVSFQQDNRWMVTSSEDGT---------IKVWD-VRSPSIPRNYKHNAPVNEVVIHP 126
           N+    ++Q N   V  S DGT         + V+D V + S    Y+H   V  + ++ 
Sbjct: 9   NLLGTVYRQGN---VLFSHDGTQLLSPVGNRVSVFDLVNNKSFTFEYEHRKNVATLDLNR 65

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
               LIS D DG   + +       H    ++  +  S+  + DG + A A T     +W
Sbjct: 66  QGSLLISVDDDGRAILVNYRTRNVLHHFNFKEHCN--SVKFSPDGKLFALA-TGRFLQIW 122

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILL---SSDVKHLATCSADHTARVWSIDDDFK-- 241
           + P  T+     P  ++R  + +   IL    S D + + T S D TAR+WSID + K  
Sbjct: 123 KTPEATEDRQFAPFVRYRIQAGHFQDILSFTWSQDSRFVITTSKDLTARIWSIDSEDKDL 182

Query: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
             TT  GH+ +V    FSAD   + T S D  +  W+ + R+
Sbjct: 183 ASTTFAGHRDYVLGAFFSADQEQIYTVSKDGALFKWEFTPRD 224

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 98/237 (41%), Gaps = 8/237 (3%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           S ILV    +   R +E       + +    + VN + I +  + LA    +  +L    
Sbjct: 260 SRILVVGFNNGEFRLYELPDFTLIQQLSMGQNPVNTVSINSSGEWLAFGSSKLGQLLVYE 319

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVN 120
             + + +   +GH  ++ ++++  D   +VT++EDG IKVWDV S       + H + V 
Sbjct: 320 WQSESYILKQQGHFDSLNALTYSPDGSRVVTAAEDGKIKVWDVISGFCLVTLEGHTSSVT 379

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
            V        L S   DG +R WDL   +     T  +      L++   G  + A +  
Sbjct: 380 AVQFAKRGQVLFSASLDGTVRAWDLIRYRNFRVFTAAERIQFNCLAVDPSGECVCAGSVD 439

Query: 181 G-NCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236
             + +VW +         + +     H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 440 SFDIHVWSVQTS------QLLDTLSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI 490

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/332 (22%), Positives = 124/332 (37%), Gaps = 79/332 (23%)

Query: 33  SQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVAS-FEGHRGNVTSVSFQQDNRWMV 91
           SQ +R  IT  K L A       R++ I + + +  ++ F GHR  V    F  D   + 
Sbjct: 155 SQDSRFVITTSKDLTA-------RIWSIDSEDKDLASTTFAGHRDYVLGAFFSADQEQIY 207

Query: 92  TSSEDGTIKVWDVRSPS---------------IPRNYKHNA--PVNEVVIHPNQGELISC 134
           T S+DG +  W+  +P                  +++ HN    V  V  HPN   L+  
Sbjct: 208 TVSKDGALFKWEF-TPRDEEDEEDLSKYSWRITQKHFFHNEQNKVKCVTFHPNSRILVVG 266

Query: 135 DRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK-GNCYVWEMPNHTD 193
             +G  R+++L +     QL+   +  + ++S+ S G  LA  ++K G   V+E  + + 
Sbjct: 267 FNNGEFRLYELPDFTLIQQLSMGQN-PVNTVSINSSGEWLAFGSSKLGQLLVYEWQSES- 324

Query: 194 ASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV 253
                 + K + H   +  +  S D   + T + D   +VW +   F L  TL+GH   V
Sbjct: 325 -----YILKQQGHFDSLNALTYSPDGSRVVTAAEDGKIKVWDVISGFCL-VTLEGHTSSV 378

Query: 254 WDCAFSADSAYLVTASSDHYVRLWDL---------------------------------- 279
               F+     L +AS D  VR WDL                                  
Sbjct: 379 TAVQFAKRGQVLFSASLDGTVRAWDLIRYRNFRVFTAAERIQFNCLAVDPSGECVCAGSV 438

Query: 280 ----------STREIVRQYGGHHKGAVCVALN 301
                      T +++    GH     C++ +
Sbjct: 439 DSFDIHVWSVQTSQLLDTLSGHEGPVSCLSFS 470

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 108/247 (43%), Gaps = 18/247 (7%)

Query: 42  NDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM-VTSSEDGTIK 100
           N + L+    +   RLY++   +   +      +  V +VS      W+   SS+ G + 
Sbjct: 259 NSRILVVGFNNGEFRLYEL--PDFTLIQQLSMGQNPVNTVSINSSGEWLAFGSSKLGQLL 316

Query: 101 VWDVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDD 159
           V++ +S S I +   H   +N +   P+   +++   DG I++WD+    C   +T E  
Sbjct: 317 VYEWQSESYILKQQGHFDSLNALTYSPDGSRVVTAAEDGKIKVWDVISGFCL--VTLEGH 374

Query: 160 TS-LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSD 218
           TS + ++  A  G +L +A+  G    W++  + +        + + +        L+ D
Sbjct: 375 TSSVTAVQFAKRGQVLFSASLDGTVRAWDLIRYRNFRVFTAAERIQFNC-------LAVD 427

Query: 219 VKHLATCSAD---HTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275
                 C+         VWS+    +L  TL GH+  V   +FS +++ L +AS D  +R
Sbjct: 428 PSGECVCAGSVDSFDIHVWSVQTS-QLLDTLSGHEGPVSCLSFSQENSVLASASWDKTIR 486

Query: 276 LWDLSTR 282
           +W +  R
Sbjct: 487 IWSIFGR 493

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/315 (20%), Positives = 113/315 (35%), Gaps = 81/315 (25%)

Query: 36  NRLEITNDKKLLATAGHQNVRLYDI-RTTNPNPVASF------EGHRGNVTSVSFQQDNR 88
           N ++ + D KL A A  + ++++     T     A F       GH  ++ S ++ QD+R
Sbjct: 100 NSVKFSPDGKLFALATGRFLQIWKTPEATEDRQFAPFVRYRIQAGHFQDILSFTWSQDSR 159

Query: 89  WMVTSSEDGTIKVWDVRSP----SIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
           +++T+S+D T ++W + S     +      H   V       +Q ++ +  +DG +  W 
Sbjct: 160 FVITTSKDLTARIWSIDSEDKDLASTTFAGHRDYVLGAFFSADQEQIYTVSKDGALFKW- 218

Query: 145 LGENQCTHQLTPEDDTSLQSLSMAS-----------------------DGSMLAAANTKG 181
                   + TP D+   + LS  S                       +  +L      G
Sbjct: 219 --------EFTPRDEEDEEDLSKYSWRITQKHFFHNEQNKVKCVTFHPNSRILVVGFNNG 270

Query: 182 NCYVWEMPNHTDASHL----KPVT---------------------------------KFR 204
              ++E+P+ T    L     PV                                  K +
Sbjct: 271 EFRLYELPDFTLIQQLSMGQNPVNTVSINSSGEWLAFGSSKLGQLLVYEWQSESYILKQQ 330

Query: 205 AHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAY 264
            H   +  +  S D   + T + D   +VW +   F L  TL+GH   V    F+     
Sbjct: 331 GHFDSLNALTYSPDGSRVVTAAEDGKIKVWDVISGFCL-VTLEGHTSSVTAVQFAKRGQV 389

Query: 265 LVTASSDHYVRLWDL 279
           L +AS D  VR WDL
Sbjct: 390 LFSASLDGTVRAWDL 404

>NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {ON}
           Anc_6.325
          Length = 915

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 97/221 (43%), Gaps = 21/221 (9%)

Query: 77  NVTSVSFQQDNRWMVTSSEDGT---------IKVWD-VRSPSIPRNYKHNAPVNEVVIHP 126
           N+    ++Q N   +  S DGT         + V+D + + S    Y+H   +  + ++ 
Sbjct: 9   NLLGTVYRQGN---IIFSNDGTQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIATIDLNK 65

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
               LIS D DG   + +       H    ++      +  + DG + A A T     +W
Sbjct: 66  QGTLLISVDEDGRAILTNFKAKTVLHHFNFKE--KCYQVKFSPDGKLFALA-TGRFLQIW 122

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILL---SSDVKHLATCSADHTARVWSIDDDFK-- 241
           + P+ T+     P  ++R H+ +   IL    S D + + + S D TAR+WSID + K  
Sbjct: 123 KTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDL 182

Query: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
              T  GH+ +V    FSAD   + T S D  + +W+ + +
Sbjct: 183 ASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVWEFTKK 223

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 99/237 (41%), Gaps = 8/237 (3%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           S +LV    +   R +E       + +    + +N + + +  + LA    +  +L    
Sbjct: 270 SNMLVVGFTNGEFRLYELPHFTLLQQLSMGQNPINTVAVNSSGEWLAFGSSKLGQLLVYE 329

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVN 120
             + + +   +GH     S+++  D   +VT++EDG IKVWDV S      ++ H + V 
Sbjct: 330 WQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVT 389

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +V        L S   DG +R WDL   +     T  +      L++   G ++ A +  
Sbjct: 390 QVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLD 449

Query: 181 G-NCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236
             + +VW +         + +     H   ++ +  S +   LA+ S D T RVWSI
Sbjct: 450 NFDIHVWSVQTG------QLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSI 500

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 92/210 (43%), Gaps = 14/210 (6%)

Query: 78  VTSVSFQQDNRWM-VTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCD 135
           + +V+      W+   SS+ G + V++ +S S I +   H    N +   P+   +++  
Sbjct: 303 INTVAVNSSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAA 362

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            DG I++WD+    C      E  +S+  +  A  G +L +++  G    W++  + +  
Sbjct: 363 EDGKIKVWDVVSGFCLATFQ-EHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFR 421

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSA---DHTARVWSIDDDFKLETTLDGHQRW 252
                 + + +        L+ D      C+    +    VWS+    +L  TL GH+  
Sbjct: 422 TFTAAERIQFNC-------LAVDPSGEVVCAGSLDNFDIHVWSVQTG-QLLDTLSGHEGP 473

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           V   AFS +++ L +AS D  VR+W +  R
Sbjct: 474 VSCLAFSQENSVLASASWDKTVRVWSIFGR 503

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 60/322 (18%), Positives = 120/322 (37%), Gaps = 68/322 (21%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVA-SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
           +++T+     R++ I +   +  + +F GHR  V    F  D   + T S+DG + VW+ 
Sbjct: 161 IISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVWEF 220

Query: 105 RSPSIPRN--------------------------YKHNAPVNEVVIHPNQGELISCDRDG 138
              S                              Y +   V  V  H     L+    +G
Sbjct: 221 TKKSTDDEDDDDEEEEEDIDISKYSWRITQKHFFYANQCKVKCVTFHAPSNMLVVGFTNG 280

Query: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK----------GNCYVWEM 188
             R+++L       QL+   +  + ++++ S G  LA  ++K             Y+ + 
Sbjct: 281 EFRLYELPHFTLLQQLSMGQN-PINTVAVNSSGEWLAFGSSKLGQLLVYEWQSESYILKQ 339

Query: 189 PNHTDASH---LKP------------------------VTKFRAHSTYITRILLSSDVKH 221
             H DA++     P                        +  F+ H++ +T++  +   + 
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQV 399

Query: 222 LATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASS-DHY-VRLWDL 279
           L + S D T R W +   ++   T    +R  ++C     S  +V A S D++ + +W +
Sbjct: 400 LFSSSLDGTVRAWDLIR-YRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 458

Query: 280 STREIVRQYGGHHKGAVCVALN 301
            T +++    GH     C+A +
Sbjct: 459 QTGQLLDTLSGHEGPVSCLAFS 480

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/335 (17%), Positives = 121/335 (36%), Gaps = 76/335 (22%)

Query: 20  LTGVCSRTIQH---SDSQVNRLEITNDKKLLATAGHQNVRLYDIR-TTNPNPVASF---- 71
           LT   ++T+ H      +  +++ + D KL A A  + ++++     T     A F    
Sbjct: 81  LTNFKAKTVLHHFNFKEKCYQVKFSPDGKLFALATGRFLQIWKTPDATEDRQFAPFVRYR 140

Query: 72  --EGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSP----SIPRNYKHNAPVNEVVIH 125
              GH  ++ S+++  D+R+++++S+D T ++W + S     +      H   V      
Sbjct: 141 VHAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFS 200

Query: 126 PNQGELISCDRDGNIRIWDLGENQCT------------------------HQLTPEDDTS 161
            +Q ++ +  +DG + +W+  +                                  +   
Sbjct: 201 ADQEKIYTVSKDGALFVWEFTKKSTDDEDDDDEEEEEDIDISKYSWRITQKHFFYANQCK 260

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHL----KPVTKFRAHS---------- 207
           ++ ++  +  +ML    T G   ++E+P+ T    L     P+     +S          
Sbjct: 261 VKCVTFHAPSNMLVVGFTNGEFRLYELPHFTLLQQLSMGQNPINTVAVNSSGEWLAFGSS 320

Query: 208 -------------TYITR----------ILLSSDVKHLATCSADHTARVWSIDDDFKLET 244
                        +YI +          +  S D   + T + D   +VW +   F L  
Sbjct: 321 KLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCL-A 379

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           T   H   V    F+     L ++S D  VR WDL
Sbjct: 380 TFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDL 414

>SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} similar
           to uniprot|P36037 Saccharomyces cerevisiae YKL213C DOA1
           WD repeat protein required for ubiquitin- mediated
           protein degradation forms complex with Cdc48p plays a
           role in controlling cellular ubiquitin concentration
           also promotes efficient NHEJ in postdiauxic/stationary
           phase
          Length = 711

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 124/285 (43%), Gaps = 23/285 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQH-SDSQVNRLEITNDKKLLATAGHQNV--RLYDIR 61
           + S   D T+R W    GV +  I H S+  +N L      +LL   G   +   +  + 
Sbjct: 26  VASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCYDKSSQLLFYGGQDTLVGGISPLA 85

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNE 121
           TT+ +PV    GH+GNV S+S    N ++++SS D T KVW   S +I     H+A V +
Sbjct: 86  TTDEDPVYMLIGHKGNVCSLS--SKNNFVISSSWDKTAKVWHNGS-AIYDLVGHSASVWD 142

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKG 181
               P +   ++   D  I++W    N+     +      ++ L ++ DG   A+ +  G
Sbjct: 143 AKFLPEKDFFLTASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDG 200

Query: 182 NCYVWEMPNHTDASHLKPVTKFRAHSTYI--TRILLSSDVKHLATCSADHTARVWSIDDD 239
              +    N  D + LK    F  H +++   + L + D   L +C  D + RVWS    
Sbjct: 201 TVKI----NDMDGNILK---TFTGHESFVYSVKFLPNGD---LVSCGEDRSVRVWSKTGA 250

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREI 284
            K    L     W  D   + D   ++  SSD+ VR++ +    I
Sbjct: 251 VKQVLRLPAVSIWDLDILPNGD---ILVGSSDNMVRIFTVEESRI 292

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 71/178 (39%), Gaps = 18/178 (10%)

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182
           V+  N  ++ SC RDG +R+W   +      +    +  + SL       +L        
Sbjct: 18  VVAINDSQVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCYDKSSQLLFYGGQDTL 77

Query: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW----SIDD 238
                    TD     PV     H   +    LSS    + + S D TA+VW    +I D
Sbjct: 78  VGGISPLATTDED---PVYMLIGHKGNVCS--LSSKNNFVISSSWDKTAKVWHNGSAIYD 132

Query: 239 DFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 296
                  L GH   VWD  F  +  + +TAS+D  ++LW     ++++ + G HK  +
Sbjct: 133 -------LVGHSASVWDAKFLPEKDFFLTASADCTIKLW--HGNKLIKTFSGIHKDVI 181

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 108/271 (39%), Gaps = 30/271 (11%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF-----QQD 86
           +N L+ + D   +ATA   +  L   Y  +  +    A F GH G+VT+V+      Q  
Sbjct: 384 LNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVALPNIMDQHF 443

Query: 87  NRWMVTSSEDGTIKVWDVRSPS-------IP-------RNYKHNAPVNEVVIHPNQGELI 132
             ++++SS D T+K W V  P+       IP           H   +N + I PN     
Sbjct: 444 PNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSIFA 503

Query: 133 SCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT 192
           +   D   +IWDL   +    L       L  +S      ++A  +      +W + N+ 
Sbjct: 504 TASYDKTCKIWDLVTGELVATLANHK-RGLWDVSFCQHDKLIATCSGDKTIKIWSLENYN 562

Query: 193 DASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRW 252
             + L+       H+  + RI   +  K L +C AD   ++W       L T LD H   
Sbjct: 563 IKATLE------GHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRT-LDAHDNR 615

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
           +W    + D    VTA +D   + W  ++ E
Sbjct: 616 IWALEVADDGDRFVTADADGLFQFWKDNSEE 646

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           I  +A YD T + W+ +TG    T+ +    +  +      KL+AT +G + ++++ +  
Sbjct: 501 IFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLE- 559

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNE 121
            N N  A+ EGH   V  +SF   N+ +V+   DG +K+WD  +    R    H+  +  
Sbjct: 560 -NYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWA 618

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           + +  +    ++ D DG  + W
Sbjct: 619 LEVADDGDRFVTADADGLFQFW 640

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 61/150 (40%), Gaps = 19/150 (12%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKH 221
           L +L  + DG  +A A+      +W           K   KF  H+  +T + L + +  
Sbjct: 384 LNALDASEDGLWIATASKDHTVLLWRYSEQL--GDFKQYAKFIGHAGSVTAVALPNIMDQ 441

Query: 222 -----LATCSADHTARVWSI--------DDDFKL----ETTLDGHQRWVWDCAFSADSAY 264
                L + S D T + W +        +D+  +    E T   H++ +   + S + + 
Sbjct: 442 HFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSI 501

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
             TAS D   ++WDL T E+V     H +G
Sbjct: 502 FATASYDKTCKIWDLVTGELVATLANHKRG 531

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/154 (20%), Positives = 67/154 (43%), Gaps = 3/154 (1%)

Query: 38  LEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDG 97
           + ITND  LLAT+    + +  ++  +             +T++    D  ++   +++ 
Sbjct: 23  VSITNDGSLLATSVLDVINIVQLKERHEIVHKINNDDEQEITALKLTPDGSYLCFVAQNQ 82

Query: 98  TIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157
            ++++ + S  I R+ K ++PV  +        L+    DG++ I+D+     TH     
Sbjct: 83  LLRIYSLASKKIVRSMKVSSPVYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGH 142

Query: 158 DD-TSLQSLSMASDGS--MLAAANTKGNCYVWEM 188
               S        DG+  +LA+ +T G   +W++
Sbjct: 143 GGIISSVKFYGELDGANWLLASGDTNGVVKIWDL 176

>NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa]
           {ON} Anc_7.231
          Length = 608

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 126/290 (43%), Gaps = 12/290 (4%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  +    R +      V  L   ++ KL+  +  + +R+++ +T 
Sbjct: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTG 323

Query: 64  NPNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
               ++++ GH  +V SV +F+   + +V+ S D T+K+W V S +      H   VN V
Sbjct: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-SDGSMLAAANTKG 181
            +HP      S   D  IR+WD+  N C            + + +   D   L   N  G
Sbjct: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438

Query: 182 NCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK-HLATCSADHTARVWSIDDDF 240
           +    + P  T         +   +      +  S     HL +CS D+T ++W +    
Sbjct: 439 SNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQ 498

Query: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
            + T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 499 CIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/225 (20%), Positives = 86/225 (38%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           V  F+GH   V ++ F  + R + T S D T+ +WD+ S  + R    H   V    ++ 
Sbjct: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK--TLYF 301

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           ++ +L++   D  IR+W+    +C                                    
Sbjct: 302 DEAKLVTGSLDKTIRVWNYKTGEC------------------------------------ 325

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R H+  +  +   +  K + + SAD T ++W ++   +   TL
Sbjct: 326 -------------ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES--RTCYTL 368

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 369 RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 46/112 (41%), Gaps = 20/112 (17%)

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           KGNC V E   H D                   + L  + + L T S D T  +W +  +
Sbjct: 241 KGNCQVQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTVAIWDLCSN 283

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            KL   L GH   V    F  D A LVT S D  +R+W+  T E +  Y GH
Sbjct: 284 -KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGH 332

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 54/272 (19%), Positives = 108/272 (39%), Gaps = 32/272 (11%)

Query: 38  LEITNDKKLLATAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSED 96
           L +  + +LL T  + + V ++D+   +   +    GH   V ++ F  D   +VT S D
Sbjct: 257 LTLQFNYRLLFTGSYDSTVAIWDL--CSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLD 312

Query: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH--- 152
            TI+VW+ ++      Y+ H   V  + +   +  ++S   D  ++IW +    C     
Sbjct: 313 KTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRG 370

Query: 153 --------QLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT-DASHLKPVTKF 203
                   +L P+  T        SD + +   + + N  +     H      + P+T  
Sbjct: 371 HTEWVNCVKLHPKSFTCFS----GSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTII 426

Query: 204 RAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263
            A +  +  I  S++         D  A   +       E   +  +    D +    + 
Sbjct: 427 DAENLVVDNISGSNE-------GDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPT- 478

Query: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGA 295
           +L++ S D+ ++LWD+ T + +R   GH +G 
Sbjct: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 141/331 (42%), Gaps = 46/331 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D +++AT    N +RL++    
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMTTLTGHQNWVLCVSWSPDGEIIATGSMDNTIRLWESDRG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWD-VRSPSIPRNYKH 115
            P       GH   +TS+S++        +   + ++S+DGTIK+WD VR   +     H
Sbjct: 219 KPLG-EPLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGTIKIWDTVRRVCVYTLSGH 277

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLG-ENQC----------THQLTPEDDTSLQS 164
              V+  V    QG L S   D  +R+WD+    +C           + L+   D +L+ 
Sbjct: 278 TNSVS-CVKWGGQGVLYSGSHDKTVRVWDMNLGGKCINILKNHAHWVNHLSLSTDYALRR 336

Query: 165 LSMASDGSMLAAAN-------------TKGNCYVWE-MPNHTDASHL---------KPVT 201
                 G+ +A+                K N    E M   +D   +         KP+ 
Sbjct: 337 GPFDHTGTKMASPEEAREKALKNYEKVVKKNGTTEELMVTASDDFTMFLWNPLKSNKPLA 396

Query: 202 KFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSAD 261
           +   H   +  +  S D +++ + S D++ ++W    D K  +T  GH   V+  A+S+D
Sbjct: 397 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFLSTFRGHVSSVYQVAWSSD 455

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
              LV+ S D  +++WD+ TR++     GH 
Sbjct: 456 CRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQ 486

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+ +  VC  T+    + V+ ++      L + +  + VR++D+    
Sbjct: 251 LASASKDGTIKIWDTVRRVCVYTLSGHTNSVSCVKWGGQGVLYSGSHDKTVRVWDMNLGG 310

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN-EVV 123
              +   + H   V  +S   D        +    K+      + P   +  A  N E V
Sbjct: 311 -KCINILKNHAHWVNHLSLSTDYALRRGPFDHTGTKM------ASPEEAREKALKNYEKV 363

Query: 124 IHPN---QGELISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
           +  N   +  +++   D  + +W+ L  N+   ++T      +  ++ + DG  + +A+ 
Sbjct: 364 VKKNGTTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H + + ++  SSD + L +CS D T +VW +   
Sbjct: 423 DNSIKLW------DGRDGKFLSTFRGHVSSVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  +RLW
Sbjct: 477 -KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMIRLW 513

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEALTG--VCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D T+  W  L      +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPLARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFLSTFRGHVSSVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  IR+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMIRLW 513

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 6/87 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+   A + + + IL S+   H    + T + D+TAR+W  D    + TTL GHQ 
Sbjct: 129 VKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPM-TTLTGHQN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWD 278
           WV   ++S D   + T S D+ +RLW+
Sbjct: 188 WVLCVSWSPDGEIIATGSMDNTIRLWE 214

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 233 VWSIDDDFKLETTLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           V+ +    +  + + GH   +   AF+   S+ +VT + D+  R+WD  T+  +    GH
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMTTLTGH 185

Query: 292 HKGAVCVA 299
               +CV+
Sbjct: 186 QNWVLCVS 193

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 134/298 (44%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ Q  +  V    +T D    L+ +  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDKQYGVPVRSFQGHNHIVQDCSLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+D+ T        F GH+ +V SV+  +    +++ S D T+KVW +R   +     HN
Sbjct: 91  LWDVATGQT--YQRFVGHKSDVMSVAIDRKASMIISGSRDRTVKVWTIRGQCLATMLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             V++V I P +        +IS   D  ++ W++ + Q        ++  + +++ + D
Sbjct: 149 DWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNVNQFQIEADFIGHNNY-VNTITASPD 207

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHT 230
           GS++A+A   G   +W + +      L    +  A +    R  LS+     AT S    
Sbjct: 208 GSLVASAGKDGEIMLWNLADKVPMYTLSAQDEVFALAFSPNRYWLSA-----ATSSG--- 259

Query: 231 ARVWSIDDDF---KLETTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            +++ +D  +   +L+    G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 260 IKIFCLDPKYLVDELKPEFAGYTKASEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 105/228 (46%), Gaps = 24/228 (10%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  ++++S D T+  W    D +   +P R+++ HN  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +  +  +    +S   D  +R+WD+   Q T+Q      + + S+++    SM+ + +  
Sbjct: 70  DCSLTADGAYALSASWDKTLRLWDVATGQ-TYQRFVGHKSDVMSVAIDRKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSS------DVKHLATCSADHTARVW 234
               VW +     A+ L        H+ +++++ ++       D   + +   D   + W
Sbjct: 129 RTVKVWTIRGQCLATML-------GHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAW 181

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +++  F++E    GH  +V     S D + + +A  D  + LW+L+ +
Sbjct: 182 NVNQ-FQIEADFIGHNNYVNTITASPDGSLVASAGKDGEIMLWNLADK 228

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHLA-TCSADHTARVWSIDDDFKLET----TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +  D K       +  GH   V DC+
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIVQDCS 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            +AD AY ++AS D  +RLWD++T +  +++ GH    + VA++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAID 116

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 76/189 (40%), Gaps = 19/189 (10%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDLGENQCTHQLTPEDDTS----LQSLSMAS 169
           HN  V  +     Q  L+ S  RD  +  W L  +   + +           +Q  S+ +
Sbjct: 16  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIVQDCSLTA 75

Query: 170 DGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADH 229
           DG+   +A+      +W      D +  +   +F  H + +  + +      + + S D 
Sbjct: 76  DGAYALSASWDKTLRLW------DVATGQTYQRFVGHKSDVMSVAIDRKASMIISGSRDR 129

Query: 230 TARVWSIDDDFKLETTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTRE 283
           T +VW+I    +   T+ GH  WV     +       D+  +++A  D  V+ W+++  +
Sbjct: 130 TVKVWTIRG--QCLATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNVNQFQ 187

Query: 284 IVRQYGGHH 292
           I   + GH+
Sbjct: 188 IEADFIGHN 196

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 125/298 (41%), Gaps = 55/298 (18%)

Query: 45  KLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
           +++  AG    R++D  T  P  +A+ EGH   V  VS+  D   + T S D TI++W+ 
Sbjct: 154 RMVTGAGDNTARIWDCDTQTP--LATLEGHSNWVLCVSWSPDGEVIATGSMDSTIRLWES 211

Query: 105 -----------RSPSIPRNYKHNAPVNEVVIH--PNQGE--LISCDRDGNIRIWDLGENQ 149
                       S ++  + K    ++   +H  P+  +  L S  +DG I+IWD     
Sbjct: 212 TKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIKIWDTARRV 271

Query: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEM------------PNHT----- 192
           C + L+   + S+  +    +G + + ++ K    VW+M             NH      
Sbjct: 272 CLYTLSGHSN-SVACVKWGGEGLLYSGSHDK-TVRVWDMNSATVGKCISILKNHAHWVNH 329

Query: 193 --------------DASHLKPVT----KFRAHSTYITRILLSSDVKHL-ATCSADHTARV 233
                         D + +KP T    K RA + Y      +   + L  T S D T  +
Sbjct: 330 LSLSTDYALRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFL 389

Query: 234 WSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           W+     K    + GHQ+ V   AFS D  Y+V+AS D+ ++LWD    + +  + GH
Sbjct: 390 WNPKKLTKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGH 447

 Score = 73.2 bits (178), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 74/344 (21%), Positives = 144/344 (41%), Gaps = 64/344 (18%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++AT    + +RL++  +T
Sbjct: 155 MVTGAGDNTARIWDCDTQTPLATLEGHSNWVLCVSWSPDGEVIATGSMDSTIRLWE--ST 212

Query: 64  NPNPV-------ASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSI 109
              PV       ++ +GH   +TS+S++            + ++S+DGTIK+WD      
Sbjct: 213 KGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIKIWDTARRVC 272

Query: 110 PRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGE---NQCTH-------------- 152
                 ++     V    +G L S   D  +R+WD+      +C                
Sbjct: 273 LYTLSGHSNSVACVKWGGEGLLYSGSHDKTVRVWDMNSATVGKCISILKNHAHWVNHLSL 332

Query: 153 ------QLTPEDDTSLQSLSMAS---------------DGS---MLAAANTKGNCYVWEM 188
                 ++ P D T ++  + A                +GS   ++  A+     ++W  
Sbjct: 333 STDYALRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNP 392

Query: 189 PNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248
              T     KP+ +   H   +  +  S D +++ + S D++ ++W    D K  +T  G
Sbjct: 393 KKLT-----KPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD-GRDGKFLSTFRG 446

Query: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           H   V+  A+S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 447 HVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQ 490

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 114/278 (41%), Gaps = 18/278 (6%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT-T 63
           L SA  D TI+ W+    VC  T+    + V  ++   +  L + +  + VR++D+ + T
Sbjct: 253 LASASKDGTIKIWDTARRVCLYTLSGHSNSVACVKWGGEGLLYSGSHDKTVRVWDMNSAT 312

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               ++  + H   V  +S   D    +   +   +K      PS P   K  A  N   
Sbjct: 313 VGKCISILKNHAHWVNHLSLSTDYALRIGPFDHTGVK------PSTPAEAKRRAQANYDK 366

Query: 124 IHPNQGE----LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
           +    G     +++   D  + +W+  +              +  ++ + DG  + +A+ 
Sbjct: 367 VAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSPDGRYIVSASF 426

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W      D    K ++ FR H   + ++  SSD + L +CS D T +VW +   
Sbjct: 427 DNSIKLW------DGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 480

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  VR+W
Sbjct: 481 -KLSVDLPGHQDEVFTVDWSVDGKRVCSGGKDKMVRIW 517

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFW--EALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D T+  W  + LT   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 377 LMVTASDDFTMFLWNPKKLTKPLARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 435

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  +   +++F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 436 R--DGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQDEV 493

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +RIW
Sbjct: 494 FTVDWSVDGKRVCSGGKDKMVRIW 517

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 6/87 (6%)

Query: 197 LKPVTK----FRAHSTYITRILLSSDVK-HLATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KPVT+       H + I     + D    + T + D+TAR+W  D    L  TL+GH  
Sbjct: 125 VKPVTRSASAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCDTQTPL-ATLEGHSN 183

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWD 278
           WV   ++S D   + T S D  +RLW+
Sbjct: 184 WVLCVSWSPDGEVIATGSMDSTIRLWE 210

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 13/113 (11%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWS------IDDDFKLETTLDGHQRW 252
           P+     HS ++  +  S D + +AT S D T R+W       +       + L GH +W
Sbjct: 174 PLATLEGHSNWVLCVSWSPDGEVIATGSMDSTIRLWESTKGKPVGGGNGSSSALKGHMKW 233

Query: 253 VWDCAFSA-----DSAY--LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +   ++       D A   L +AS D  +++WD + R  +    GH     CV
Sbjct: 234 ITSLSWEPLHLVPDGAKPRLASASKDGTIKIWDTARRVCLYTLSGHSNSVACV 286

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 244 TTLDGHQRWVWDCAFSAD-SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + + GH   +   AF+ D S+ +VT + D+  R+WD  T+  +    GH    +CV+
Sbjct: 133 SAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCDTQTPLATLEGHSNWVLCVS 189

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 113/266 (42%), Gaps = 47/266 (17%)

Query: 35  VNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF-----QQD 86
           +N L+ T D   +ATA   N  +   Y+ RT+  +  A + GH   VT+V       +  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGY 450

Query: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++T+S D TIK W V  P+   + +    V+E   H ++ ++               
Sbjct: 451 PEFLLTASNDLTIKKWKVPKPTSIMDVQI-IKVSEYTRHAHEKDI--------------- 494

Query: 147 ENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAH 206
                            +LS++ + S+ A A+    C +W + N    + L        H
Sbjct: 495 ----------------NALSVSPNDSIFATASYDKTCKIWSLENGELEATLA------NH 532

Query: 207 STYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLV 266
              +  +      K LAT S D T ++WS+D  F +  TL+GH   V  C+F      LV
Sbjct: 533 KRGLWDVSFCQYDKLLATSSGDKTVKIWSLDT-FSVMKTLEGHSNAVQRCSFINKQKQLV 591

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHH 292
           +  +D  +++WD S+ E +    GH+
Sbjct: 592 SCGADGLIKIWDCSSGECLNTLDGHN 617

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           I  +A YD T + W    G    T+ +    +  +      KLLAT +G + V+++ + T
Sbjct: 505 IFATASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDT 564

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
              + + + EGH   V   SF    + +V+   DG IK+WD  S         HN  +  
Sbjct: 565 F--SVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWA 622

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           +    +   ++S D DG  + W
Sbjct: 623 LNTMNDGDMIVSADADGVFQFW 644

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 109/264 (41%), Gaps = 24/264 (9%)

Query: 40  ITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGH-RGNVTSVSFQQDNRWMVTSSEDGT 98
           ++ D K+LAT     + + D+       +          +T++    D +++   S+   
Sbjct: 25  VSEDGKILATPILDEINIIDLTLGCRKILHKISNEDEQEITALRLTPDGQYLAYVSQAQL 84

Query: 99  IKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
           +K++ +++  I R+ K ++P   +   P    L     DG+I I D+     TH L    
Sbjct: 85  LKIFQLKTGRIVRSLKISSPSYILDTDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHG 144

Query: 159 DTSLQSLS----MASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRIL 214
            T + SL     + S+  +LA+ +T G   VW++         K +   + HS+ +  + 
Sbjct: 145 GT-ISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKR------KCLLTLQEHSSAVRGLD 197

Query: 215 L----SSDVKHLATCSA--DHTARVWSID--DDFKLETTLDGHQRWVWDCAFSAD---SA 263
           +    S D   L   S   D    VW  D     KL  TL  +Q+ V  C F  +     
Sbjct: 198 IIEGESGDGSSLKLLSGGRDDIVNVWDFDMKKKCKLVKTLPVNQQ-VESCGFLKNHDGKR 256

Query: 264 YLVTASSDHYVRLWDLSTREIVRQ 287
            + TA  D   +L DL +  ++++
Sbjct: 257 IIYTAGGDAIFQLIDLESGTVLKR 280

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/312 (20%), Positives = 120/312 (38%), Gaps = 45/312 (14%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-------KLLATAGHQNVR 56
           +L S   +  ++ W+ +   C  T+Q   S V  L+I   +       KLL+      V 
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVN 221

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQD---NRWMVTSSEDGTIKVWDVRSPSIPRNY 113
           ++D        +         V S  F ++    R + T+  D   ++ D+ S ++ +  
Sbjct: 222 VWDFDMKKKCKLVKTLPVNQQVESCGFLKNHDGKRIIYTAGGDAIFQLIDLESGTVLK-- 279

Query: 114 KHNAPVNEVVIHP-----NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA 168
           + N P+ E+ I       N  E+     D  +++ ++ E      L  E+DT     ++A
Sbjct: 280 RTNKPIEELFIIGVLPIMNDSEMFLVMSDQTLQLINIEE-----VLENENDTINARSTIA 334

Query: 169 SDGSM-------------LAAANTKGNCYVWEMPNHT--DASHLKPVTKFRAHSTYITRI 213
            +  +             LA A    +  +  +P+ +  DAS    V  +  H   +  +
Sbjct: 335 GNNGIIADMRFVGPELNKLALATNSPSLRIIPIPDLSGADASLPLDVEIYEGHEDLLNSL 394

Query: 214 LLSSDVKHLATCSADHTARVWSIDD---DFKLETTLDGHQRWVWDCAF-----SADSAYL 265
             + D   +AT S D+TA +W  ++    F +     GH   V               +L
Sbjct: 395 DATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFL 454

Query: 266 VTASSDHYVRLW 277
           +TAS+D  ++ W
Sbjct: 455 LTASNDLTIKKW 466

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 16/147 (10%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV-- 219
           L SL    DG  +A A+      +W+    T  S      K+  HS+ +T + L + +  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAILWKYNERT--SKFDIYAKYIGHSSAVTAVGLPNVMPK 448

Query: 220 ---KHLATCSADHTARVWSIDD-----DFKL----ETTLDGHQRWVWDCAFSADSAYLVT 267
              + L T S D T + W +       D ++    E T   H++ +   + S + +   T
Sbjct: 449 GYPEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 508

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHKG 294
           AS D   ++W L   E+      H +G
Sbjct: 509 ASYDKTCKIWSLENGELEATLANHKRG 535

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 129/297 (43%), Gaps = 22/297 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T    +T++   + V  +  + D +L+AT    N +RL+     
Sbjct: 158 MVTGAGDNTARIWDCNTNTPMQTLKGHFNWVLCVAWSPDGELIATGSMDNTIRLWQ-SEK 216

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWD-VRSPSIPRNYKH 115
             N   +  GH   +TS+S++        D   + ++S+DGTIK+WD  R   +     H
Sbjct: 217 GENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDTARRVCLFTLSGH 276

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSM-L 174
              V+  V    +G L S   D  IR WD+        +       +  LS+++D ++ +
Sbjct: 277 TNSVS-CVKWGGRGVLYSGSHDKTIRAWDMNAGGKCINILKSHAHWINHLSLSTDYALRV 335

Query: 175 AAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW 234
            A +  G       P    A  L+   K    +  +  +++        T S D T  +W
Sbjct: 336 GAFDHTGKKP--SSPEEARAKALENYEKIAKKNGKLEELMV--------TASDDFTMYLW 385

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
                 K  T + GHQ+ V   AFS D  Y+V+AS D+ ++LWD      +  + GH
Sbjct: 386 DPIKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGTFIATFRGH 442

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 107/280 (38%), Gaps = 63/280 (22%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           +L S  +D TIR W+    G C   ++     +N L ++ D  L        V  +D   
Sbjct: 290 VLYSGSHDKTIRAWDMNAGGKCINILKSHAHWINHLSLSTDYAL-------RVGAFDHTG 342

Query: 63  TNPN-PVASFEGHRGNVTSVSFQQDN--RWMVTSSEDGTIKVWDVRSPSIP--RNYKHNA 117
             P+ P  +      N   ++ +       MVT+S+D T+ +WD    + P  R   H  
Sbjct: 343 KKPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQK 402

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAA 177
            VN V   P+   ++S   D +I++WD                         DG+ +A  
Sbjct: 403 LVNHVAFSPDGRYIVSASFDNSIKLWD-----------------------GRDGTFIAT- 438

Query: 178 NTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID 237
                                    FR H   + ++  SSD + L +CS D T +VW + 
Sbjct: 439 -------------------------FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR 473

Query: 238 DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
              KL   L GH+  V+   +S D   + +A  D  VR+W
Sbjct: 474 TK-KLSVDLPGHKDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV----W 254
           P+   + H  ++  +  S D + +AT S D+T R+W  +        L GH +W+    W
Sbjct: 177 PMQTLKGHFNWVLCVAWSPDGELIATGSMDNTIRLWQSEKGENFGDALRGHSKWITSLSW 236

Query: 255 D---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +        D   L +AS D  +++WD + R  +    GH     CV
Sbjct: 237 EPIHLVKPGDKPRLASASKDGTIKIWDTARRVCLFTLSGHTNSVSCV 283

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 6/86 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           ++PVT+   A + + + IL S+   H    + T + D+TAR+W  + +  ++ TL GH  
Sbjct: 128 VRPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCNTNTPMQ-TLKGHFN 186

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLW 277
           WV   A+S D   + T S D+ +RLW
Sbjct: 187 WVLCVAWSPDGELIATGSMDNTIRLW 212

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 244 TTLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + + GH   +   AF+   S+ +VT + D+  R+WD +T   ++   GH    +CVA
Sbjct: 136 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCNTNTPMQTLKGHFNWVLCVA 192

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 112/252 (44%), Gaps = 17/252 (6%)

Query: 63  TNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAP 118
           T+P P+ +     +G R +V S+    DN  + T+S +G +K+W++ + S  R ++    
Sbjct: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN 178
           +    + P    ++   R+GN++++DL  +     +    + ++ SL + +DG  L   +
Sbjct: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488

Query: 179 TKGNCYVWEMPNHTD-----ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSAD 228
              +   W+     +     +    P       ST      I  I +S D K LA    D
Sbjct: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548

Query: 229 HTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
           +T +V+ +D   K   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 549 NTVKVFFLDS-MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607

Query: 289 GGHHKGAVCVAL 300
             H    +CV  
Sbjct: 608 FAHQDSIMCVKF 619

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 122/292 (41%), Gaps = 28/292 (9%)

Query: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87
           +Q S + V  ++I++D  LLATA +  ++++++ T   + + +FE   G   +  F    
Sbjct: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438

Query: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             +V  + +G ++++D+ S  +    +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498

Query: 146 GENQ---------------CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190
              Q                 H  T E    + S+ ++ D   LA +       V+ + +
Sbjct: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558

Query: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250
                 +K       H   +  + +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 559 ------MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCHKSLFAHQ 611

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
             +    F   S    +AS D +V+ WD    E +++   H      +A++D
Sbjct: 612 DSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 109/254 (42%), Gaps = 24/254 (9%)

Query: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHS-DSQVNRLEITND-KKLLATAGHQNVRLYDI 60
           +++V    +  ++ ++  + V   TI+ + +  +  L++TND K+L+  +  ++++ +D 
Sbjct: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498

Query: 61  RTTNPNPVASFEGH--------------RGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106
           +        + + +                ++ S+    D++++  S  D T+KV+ + S
Sbjct: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558

Query: 107 PSIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165
                + Y H  PV  + I  +   +I+   D NI+IW L    C   L    D S+  +
Sbjct: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD-SIMCV 617

Query: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225
                     +A+  G    W      D    + + K  AH + +  + +S + + + + 
Sbjct: 618 KFLPGSHNFFSASKDGFVKYW------DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671

Query: 226 SADHTARVWSIDDD 239
           S DH+ R+W   DD
Sbjct: 672 SHDHSIRIWEETDD 685

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90
           ++V+ L+  ++  L+A AG+ +  ++L+D+   +   + SF GH+  +T + F +    +
Sbjct: 78  AEVSYLQFHSETGLIA-AGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQL 134

Query: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149
           ++ SED  I VWD+ S   + +   H   +  +    +   LIS  +DG I++WDL   Q
Sbjct: 135 ISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQ 193

Query: 150 CTH 152
           C  
Sbjct: 194 CIE 196

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 81/195 (41%), Gaps = 26/195 (13%)

Query: 99  IKVWDVRS-----------PSIPRNYKHNAP--VNEVVIHPNQGELISCDRDGNIRIWDL 145
           I VWD+++           P    + K + P  V+ +  H   G + +   DG I++WDL
Sbjct: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDL 106

Query: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA 205
                         + +  L     G+ L + +   N  VW++ +         + K R+
Sbjct: 107 VSKTVLLSFNGHK-SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVG------LYKLRS 159

Query: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC-AFSADSAY 264
           H   IT +   SD   L + S D   +VW    D K +  ++ H     +C A    + +
Sbjct: 160 HKGTITGLWCDSD-NWLISTSKDGLIKVW----DLKTQQCIETHIAHTGECWALGIMTDF 214

Query: 265 LVTASSDHYVRLWDL 279
           +VT+S+D  +++W +
Sbjct: 215 VVTSSADSQLKIWQM 229

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 49/106 (46%), Gaps = 4/106 (3%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L+S   D  I  W+ ++ V    ++     +  L   +D  L++T+    ++++D++T  
Sbjct: 134 LISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQ- 192

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIP 110
              + +   H G   ++    D  ++VTSS D  +K+W +     P
Sbjct: 193 -QCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEP 235

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 73.2 bits (178), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 134/299 (44%), Gaps = 34/299 (11%)

Query: 4   ILVSAGYDHTIRFWEAL-----TGVCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVRL 57
           +LVSA  D T+  W+        GV  R+ +     V  + +T D    L+ +  + +RL
Sbjct: 32  LLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLRL 91

Query: 58  YDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNA 117
           +++ T        F GH+ +V SV+  +    +++ S D +IKVW ++   +     HN 
Sbjct: 92  WEVATGET--FQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQCLATLLGHND 149

Query: 118 PVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDG 171
            V++V + PN  +      +IS   D  ++ W+L + Q        +  ++ +++ + DG
Sbjct: 150 WVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNG-NVNTITASPDG 208

Query: 172 SMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTA 231
           S++A+A   G   +W + +      L    +  A +    R  L++     AT S     
Sbjct: 209 SLIASAGKDGEIMLWNLADKVPMYTLNAQDEVFALAFSPNRYWLAA-----ATASG---I 260

Query: 232 RVWSID-----DDFKLETTLDGHQRWVWDCA----FSADSAYLVTASSDHYVRLWDLST 281
           +V+S+D     DD + E    G+ +     A    +SAD   L    +D+ +R+W + T
Sbjct: 261 KVFSLDPQALIDDLRPE--FAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 107/228 (46%), Gaps = 24/228 (10%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  +V++S D T+  W    D +   +P R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +V + P+    +S   D  +R+W++   + T Q      + + S+++    SM+ + +  
Sbjct: 70  DVTLTPDGAYALSASWDKTLRLWEVATGE-TFQRFVGHKSDVMSVAIDRKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKH------LATCSADHTARVW 234
            +  VW +     A+ L        H+ +++++ ++ + K       + +   D   + W
Sbjct: 129 KSIKVWTIKGQCLATLL-------GHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAW 181

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +++  F++E    GH   V     S D + + +A  D  + LW+L+ +
Sbjct: 182 NLNQ-FQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADK 228

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHL-ATCSADHTARVWSI-DDDFKLET---TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +  DD K+     +  GH   V D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            + D AY ++AS D  +RLW+++T E  +++ GH    + VA++
Sbjct: 73  LTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAID 116

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 79/191 (41%), Gaps = 23/191 (12%)

Query: 115 HNAPVNEVVIHPNQGEL-ISCDRDGNIRIWDL-GENQCTHQLTPEDDTS-----LQSLSM 167
           HN  V  +     Q  L +S  RD  +  W L G++Q      P          +Q +++
Sbjct: 16  HNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVG--VPVRSFKGHSHIVQDVTL 73

Query: 168 ASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSA 227
             DG+   +A+      +WE+         +   +F  H + +  + +      + + S 
Sbjct: 74  TPDGAYALSASWDKTLRLWEVATG------ETFQRFVGHKSDVMSVAIDRKASMIISGSR 127

Query: 228 DHTARVWSIDDDFKLETTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLST 281
           D + +VW+I    +   TL GH  WV     +       ++  +++A +D  V+ W+L+ 
Sbjct: 128 DKSIKVWTIKG--QCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQ 185

Query: 282 REIVRQYGGHH 292
            +I   + GH+
Sbjct: 186 FQIEADFVGHN 196

>NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231
          Length = 767

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 127/305 (41%), Gaps = 35/305 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  +    R +      V  L   +D+KL+  +  + +R+++ +T 
Sbjct: 374 LLFTGSYDSTIAIWDLCSNKLIRRLSGHTDGVKTLHF-DDQKLVTGSLDKTIRVWNYKTG 432

Query: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123
               ++++ GH  ++ SV   +  + +V+ S D TIKVW V S +      H   VN V 
Sbjct: 433 QC--ISTYRGHTDSIMSVDSYK--KIIVSGSADKTIKVWHVESRTCYTLRGHTEWVNCVK 488

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDDTSLQSLSMAS---- 169
           +HP      S   D  IR+WD+  N C            ++ P     +++L   S    
Sbjct: 489 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKIFKGHVGQVQKVIPLTIIDVENLVTDSEDIT 548

Query: 170 ----DGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225
               D +M     T           +    +L           Y T +L         +C
Sbjct: 549 ASDDDVAMTNDTTTNEPTTNNNDNANGVDENLPQTQTLDESIPYPTHLL---------SC 599

Query: 226 SADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S D+T ++W +     + T   GH   VWD A  AD+  +++ S D  +++WDL + + +
Sbjct: 600 SLDNTIKLWDVKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCM 656

Query: 286 RQYGG 290
             + G
Sbjct: 657 HTFHG 661

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 85/225 (37%), Gaps = 58/225 (25%)

Query: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V ++ F  + R + T S D TI +WD+ S  + R    H   V    +H 
Sbjct: 355 IQEFKGHLDGVLTLQF--NYRLLFTGSYDSTIAIWDLCSNKLIRRLSGHTDGVK--TLHF 410

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           +  +L++   D  IR+W+    QC                                    
Sbjct: 411 DDQKLVTGSLDKTIRVWNYKTGQC------------------------------------ 434

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246
                        ++ +R H+  I  +   S  K + + SAD T +VW ++   +   TL
Sbjct: 435 -------------ISTYRGHTDSIMSV--DSYKKIIVSGSADKTIKVWHVES--RTCYTL 477

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 478 RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKIFKGH 522

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 90  MVTSSEDGTIKVWDVRSPSIPR-NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN 148
           +++ S D TIK+WDV++    R  + H   V ++    +   +IS   DG+I+IWDL   
Sbjct: 596 LLSCSLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 653

Query: 149 QCTH-----QLTPEDDT 160
           +C H     +L P+DD+
Sbjct: 654 KCMHTFHGKKLQPQDDS 670

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
             GH   V    F  +   L T S D  + +WDL + +++R+  GH  G   +  +D
Sbjct: 358 FKGHLDGVLTLQF--NYRLLFTGSYDSTIAIWDLCSNKLIRRLSGHTDGVKTLHFDD 412

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 132/298 (44%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L+ +  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+D+ T        F GH+ +V SV   +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             V++V + PN+        +IS   D  ++ W+L + Q         ++++ +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHT 230
           G+++A+A   G   +W +         K +    A     + +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLAAK------KAMYTLSAQDEVFS-LAFSPNRYWLAAATATGI 260

Query: 231 ARVWSIDDDF---KLETTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            +V+S+D  +    L     G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 85/218 (38%), Gaps = 46/218 (21%)

Query: 67  PVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-PSIPRNYKHNAPVNEVVIH 125
           PV SF+GH   V   +   D  + +++S D T+++WDV +  +  R   H + V  V I 
Sbjct: 57  PVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

Query: 126 PNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYV 185
                +IS  RD  I++W + + QC   L   +D                          
Sbjct: 117 KKASMIISGSRDKTIKVWTI-KGQCLATLLGHND-------------------------- 149

Query: 186 WEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETT 245
           W        S ++ V   +A    +T I          +   D   + W+++  F++E  
Sbjct: 150 W-------VSQVRVVPNEKADDDSVTII----------SAGNDKMVKAWNLNQ-FQIEAD 191

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
             GH   +     S D   + +A  D  + LW+L+ ++
Sbjct: 192 FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHLA-TCSADHTARVWSI-DDDFKLET---TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +  DD K      +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 92/238 (38%), Gaps = 66/238 (27%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  ++++S D T+  W    D +   +P R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +  +  +    +S   D  +R+WD+   + T+Q                           
Sbjct: 70  DCTLTADGAYALSASWDKTLRLWDVATGE-TYQ--------------------------- 101

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
                                +F  H + +  + +      + + S D T +VW+I    
Sbjct: 102 ---------------------RFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-- 138

Query: 241 KLETTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +   TL GH  WV             DS  +++A +D  V+ W+L+  +I   + GH+
Sbjct: 139 QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHN 196

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 69/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           SV ++SAG D  ++ W                 +N+ +I  D                  
Sbjct: 166 SVTIISAGNDKMVKAW----------------NLNQFQIEAD------------------ 191

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNE 121
                    F GH  N+ +++   D   + ++ +DG I +W++ +            V  
Sbjct: 192 ---------FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DDTSLQSLSMASDGSML 174
           +   PN+  L +    G I+++ L        L PE        +    SL+ ++DG  L
Sbjct: 243 LAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTL 301

Query: 175 AAANTKGNCYVWEM 188
            A  T     VW++
Sbjct: 302 FAGYTDNVIRVWQV 315

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 132/298 (44%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L+ +  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+D+ T        F GH+ +V SV   +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             V++V + PN+        +IS   D  ++ W+L + Q         ++++ +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHT 230
           G+++A+A   G   +W +         K +    A     + +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLAAK------KAMYTLSAQDEVFS-LAFSPNRYWLAAATATGI 260

Query: 231 ARVWSIDDDF---KLETTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            +V+S+D  +    L     G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 85/218 (38%), Gaps = 46/218 (21%)

Query: 67  PVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-PSIPRNYKHNAPVNEVVIH 125
           PV SF+GH   V   +   D  + +++S D T+++WDV +  +  R   H + V  V I 
Sbjct: 57  PVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

Query: 126 PNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYV 185
                +IS  RD  I++W + + QC   L   +D                          
Sbjct: 117 KKASMIISGSRDKTIKVWTI-KGQCLATLLGHND-------------------------- 149

Query: 186 WEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETT 245
           W        S ++ V   +A    +T I          +   D   + W+++  F++E  
Sbjct: 150 W-------VSQVRVVPNEKADDDSVTII----------SAGNDKMVKAWNLNQ-FQIEAD 191

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
             GH   +     S D   + +A  D  + LW+L+ ++
Sbjct: 192 FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHLA-TCSADHTARVWSI-DDDFKLET---TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +  DD K      +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 92/238 (38%), Gaps = 66/238 (27%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  ++++S D T+  W    D +   +P R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +  +  +    +S   D  +R+WD+   + T+Q                           
Sbjct: 70  DCTLTADGAYALSASWDKTLRLWDVATGE-TYQ--------------------------- 101

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
                                +F  H + +  + +      + + S D T +VW+I    
Sbjct: 102 ---------------------RFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-- 138

Query: 241 KLETTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +   TL GH  WV             DS  +++A +D  V+ W+L+  +I   + GH+
Sbjct: 139 QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHN 196

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 69/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           SV ++SAG D  ++ W                 +N+ +I  D                  
Sbjct: 166 SVTIISAGNDKMVKAW----------------NLNQFQIEAD------------------ 191

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNE 121
                    F GH  N+ +++   D   + ++ +DG I +W++ +            V  
Sbjct: 192 ---------FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DDTSLQSLSMASDGSML 174
           +   PN+  L +    G I+++ L        L PE        +    SL+ ++DG  L
Sbjct: 243 LAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTL 301

Query: 175 AAANTKGNCYVWEM 188
            A  T     VW++
Sbjct: 302 FAGYTDNVIRVWQV 315

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 132/298 (44%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L+ +  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+D+ T        F GH+ +V SV   +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             V++V + PN+        +IS   D  ++ W+L + Q         ++++ +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHT 230
           G+++A+A   G   +W +         K +    A     + +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLAAK------KAMYTLSAQDEVFS-LAFSPNRYWLAAATATGI 260

Query: 231 ARVWSIDDDF---KLETTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            +V+S+D  +    L     G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 85/218 (38%), Gaps = 46/218 (21%)

Query: 67  PVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-PSIPRNYKHNAPVNEVVIH 125
           PV SF+GH   V   +   D  + +++S D T+++WDV +  +  R   H + V  V I 
Sbjct: 57  PVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

Query: 126 PNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYV 185
                +IS  RD  I++W + + QC   L   +D                          
Sbjct: 117 KKASMIISGSRDKTIKVWTI-KGQCLATLLGHND-------------------------- 149

Query: 186 WEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETT 245
           W        S ++ V   +A    +T I          +   D   + W+++  F++E  
Sbjct: 150 W-------VSQVRVVPNEKADDDSVTII----------SAGNDKMVKAWNLNQ-FQIEAD 191

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
             GH   +     S D   + +A  D  + LW+L+ ++
Sbjct: 192 FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHLA-TCSADHTARVWSI-DDDFKLET---TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +  DD K      +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 92/238 (38%), Gaps = 66/238 (27%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  ++++S D T+  W    D +   +P R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +  +  +    +S   D  +R+WD+   + T+Q                           
Sbjct: 70  DCTLTADGAYALSASWDKTLRLWDVATGE-TYQ--------------------------- 101

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
                                +F  H + +  + +      + + S D T +VW+I    
Sbjct: 102 ---------------------RFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-- 138

Query: 241 KLETTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +   TL GH  WV             DS  +++A +D  V+ W+L+  +I   + GH+
Sbjct: 139 QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHN 196

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 69/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           SV ++SAG D  ++ W                 +N+ +I  D                  
Sbjct: 166 SVTIISAGNDKMVKAW----------------NLNQFQIEAD------------------ 191

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNE 121
                    F GH  N+ +++   D   + ++ +DG I +W++ +            V  
Sbjct: 192 ---------FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DDTSLQSLSMASDGSML 174
           +   PN+  L +    G I+++ L        L PE        +    SL+ ++DG  L
Sbjct: 243 LAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTL 301

Query: 175 AAANTKGNCYVWEM 188
            A  T     VW++
Sbjct: 302 FAGYTDNVIRVWQV 315

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 132/298 (44%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L+ +  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+D+ T        F GH+ +V SV   +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             V++V + PN+        +IS   D  ++ W+L + Q         ++++ +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHT 230
           G+++A+A   G   +W +         K +    A     + +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLAAK------KAMYTLSAQDEVFS-LAFSPNRYWLAAATATGI 260

Query: 231 ARVWSIDDDF---KLETTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            +V+S+D  +    L     G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 85/218 (38%), Gaps = 46/218 (21%)

Query: 67  PVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-PSIPRNYKHNAPVNEVVIH 125
           PV SF+GH   V   +   D  + +++S D T+++WDV +  +  R   H + V  V I 
Sbjct: 57  PVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

Query: 126 PNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYV 185
                +IS  RD  I++W + + QC   L   +D                          
Sbjct: 117 KKASMIISGSRDKTIKVWTI-KGQCLATLLGHND-------------------------- 149

Query: 186 WEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETT 245
           W        S ++ V   +A    +T I          +   D   + W+++  F++E  
Sbjct: 150 W-------VSQVRVVPNEKADDDSVTII----------SAGNDKMVKAWNLNQ-FQIEAD 191

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
             GH   +     S D   + +A  D  + LW+L+ ++
Sbjct: 192 FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHLA-TCSADHTARVWSI-DDDFKLET---TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +  DD K      +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 92/238 (38%), Gaps = 66/238 (27%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  ++++S D T+  W    D +   +P R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +  +  +    +S   D  +R+WD+   + T+Q                           
Sbjct: 70  DCTLTADGAYALSASWDKTLRLWDVATGE-TYQ--------------------------- 101

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
                                +F  H + +  + +      + + S D T +VW+I    
Sbjct: 102 ---------------------RFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-- 138

Query: 241 KLETTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +   TL GH  WV             DS  +++A +D  V+ W+L+  +I   + GH+
Sbjct: 139 QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHN 196

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 69/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           SV ++SAG D  ++ W                 +N+ +I  D                  
Sbjct: 166 SVTIISAGNDKMVKAW----------------NLNQFQIEAD------------------ 191

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNE 121
                    F GH  N+ +++   D   + ++ +DG I +W++ +            V  
Sbjct: 192 ---------FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DDTSLQSLSMASDGSML 174
           +   PN+  L +    G I+++ L        L PE        +    SL+ ++DG  L
Sbjct: 243 LAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTL 301

Query: 175 AAANTKGNCYVWEM 188
            A  T     VW++
Sbjct: 302 FAGYTDNVIRVWQV 315

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 98/221 (44%), Gaps = 21/221 (9%)

Query: 77  NVTSVSFQQDNRWMVTSSEDGT---------IKVWD-VRSPSIPRNYKHNAPVNEVVIHP 126
           N+    ++Q N   V  S+DGT         + V+D + + S    Y+H   +  + ++ 
Sbjct: 9   NLLGTVYRQGN---VIFSDDGTKLLSPVGNRVSVFDLINNKSFTFEYEHRKNIARIDLNK 65

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
               L+S D DG   + +       H     +   +  L  + DG + A A  +    +W
Sbjct: 66  QGTLLLSVDEDGRAILVNFKSRNVLHHFNFRE--KVYDLKFSPDGRLFALACGRF-IQIW 122

Query: 187 EMPNHTDASHLKPVTKFRAHSTYITRILL---SSDVKHLATCSADHTARVWSIDDDFK-- 241
           + P+ ++     P  ++R H+ +   I+    S D + + + S D TAR+WSID + K  
Sbjct: 123 KTPDVSEDRQFAPFVRYRVHAGHFADIISLTWSPDSRFITSTSKDLTARIWSIDSEEKDL 182

Query: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
              T  GH+ +V +  FSAD   + T S D  +  W+ + R
Sbjct: 183 ASMTFAGHKDYVVNSFFSADQEIIYTISKDGALFQWEYTRR 223

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 100/241 (41%), Gaps = 16/241 (6%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           S +L+    +   R +E       + +    + VN + I N  + LA    +  +L    
Sbjct: 269 SNLLIVGFSNGEFRLYELPHFALIQQLSMGQNAVNTVSINNSGEWLAFGSSKLGQLLVYE 328

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVN 120
             + + +   +GH  ++ S+++  D   +VTSS+DG IK+WDV S      +  H + V 
Sbjct: 329 WQSESYILKQQGHFDSMNSLTYSPDGSRVVTSSDDGKIKIWDVVSGFCLATFDDHTSSVT 388

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
            V        L S   DG ++ WDL   +     T  +      L++   G ++ A +  
Sbjct: 389 AVQFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSVD 448

Query: 181 G-NCYVWEMPN----HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWS 235
               +VW +       T A H  PV+           +  S++   LA+ S D T R+WS
Sbjct: 449 SFEIHVWSVQTGNLLDTLAGHEGPVSC----------LSFSNENSVLASASWDKTIRIWS 498

Query: 236 I 236
           I
Sbjct: 499 I 499

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 94/212 (44%), Gaps = 18/212 (8%)

Query: 78  VTSVSFQQDNRWM-VTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCD 135
           V +VS      W+   SS+ G + V++ +S S I +   H   +N +   P+   +++  
Sbjct: 302 VNTVSINNSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSMNSLTYSPDGSRVVTSS 361

Query: 136 RDGNIRIWDLGENQCTHQLTPEDD--TSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD 193
            DG I+IWD+    C   L   DD  +S+ ++  A  G +L +A+  G    W++  + +
Sbjct: 362 DDGKIKIWDVVSGFC---LATFDDHTSSVTAVQFAKKGQVLFSASLDGTVKAWDLIRYRN 418

Query: 194 ASHLKPVTKFRAHSTYITRILLSSDVKHLATCSAD---HTARVWSIDDDFKLETTLDGHQ 250
                   + + +        L+ D      C+         VWS+     L  TL GH+
Sbjct: 419 FRTFTAAERIQFNC-------LAVDPSGEVVCAGSVDSFEIHVWSVQTG-NLLDTLAGHE 470

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
             V   +FS +++ L +AS D  +R+W +  R
Sbjct: 471 GPVSCLSFSNENSVLASASWDKTIRIWSIFGR 502

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 48/97 (49%), Gaps = 10/97 (10%)

Query: 20  LTGVCSRTIQH---SDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPN----PVASFE 72
           L    SR + H      +V  L+ + D +L A A  + ++++     + +    P   + 
Sbjct: 81  LVNFKSRNVLHHFNFREKVYDLKFSPDGRLFALACGRFIQIWKTPDVSEDRQFAPFVRYR 140

Query: 73  ---GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106
              GH  ++ S+++  D+R++ ++S+D T ++W + S
Sbjct: 141 VHAGHFADIISLTWSPDSRFITSTSKDLTARIWSIDS 177

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 127/314 (40%), Gaps = 58/314 (18%)

Query: 21  TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTS 80
           T +CS+   H+ S           +++  AG    R++D  T  P  +A+  GH+  V  
Sbjct: 145 TILCSQFAPHTSS-----------RMVTGAGDNTARVWDCDTQTP--MATLSGHQNWVLC 191

Query: 81  VSFQQDNRWMVTSSEDGTIKVWDVRS--PSIPRNYKHNAPVNEVVIHP-------NQGEL 131
           V++  D   + T S D T+++WD ++  P       H   +  +V  P       ++  L
Sbjct: 192 VAWSPDGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRL 251

Query: 132 ISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEM--- 188
            S  +DG I+IWD     C + L+   + S+  +     G + + ++ K    VW+M   
Sbjct: 252 ASASKDGTIKIWDTSRRVCIYTLSGHTN-SVSCVKWGGQGLLYSGSHDK-TVRVWDMNVG 309

Query: 189 -------------PNHTDAS-----HLKP----VTKFRAHSTYITRILLSSDV------- 219
                         NH   S      + P     TKF +      + L + +        
Sbjct: 310 GKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALENYEKIAKRNGK 369

Query: 220 --KHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             + + T S D T  +W      K    L GHQ+ V   AFS D  ++V+AS D+ ++LW
Sbjct: 370 AEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLW 429

Query: 278 DLSTREIVRQYGGH 291
           D      +  + GH
Sbjct: 430 DGRNGTFISTFRGH 443

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 77/335 (22%), Positives = 138/335 (41%), Gaps = 56/335 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQ-NVRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D + +AT      VRL+D +  
Sbjct: 159 MVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVAWSPDGETIATGSMDCTVRLWDSKAG 218

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSIPRNYKH 115
            P   A  +GH+  +TS+ ++        D   + ++S+DGTIK+WD  R   I     H
Sbjct: 219 QPLGDA-LKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRVCIYTLSGH 277

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLG-ENQCTHQLT------------------- 155
              V+  V    QG L S   D  +R+WD+    +C + L                    
Sbjct: 278 TNSVS-CVKWGGQGLLYSGSHDKTVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRV 336

Query: 156 -PEDDTSLQSLSM------------------ASDGSMLAAANTKGNCYVWEMPNHTDASH 196
            P D T+ +  S                        ++  A+     ++W+ P  +    
Sbjct: 337 GPFDHTATKFTSAEEARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWD-PTKSG--- 392

Query: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256
            KP+ +   H   +  +  S D + + + S D++ ++W    +    +T  GH   V+  
Sbjct: 393 -KPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWD-GRNGTFISTFRGHVASVYQV 450

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           A+S+D   LV+ S D  +++WD+ TR++     GH
Sbjct: 451 AWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/283 (21%), Positives = 115/283 (40%), Gaps = 30/283 (10%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    + V+ ++      L + +  + VR++D+    
Sbjct: 251 LASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWGGQGLLYSGSHDKTVRVWDMNVGG 310

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMV----------TSSEDGTIKVWDVRSPSIPRNYK 114
              +   + H   V  +S   +    V          TS+E+   K  +    +  +  K
Sbjct: 311 -KCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALE----NYEKIAK 365

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSML 174
            N    E++        ++   D  + +WD  ++             +  ++ + DG  +
Sbjct: 366 RNGKAEELI--------VTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFI 417

Query: 175 AAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW 234
            +A+   +  +W+  N T       ++ FR H   + ++  SSD + L +CS D T +VW
Sbjct: 418 VSASFDNSIKLWDGRNGTF------ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 471

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            +    KL   L GH+  V+   +S D   + +   D  VRLW
Sbjct: 472 DVRTR-KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 46/107 (42%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRW----VW 254
           P+     H  ++  +  S D + +AT S D T R+W       L   L GHQ+W    VW
Sbjct: 178 PMATLSGHQNWVLCVAWSPDGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSLVW 237

Query: 255 D---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +        D   L +AS D  +++WD S R  +    GH     CV
Sbjct: 238 EPLHLVKPGDKPRLASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCV 284

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 197 LKPVTKFR-AHSTYITRILLSSDVKH----LATCSADHTARVWSIDDDFKLETTLDGHQR 251
           +KP+T+   A + +   IL S    H    + T + D+TARVW  D    +  TL GHQ 
Sbjct: 129 VKPITRSSSAIAGHGATILCSQFAPHTSSRMVTGAGDNTARVWDCDTQTPM-ATLSGHQN 187

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWD 278
           WV   A+S D   + T S D  VRLWD
Sbjct: 188 WVLCVAWSPDGETIATGSMDCTVRLWD 214

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADHTARVWSIDDDFKLE------TTLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D    +++    FK++      + + GH   +    F+   S
Sbjct: 97  ITDNLYSSLLKPGLKTTEDQITLIYTPRAVFKVKPITRSSSAIAGHGATILCSQFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + +VT + D+  R+WD  T+  +    GH    +CVA
Sbjct: 157 SRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVA 193

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 117/274 (42%), Gaps = 22/274 (8%)

Query: 46  LLATAGHQNVRLYDI-------RTTNPNPVASFE--GHRGNVTSVSFQQDNRWMVTSSED 96
           L+ T     V  Y I       +   PN + S E  GHR +V ++    D+  + T+S +
Sbjct: 347 LVVTTASNTVEYYTIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATAS-N 405

Query: 97  GTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTP 156
           GT+KVW++++    R +     +    + P    ++   R+G+++++DL  +        
Sbjct: 406 GTLKVWNLKTRMCLRTFDCGYALCCRFL-PGGFLIVVGTRNGDLQLFDLASSTMLDNKEG 464

Query: 157 EDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD-----ASHLKPVTKFRAHSTY-- 209
             D ++ SL + SDG  L   +   +   W+     D          PV K    +T   
Sbjct: 465 AHDAAIWSLDITSDGKKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLEL 524

Query: 210 ---ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLV 266
              +  + +S + K+ A    D+T +V+ +D   K   +L GH+  V     S DS  ++
Sbjct: 525 NDDVLSVRISPEDKYFAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSKVII 583

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300
           T+S+D  +++W L   +  +    H    + V  
Sbjct: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 617

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 58/295 (19%), Positives = 126/295 (42%), Gaps = 28/295 (9%)

Query: 25  SRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQ 84
           S  +Q   + V  ++I+ND  LLATA +  +++++++T     + +F+   G      F 
Sbjct: 378 SVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTR--MCLRTFDC--GYALCCRFL 433

Query: 85  QDNRWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRI 142
                +V  + +G ++++D+ S ++  N +  H+A +  + I  +  +L++   D +++ 
Sbjct: 434 PGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSDGKKLVTGSADKSVKF 493

Query: 143 WDLGEN---------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187
           W                    + +H  T E +  + S+ ++ +    A +       V+ 
Sbjct: 494 WKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDKYFAISLLDNTVKVFF 553

Query: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247
           + +      +K       H   +  I +S D K + T SAD   ++W +D       +L 
Sbjct: 554 LDS------MKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDFG-DCHKSLF 606

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302
            HQ  +    F  +S    + S D  V+ WD    E +++  GH      +A+++
Sbjct: 607 AHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALAISN 661

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62
           L++ GY +  I+ W+ ++     T+    S V  L+      +L++ +   N+ ++D+  
Sbjct: 89  LLAVGYAEGVIKVWDLMSKTVLLTLNGHKSAVTILKFDITGTRLISGSQDSNIIMWDL-- 146

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNE 121
                +     H+G ++ +  ++D  W++++S DG IKVWD+++   +  +  H      
Sbjct: 147 IGEVGLYKLRSHKGAISGLWLEKD-EWLISTSRDGLIKVWDLKTQQCVETHIAHTGECWS 205

Query: 122 VVIHPNQGELISCDRDGNIRIWDL 145
           + +H +    I+   D  ++IW L
Sbjct: 206 LGVHEDLA--ITASADSQVKIWHL 227

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91
           ++   LE   +  LLA    + V +++D+   +   + +  GH+  VT + F      ++
Sbjct: 76  AETTYLEYHAETNLLAVGYAEGVIKVWDL--MSKTVLLTLNGHKSAVTILKFDITGTRLI 133

Query: 92  TSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           + S+D  I +WD +    + +   H   ++ + +  ++  LIS  RDG I++WDL   QC
Sbjct: 134 SGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEW-LISTSRDGLIKVWDLKTQQC 192

Query: 151 TH 152
             
Sbjct: 193 VE 194

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 60/115 (52%), Gaps = 4/115 (3%)

Query: 38  LEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSED 96
           ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + S+D
Sbjct: 573 IDISFDSKVIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSCSKD 630

Query: 97  GTIKVWDV-RSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           G +K WD  +   I +   H + V  + I  N   ++S   D +IRIW+  E+Q 
Sbjct: 631 GLVKYWDGDKFECIQKLAGHQSEVWALAISNNGKYVVSASHDRSIRIWEETEDQV 685

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 62/144 (43%), Gaps = 11/144 (7%)

Query: 137 DGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASH 196
           +G I++WDL        L     +++  L     G+ L + +   N  +W++        
Sbjct: 96  EGVIKVWDLMSKTVLLTLNGHK-SAVTILKFDITGTRLISGSQDSNIIMWDLIGEVG--- 151

Query: 197 LKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256
              + K R+H   I+ + L  D + L + S D   +VW +     +ET +  H    W  
Sbjct: 152 ---LYKLRSHKGAISGLWLEKD-EWLISTSRDGLIKVWDLKTQQCVETHI-AHTGECWSL 206

Query: 257 AFSADSAYLVTASSDHYVRLWDLS 280
               D A  +TAS+D  V++W L+
Sbjct: 207 GVHEDLA--ITASADSQVKIWHLN 228

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 46/108 (42%), Gaps = 10/108 (9%)

Query: 189 PNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248
           P   DA   KP     A +TY+      ++   LA   A+   +VW +     L  TL+G
Sbjct: 65  PGSIDAKSTKP-----AETTYLE---YHAETNLLAVGYAEGVIKVWDLMSKTVL-LTLNG 115

Query: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 296
           H+  V    F      L++ S D  + +WDL   E+       HKGA+
Sbjct: 116 HKSAVTILKFDITGTRLISGSQDSNIIMWDL-IGEVGLYKLRSHKGAI 162

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 110/261 (42%), Gaps = 44/261 (16%)

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           + T P  V  +EGH   + S+    D  W+ T+S+D ++ +W   +      Y+   P  
Sbjct: 376 KETFPIEVKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHA-----KYEDFYPYT 430

Query: 121 EVVIH---------PNQGE------LISCDRDGNIRIWDLGENQCTHQLTPED------- 158
           + V H         PN         +I+   D  I+ W + +        PED       
Sbjct: 431 KFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDE---PEDLILVKTS 487

Query: 159 -------DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYIT 211
                  +  + ++S++ + S+ A A+    C +W + +    + L        H   + 
Sbjct: 488 EYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLA------NHKRGLW 541

Query: 212 RILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSD 271
            +      K LATCS D T ++WS++  + +  TL+GH   V  C+F   +  L++  +D
Sbjct: 542 DVAFCQYDKLLATCSGDKTIKIWSLES-YAVVKTLEGHTNAVQRCSFINKNKQLISTGAD 600

Query: 272 HYVRLWDLSTREIVRQYGGHH 292
             V +WDLST E V+    H+
Sbjct: 601 GLVIIWDLSTGESVKTLDAHN 621

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 104/273 (38%), Gaps = 38/273 (13%)

Query: 30  HSDSQVNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSFQQD 86
           H+D  +N L+ T D   +ATA   +  +   Y  +  +  P   F GH G+V +V     
Sbjct: 389 HTD-LLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLPNV 447

Query: 87  N-----RWMVTSSEDGTIKVWDVRSPSI----PRNY-----------KHNAPVNEVVIHP 126
                  +++T+S D TIK W V  P +    P +             H   +N + I P
Sbjct: 448 MPRSWPEFIITASNDLTIKKWKV--PKVTSDEPEDLILVKTSEYTRRAHEKDINAISISP 505

Query: 127 NQGELISCDRDGNIRIWDL--GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCY 184
           N     +   D   +IW+L  GE Q T          L  ++      +LA  +      
Sbjct: 506 NDSLFATASYDKTCKIWNLDDGEFQAT---LANHKRGLWDVAFCQYDKLLATCSGDKTIK 562

Query: 185 VWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLET 244
           +W + ++        V     H+  + R    +  K L +  AD    +W +     ++T
Sbjct: 563 IWSLESYA------VVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKT 616

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            LD H   +W  A   D    VTA +D +   W
Sbjct: 617 -LDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62
           +  +A YD T + W    G    T+ +    +  +      KLLAT +G + ++++ + +
Sbjct: 509 LFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLES 568

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-PSIPRNYKHNAPVNE 121
                V + EGH   V   SF   N+ ++++  DG + +WD+ +  S+     HN  +  
Sbjct: 569 Y--AVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWA 626

Query: 122 VVIHPNQGELISCDRDGNIRIW-DLGE-----NQCTHQLTPEDDTSLQS 164
           + +  +    ++ D DG    W D  E     N    +L  E + SLQ+
Sbjct: 627 LAVMNDGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQSLQN 675

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 73.2 bits (178), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 127/297 (42%), Gaps = 22/297 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +    D +L+AT    N +RL+D    
Sbjct: 158 MVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWD-SNK 216

Query: 64  NPNPVASFEGHRGNVTSVSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSIPRNYKH 115
             +   +  GH   +TS++++        D   + ++S+DGTIK+WD  R   +     H
Sbjct: 217 GESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGH 276

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSM-L 174
              V+  V    +G L S   D  IR WD+        +       +  LS+ +D ++ +
Sbjct: 277 TNSVS-CVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRV 335

Query: 175 AAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW 234
            A +  G       P    A  LK   K    +  +  +++        T S D T  +W
Sbjct: 336 GAFDHTGEKP--SSPEEARAKALKNYEKIAKKNGQLEELMV--------TASDDFTMYLW 385

Query: 235 SIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
                 K  T + GHQ+ V   AFS D  Y+V+AS D+ ++LWD      +  + GH
Sbjct: 386 DPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGH 442

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 116/278 (41%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    + V+ ++      L + +  + +R +D+    
Sbjct: 250 LASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDM-AAG 308

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124
              +   + H   +  +S   D    V + +    K      PS P   +  A  N   I
Sbjct: 309 GKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEK------PSSPEEARAKALKNYEKI 362

Query: 125 HPNQGEL----ISCDRDGNIRIWD-LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANT 179
               G+L    ++   D  + +WD L  ++   ++T      +  ++ + DG  + +A+ 
Sbjct: 363 AKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKL-VNHVAFSPDGRYIVSASF 421

Query: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             +  +W+  N T       +  FR H   + ++  SSD + L +CS D T +VW +   
Sbjct: 422 DNSIKLWDGRNGTF------IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK 475

Query: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH   V+   +S D   + +A  D  VR+W
Sbjct: 476 -KLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 75/144 (52%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYDI 60
           ++V+A  D T+  W+ L  +   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 372 LMVTASDDFTMYLWDPLKASKPITRMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 430

Query: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPV 119
           R  N   +A+F GH  +V  V++  D R +V+ S+D T+KVWDVR+  +  +   HN  V
Sbjct: 431 R--NGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEV 488

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +RIW
Sbjct: 489 YTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 94/224 (41%), Gaps = 42/224 (18%)

Query: 4   ILVSAGYDHTIRFWE-ALTGVCSRTIQHSDSQVNRLEITNDKKLLATA------------ 50
           IL S  +D TIR W+ A  G C   ++     +N L +  D  L   A            
Sbjct: 290 ILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPE 349

Query: 51  -------------GHQNVRLYDIRTT----------NP----NPVASFEGHRGNVTSVSF 83
                          +N +L ++  T          +P     P+    GH+  V  V+F
Sbjct: 350 EARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF 409

Query: 84  QQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRI 142
             D R++V++S D +IK+WD R+ +    ++ H A V +V    +   L+SC +D  +++
Sbjct: 410 SPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 469

Query: 143 WDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186
           WD+   + +  L P  +  + ++  + DG  + +A       +W
Sbjct: 470 WDVRTKKLSVDL-PGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 7/107 (6%)

Query: 199 PVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWV----W 254
           P+   + H  ++  +    D + +AT S D+T R+W  +        L GH +W+    W
Sbjct: 177 PMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTW 236

Query: 255 D---CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298
           +      + D   L +AS D  +++WD + R  V    GH     CV
Sbjct: 237 EPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCV 283

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 244 TTLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVA 299
           + + GH   +   AF+   S  +VT S D+  R+WD +T   +    GH    +CVA
Sbjct: 136 SAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVA 192

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 64/271 (23%), Positives = 121/271 (44%), Gaps = 23/271 (8%)

Query: 29  QHSDSQVNRLEITNDK-KLLATAGHQNVRLYDI-----RTTNPNPVASFE----GHRGNV 78
           Q+    V+   ++N K + + T    ++  Y I       T+P P   +     GHR ++
Sbjct: 331 QYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDI 390

Query: 79  TSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDG 138
            SV    D++ + T+S +G +KVW++++ +  R +     +    + P    +I   R+G
Sbjct: 391 RSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFL-PGGTLVIVGTREG 448

Query: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD----- 193
           +++++DL  +          +T++ SL + SDG  L   +       W      D     
Sbjct: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508

Query: 194 ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248
           A    PV K    +T      +  + +S + K LA    D+T +V+ +D   K   +L G
Sbjct: 509 ADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS-MKFFLSLYG 567

Query: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           H+  V     S DS  ++T+S+D  +++W L
Sbjct: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGL 598

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 21/201 (10%)

Query: 5   LVSAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLEITNDKKLLA 48
           LV+   D TI+FW      + + G   +          T    +  V  + I+ + K LA
Sbjct: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543

Query: 49  TAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSP 107
            +   N V+++ + +       S  GH+  V S+    D++ ++TSS D  IK+W +   
Sbjct: 544 ISLLDNTVKVFYLDSMKF--FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601

Query: 108 SIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLS 166
              ++ + H   +  V   P      S  +DG ++ WD  + +C  +L     + + S++
Sbjct: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIA 660

Query: 167 MASDGSMLAAANTKGNCYVWE 187
           + SDG+ + +A+   +  VWE
Sbjct: 661 ITSDGTSVISASHDHSLRVWE 681

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135
           +V SV    +++++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 529 DVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            D NI+IW L    C   L    D S+ ++    +     +++  G    W      D  
Sbjct: 589 ADKNIKIWGLDFGDCHKSLFAHQD-SIMNVKFLPESHNFFSSSKDGLVKYW------DGD 641

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
             + + K  AH + +  I ++SD   + + S DH+ RVW   DD
Sbjct: 642 KFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDD 685

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 57/310 (18%), Positives = 124/310 (40%), Gaps = 68/310 (21%)

Query: 33  SQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVT 92
           + +  ++I++D KLLATA +  +++++++T     +  F+   G   +  F      ++ 
Sbjct: 388 TDIRSVDISDDDKLLATASNGLLKVWNLKTKAC--IRVFDC--GYALTCKFLPGGTLVIV 443

Query: 93  SSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWD------ 144
            + +G+++++D+ S ++  N +  H   +  + I  +   L++   D  I+ W+      
Sbjct: 444 GTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEED 503

Query: 145 ---------LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
                    L   +  H  T E +  + S+ ++ +   LA +       V+ + +     
Sbjct: 504 LVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS----- 558

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID------------------ 237
            +K       H   +  I +S D K + T SAD   ++W +D                  
Sbjct: 559 -MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 617

Query: 238 -----------------------DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
                                  D F+    L  HQ  VW  A ++D   +++AS DH +
Sbjct: 618 KFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSL 677

Query: 275 RLWDLSTREI 284
           R+W+ +  ++
Sbjct: 678 RVWEETDDQV 687

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 46/209 (22%), Positives = 86/209 (41%), Gaps = 23/209 (11%)

Query: 41  TNDKKLLATAGHQNVRLYDIRT-------TNPNPVASFE---GHRGNVTSVSFQQDNRWM 90
           +N    + T+  +N+ ++DI+T       ++  P  S +        V+ + +  +   +
Sbjct: 33  SNSPGSVITSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLL 92

Query: 91  VTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149
                DGTIKVWD+ S S+   +  H + +  +        LIS  RD NI +WDL    
Sbjct: 93  AAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEV 152

Query: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMP-NHTDASHLKPVTKFRAHST 208
             ++L    D          D   L + +  G   +W++       +H+       AH+ 
Sbjct: 153 GLYKLRSHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIETHI-------AHTG 203

Query: 209 YITRILLSSDVKHLATCSADHTARVWSID 237
               + +  D+  L T  AD   ++W++D
Sbjct: 204 ECWAMGVHEDL--LITSGADTQLKLWNLD 230

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90
           ++V+ L   ++  LLA AG+ +  ++++D+ + +   + +F GH+  +T + F      +
Sbjct: 78  AEVSYLHYHDETNLLA-AGYMDGTIKVWDLLSKSV--LLTFNGHKSAITVMKFDVTGTRL 134

Query: 91  VTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           ++ S D  I VWD+ S       + +      +    +  L+S  +DG I+IWDL   QC
Sbjct: 135 ISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQC 194

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 133/299 (44%), Gaps = 35/299 (11%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LATAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L+ +  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHN 116
           L+D+ T        F GH+ +V SV+  +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE-----LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDG 171
             V++V I P         +IS   D  ++ W+L + Q        +  ++ +++ + DG
Sbjct: 149 DWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNG-NVNAVTASPDG 207

Query: 172 SMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTA 231
           S++A+A   G   +W +   T    L    +  A +    R  L++     AT S     
Sbjct: 208 SLIASAGKDGEIMLWNLLEKTAMYTLSAQDEVFALAFSPNRYWLAA-----ATASG---V 259

Query: 232 RVWSID-----DDFKLETTLDGHQRWVWDCA----FSADSAYLVTASSDHYVRLWDLST 281
           +++S+D     DD + E    G+ +     A    +SAD   L    +D+ +R+W + T
Sbjct: 260 KIFSLDPQSLIDDLRPE--FAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRVWQVMT 316

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 5/104 (4%)

Query: 203 FRAHSTYITRILLSSDVKHLA-TCSADHTARVWSI-DDDFKLET---TLDGHQRWVWDCA 257
              H+ ++T +  S+   +L  + S D T   W +  DD K      +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
            + D AY ++AS D  +RLWD++T E  +++ GH    + VA++
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAID 116

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 93/237 (39%), Gaps = 65/237 (27%)

Query: 69  ASFEGHRGNVTSV--SFQQDNRWMVTSSEDGTIKVW----DVRSPSIP-RNYK-HNAPVN 120
            + EGH G VTS+  S  Q N  ++++S D T+  W    D +   +P R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +  +  +    +S   D  +R+WD+   + T+Q                           
Sbjct: 70  DCTLTQDGAYALSASWDKTLRLWDVATGE-TYQ--------------------------- 101

Query: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240
                                +F  H + +  + +      + + S D T +VW+I    
Sbjct: 102 ---------------------RFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG-- 138

Query: 241 KLETTLDGHQRWVWDCAFSA-----DSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +   TL GH  WV     +      D+  +++A +D  V+ W+L+  +I   + GH+
Sbjct: 139 QCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHN 195

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 115/270 (42%), Gaps = 42/270 (15%)

Query: 30  HSDSQVNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSF--- 83
           H+D  +N L+ T D   +ATA   N  +   Y+         A F GH  +VT+V     
Sbjct: 406 HTD-LLNSLDSTEDSLWIATASKDNSCILWRYNAVLEKYQIYAKFLGHASSVTAVGLPNV 464

Query: 84  --QQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIR 141
             +    +++T+S D TIK W V  P+  +N  +N         P++ +L    R  +  
Sbjct: 465 LTKNYPDYVITASNDSTIKKWKVPKPT--KNLDNNDS-----FKPHEVKLSEYTRRAH-- 515

Query: 142 IWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVT 201
                            D  + +LS++ + S+ A A+    C +W++    ++  LK   
Sbjct: 516 -----------------DKDINALSISPNDSIFATASYDKTCKIWDL----ESGDLKAT- 553

Query: 202 KFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSAD 261
               H   +  +      K + T S D T ++WS+D  F +  T +GH   V  C F   
Sbjct: 554 -LVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDT-FTVVKTFEGHSNAVQRCQFINK 611

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
              LV+  +D  +++WD S+ E ++   GH
Sbjct: 612 QKQLVSCGADGLIKIWDCSSGECIKTLDGH 641

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRT-IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           I  +A YD T + W+  +G    T + H     +      DK ++  +G + ++++ + T
Sbjct: 530 IFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDT 589

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
                V +FEGH   V    F    + +V+   DG IK+WD  S    +    H+  +  
Sbjct: 590 F--TVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWA 647

Query: 122 VVIHPNQGELISCDRDGNIRIWD--LGENQ----CTHQLTPEDDTSLQS 164
           + +  +   +IS D DG  + W    GEN+       +L  E + SLQ+
Sbjct: 648 LSVINDGDVIISADADGVFQFWRDCTGENREKDLEKERLKVEQEQSLQN 696

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 62/153 (40%), Gaps = 22/153 (14%)

Query: 162 LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK- 220
           L SL    D   +A A+   +C +W      +   +    KF  H++ +T + L + +  
Sbjct: 410 LNSLDSTEDSLWIATASKDNSCILWRYNAVLEKYQI--YAKFLGHASSVTAVGLPNVLTK 467

Query: 221 ----HLATCSADHTARVWSI---------DDDFKL------ETTLDGHQRWVWDCAFSAD 261
               ++ T S D T + W +         +D FK       E T   H + +   + S +
Sbjct: 468 NYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPN 527

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            +   TAS D   ++WDL + ++      H +G
Sbjct: 528 DSIFATASYDKTCKIWDLESGDLKATLVNHKRG 560

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 8/113 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64
           LVS G D  I+ W+  +G C +T+    +++  L + ND  ++ +A    V  +    T 
Sbjct: 615 LVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWRDCTG 674

Query: 65  PNPVASFEGHRGNVTSVSFQQD--------NRWMVTSSEDGTIKVWDVRSPSI 109
            N     E  R  V      Q+        N +++  + D  +++++V   S+
Sbjct: 675 ENREKDLEKERLKVEQEQSLQNYLANEDWTNAFLLAMTLDHPLRLFNVLRKSL 727

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 41/230 (17%), Positives = 94/230 (40%), Gaps = 28/230 (12%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRD 137
           +T++    D +++  +S +  +K++++      ++ K ++P   + I      L     D
Sbjct: 64  ITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISSPSYVMSIDQTSTLLAVGGTD 123

Query: 138 GNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGS-------MLAAANTKGNCYVWEMPN 190
           G++ + D+  +  TH       T + ++   SD S       +L + +T G   V +M  
Sbjct: 124 GSVTVIDIENSYITHSFKGHGAT-ISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMVK 182

Query: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKH---------LATCSADHTARVWSID--DD 239
                  + +  F+ H++ I  + +     H         L +   D    +W  +    
Sbjct: 183 R------RCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRRK 236

Query: 240 FKLETTLDGHQRWVWDCAFSADSA--YLVTASSDHYVRLWDLSTREIVRQ 287
            KL  T+  +Q+ V  C F   +    + T  SD   ++  +S+ +I+++
Sbjct: 237 SKLIKTIPVYQQ-VEACGFLNGNYEDLIYTGGSDAIFQILSISSNKILKK 285

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 114/252 (45%), Gaps = 21/252 (8%)

Query: 65  PNPVASF----EGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120
           P+P   +    +GHR +V ++    DN+ + T+S +G++K+W++++ S  R ++    + 
Sbjct: 371 PSPPKIYSIDIKGHRTDVRAIDISDDNKLLATAS-NGSLKIWNIKTKSCIRTFECGYALA 429

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
              + P    ++   + G++ ++DL  +     +      ++ SL + +DG  L   +  
Sbjct: 430 CKFL-PGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADGKRLVTGSAD 488

Query: 181 GNCYVWE-------MPNHTDASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSAD 228
            +   W+       +P  TD     P  K    +T      +  + +S D + LA    D
Sbjct: 489 KSVRFWDFQVEQELVPGTTD--KFVPKLKMFHDTTLELNDDVLAVKISPDNRLLAISLLD 546

Query: 229 HTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
           +T +V+ +D   K   +L GH+  V     S DS  L+T+S+D  +++W L   +  +  
Sbjct: 547 NTVKVFFLDS-MKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFGDCHKSL 605

Query: 289 GGHHKGAVCVAL 300
             H    + VA 
Sbjct: 606 FAHSDSIMKVAF 617

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 132/296 (44%), Gaps = 28/296 (9%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVS 82
           + S  I+   + V  ++I++D KLLATA + ++++++I+T   + + +FE   G   +  
Sbjct: 376 IYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTK--SCIRTFEC--GYALACK 431

Query: 83  FQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNI 140
           F      +V  ++ G + ++D+ S ++  + +  H+  +  + +  +   L++   D ++
Sbjct: 432 FLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADGKRLVTGSADKSV 491

Query: 141 RIWDLGENQ-----CTHQLTPE----DDTSLQ------SLSMASDGSMLAAANTKGNCYV 185
           R WD    Q      T +  P+     DT+L+      ++ ++ D  +LA +       V
Sbjct: 492 RFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNRLLAISLLDNTVKV 551

Query: 186 WEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETT 245
           + + +      +K       H   +  I +S D K L T SAD   +VW +D       +
Sbjct: 552 FFLDS------MKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFG-DCHKS 604

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301
           L  H   +   AF  +S    +   D  V+ WD    E +++   H K    +A++
Sbjct: 605 LFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIAIS 660

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 86/218 (39%), Gaps = 23/218 (10%)

Query: 38  LEITND-KKLLATAGHQNVRLYDIRTTN---PNPVASFEGH-----------RGNVTSVS 82
           L++T D K+L+  +  ++VR +D +      P     F                +V +V 
Sbjct: 473 LDLTADGKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVK 532

Query: 83  FQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIR 141
              DNR +  S  D T+KV+ + S     + Y H  PV  + I  +   LI+   D NI+
Sbjct: 533 ISPDNRLLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIK 592

Query: 142 IWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVT 201
           +W L    C   L    D S+  ++   +     +    G    W      D    + + 
Sbjct: 593 VWGLDFGDCHKSLFAHSD-SIMKVAFLPESHNFFSCGKDGLVKYW------DGDKFECIQ 645

Query: 202 KFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239
           K  AH   +  I +S D   + + S D + RVW   DD
Sbjct: 646 KLAAHQKEVWTIAISHDGTFVVSASHDQSIRVWVETDD 683

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 66/178 (37%), Gaps = 19/178 (10%)

Query: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVV 123
           P  V +        T + +  + + +     DG +K+WD+ S S+  N+  H + +  + 
Sbjct: 65  PGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKSAITVLK 124

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNC 183
                  LIS  +D +I +WDL       +L    D+         D   L + +  G  
Sbjct: 125 FDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGED--WLVSTSKDGLI 182

Query: 184 YVWEMPNH----TDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID 237
            VW++       T  +H+        H   +             TC  D+  ++WS+D
Sbjct: 183 KVWDLKTQQCVETHVAHVGECWSMGVHEDLV------------VTCGGDNQIKLWSVD 228

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 77/159 (48%), Gaps = 8/159 (5%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62
           L++AGY D  ++ W+ L+           S +  L+  +   +L++ +   ++ ++D+  
Sbjct: 89  LLAAGYNDGVVKIWDLLSKSVLINFNGHKSAITVLKFDSTGTRLISGSKDSDIIVWDL-- 146

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122
                +     H+ ++T +  + ++ W+V++S+DG IKVWD+++        H A V E 
Sbjct: 147 VGEVGLFKLRSHKDSITGLWCEGED-WLVSTSKDGLIKVWDLKTQQCVET--HVAHVGEC 203

Query: 123 -VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDT 160
             +  ++  +++C  D  I++W +   +    +  E  T
Sbjct: 204 WSMGVHEDLVVTCGGDNQIKLWSVDYEKPVGSMLTERGT 242

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 86/190 (45%), Gaps = 9/190 (4%)

Query: 99  IKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157
           + V+D V + S    Y+H   +    ++     L+S D DG   + +       H    +
Sbjct: 37  VSVFDLVNNKSFTFEYEHRKNIACFDLNRQGTLLLSIDDDGRAILVNYKSRNVLHHFNFK 96

Query: 158 DDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL-- 215
           D  S   +  + DG + A A+ +    +W+ P+ T      P  ++R H+ +   ++   
Sbjct: 97  DKCS--QIKFSPDGKLFAVASGRF-LQIWKTPDATQDRQFAPFVRYRVHAGHFQDLISLT 153

Query: 216 -SSDVKHLATCSADHTARVWSIDDDFK--LETTLDGHQRWVWDCAFSADSAYLVTASSDH 272
            S D + L + S D TA++WSID + K    TT  GH+ +V    FSAD   + T S D 
Sbjct: 154 WSKDSRFLLSTSKDLTAKIWSIDSEEKDLASTTFAGHRDYVVGAFFSADQEKIYTVSKDG 213

Query: 273 YVRLWDLSTR 282
            +  W+ + R
Sbjct: 214 ALFTWEYTPR 223

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 103/260 (39%), Gaps = 34/260 (13%)

Query: 46  LLATAGHQNVRLYDIRTTNPNPVAS-FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104
           LL+T+     +++ I +   +  ++ F GHR  V    F  D   + T S+DG +  W+ 
Sbjct: 161 LLSTSKDLTAKIWSIDSEEKDLASTTFAGHRDYVVGAFFSADQEKIYTVSKDGALFTWEY 220

Query: 105 ------------------------RSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNI 140
                                   R  S    Y + A V  V  H N   L+    +G  
Sbjct: 221 TPRPEDVEAAEENDEEVDISKYNWRITSKNYFYANQAKVKCVTFHCNSNMLVVGFTNGEF 280

Query: 141 RIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK-GNCYVWEMPNHTDASHLKP 199
           R+++L       QL+   +  + ++++ S G  LA  ++K G   V+E  + +       
Sbjct: 281 RLYELPHFTLIQQLSMGQN-PVNTVTVNSTGEWLAFGSSKLGQLLVYEWQSES------Y 333

Query: 200 VTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFS 259
           + K + H      +  S D   + T + D   +VW +   F L  TLD H   V    F+
Sbjct: 334 ILKQQGHFDSTNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCL-ATLDEHTAAVTQVQFA 392

Query: 260 ADSAYLVTASSDHYVRLWDL 279
                L +AS D  V+ WDL
Sbjct: 393 KKGQVLFSASLDGTVKAWDL 412

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 100/237 (42%), Gaps = 8/237 (3%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           S +LV    +   R +E       + +    + VN + + +  + LA    +  +L    
Sbjct: 268 SNMLVVGFTNGEFRLYELPHFTLIQQLSMGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYE 327

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSP-SIPRNYKHNAPVN 120
             + + +   +GH  +  S+++  D   +VT++EDG IKVWDV S   +    +H A V 
Sbjct: 328 WQSESYILKQQGHFDSTNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATLDEHTAAVT 387

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
           +V        L S   DG ++ WDL   +     T  +     SL++   G ++ A +  
Sbjct: 388 QVQFAKKGQVLFSASLDGTVKAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSMD 447

Query: 181 G-NCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236
             + +VW +         + +     H   ++ +  S +   LA+ S D T R+W I
Sbjct: 448 NFDIHVWSVQTG------QLLDSLSGHEGPVSCLAFSQENGVLASASWDKTIRIWYI 498

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 92/210 (43%), Gaps = 14/210 (6%)

Query: 78  VTSVSFQQDNRWM-VTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCD 135
           V +V+      W+   SS+ G + V++ +S S I +   H    N +   P+   +++  
Sbjct: 301 VNTVTVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLTYSPDGSRVVTAA 360

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            DG I++WD+    C   L  E   ++  +  A  G +L +A+  G    W++  + +  
Sbjct: 361 EDGKIKVWDVVSGFCLATLD-EHTAAVTQVQFAKKGQVLFSASLDGTVKAWDLIRYRNFR 419

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSA---DHTARVWSIDDDFKLETTLDGHQRW 252
                 + + +S       L+ D      C+    +    VWS+    +L  +L GH+  
Sbjct: 420 VFTAAERIQFNS-------LAVDPSGEVVCAGSMDNFDIHVWSVQTG-QLLDSLSGHEGP 471

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           V   AFS ++  L +AS D  +R+W +  R
Sbjct: 472 VSCLAFSQENGVLASASWDKTIRIWYIFGR 501

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 92/199 (46%), Gaps = 11/199 (5%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYD-IRT 62
           +V+A  D  I+ W+ ++G C  T+    + V +++     ++L +A     V+ +D IR 
Sbjct: 356 VVTAAEDGKIKVWDVVSGFCLATLDEHTAAVTQVQFAKKGQVLFSASLDGTVKAWDLIRY 415

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGT-IKVWDVRSPSIPRNYK-HNAPVN 120
            N     + E  R    S++       +   S D   I VW V++  +  +   H  PV+
Sbjct: 416 RNFRVFTAAE--RIQFNSLAVDPSGEVVCAGSMDNFDIHVWSVQTGQLLDSLSGHEGPVS 473

Query: 121 EVVIHPNQGELISCDRDGNIRIWDL-GENQCTHQLTP-EDDTSLQSLSMASDGSMLAAAN 178
            +      G L S   D  IRIW + G +Q   Q+ P E  + + SL++  DG  +A + 
Sbjct: 474 CLAFSQENGVLASASWDKTIRIWYIFGRSQ---QVDPIEVYSDVLSLTIRPDGKQVAVST 530

Query: 179 TKGNCYVWEMPNHTDASHL 197
            KG   ++++ N T A ++
Sbjct: 531 LKGQISMFDVENGTQAGNI 549

>TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {ON}
           Anc_6.325 YCR057C
          Length = 912

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 94/215 (43%), Gaps = 13/215 (6%)

Query: 74  HRGNVTSVSFQQDNRWMVTSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELI 132
            RGN+    F  D   ++ S     + V+D + + S    Y+H   +  + I+     L+
Sbjct: 16  RRGNIL---FSSDGTQLI-SPVGNRVSVFDLINNKSFTFEYEHRKNIASLDINKQGTLLL 71

Query: 133 SCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT 192
           S D DG   + +    Q  H    +D    QS+  + DG   A  + +    +W+ P+  
Sbjct: 72  SIDEDGRAILVNFKSRQVLHHFNFKD--KCQSIKFSPDGKHFALGSGRF-IQIWKTPDVN 128

Query: 193 DASHLKPVTKFR---AHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFK--LETTLD 247
           +     P  + R    H   +T +  S D + + + S D TAR+WS+D + K     T  
Sbjct: 129 ENRQFAPFIRQRVQAGHFQDVTSLTWSYDSRFIISSSKDLTARIWSLDSEDKDLASMTFA 188

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           GH+ +V    FSAD   + T S D  +  W+ S++
Sbjct: 189 GHRDYVMGAFFSADQEKIYTVSKDGALFTWEYSSK 223

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 94/210 (44%), Gaps = 14/210 (6%)

Query: 78  VTSVSFQQDNRWM-VTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCD 135
           V +VS  +   W+   SS  G + V++ +S S I +   H   +N++   P+   +++  
Sbjct: 296 VNTVSVNETGEWLAFGSSSLGQLLVYEWQSESYILKQQGHFDALNDLTYSPDGSRVVTSS 355

Query: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195
            DG I+IWD+    C      E  +S+ ++  A  G +L +A+  G    W++  + +  
Sbjct: 356 EDGKIKIWDVVSGFCLATF-EEHTSSVTAVQFAKRGQVLFSASLDGTVRAWDLIRYRNFR 414

Query: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSA---DHTARVWSIDDDFKLETTLDGHQRW 252
                 + + +        L+ D      C+    +    VWS+    +L  TL GH+  
Sbjct: 415 TFTSTDRIQFNC-------LAVDPSGEVVCAGSLDNFEIHVWSVQTG-QLLDTLAGHEGP 466

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           V   AFS ++  L +AS D  +R+W +  R
Sbjct: 467 VSCLAFSQENGVLASASWDKTIRIWSIFAR 496

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 96/237 (40%), Gaps = 8/237 (3%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIR 61
           S +L+    +   R +E  +    + +    + VN + +    + LA       +L    
Sbjct: 263 SNMLIVGFSNGEFRLYELPSFALLQQLSMGQNPVNTVSVNETGEWLAFGSSSLGQLLVYE 322

Query: 62  TTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVN 120
             + + +   +GH   +  +++  D   +VTSSEDG IK+WDV S      + +H + V 
Sbjct: 323 WQSESYILKQQGHFDALNDLTYSPDGSRVVTSSEDGKIKIWDVVSGFCLATFEEHTSSVT 382

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180
            V        L S   DG +R WDL   +     T  D      L++   G ++ A +  
Sbjct: 383 AVQFAKRGQVLFSASLDGTVRAWDLIRYRNFRTFTSTDRIQFNCLAVDPSGEVVCAGSLD 442

Query: 181 G-NCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236
               +VW +         + +     H   ++ +  S +   LA+ S D T R+WSI
Sbjct: 443 NFEIHVWSVQTG------QLLDTLAGHEGPVSCLAFSQENGVLASASWDKTIRIWSI 493

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 93/230 (40%), Gaps = 28/230 (12%)

Query: 70  SFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS---------PSIPRN-------- 112
           +F GHR  V    F  D   + T S+DG +  W+  S         P + +         
Sbjct: 186 TFAGHRDYVMGAFFSADQEKIYTVSKDGALFTWEYSSKEEEDDDDEPDLSKYSWRISEKN 245

Query: 113 --YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             ++++A V  V  H     LI    +G  R+++L       QL+   +  + ++S+   
Sbjct: 246 FFFQNHATVKCVTFHAKSNMLIVGFSNGEFRLYELPSFALLQQLSMGQNP-VNTVSVNET 304

Query: 171 GSMLA-AANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADH 229
           G  LA  +++ G   V+E  + +       + K + H   +  +  S D   + T S D 
Sbjct: 305 GEWLAFGSSSLGQLLVYEWQSES------YILKQQGHFDALNDLTYSPDGSRVVTSSEDG 358

Query: 230 TARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
             ++W +   F L  T + H   V    F+     L +AS D  VR WDL
Sbjct: 359 KIKIWDVVSGFCL-ATFEEHTSSVTAVQFAKRGQVLFSASLDGTVRAWDL 407

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 69/149 (46%), Gaps = 4/149 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEITNDKKLLATAGHQNVRLYDIRT 62
           +L SA  D T+R W+ +     RT   +D  Q N L +    +++      N  ++    
Sbjct: 392 VLFSASLDGTVRAWDLIRYRNFRTFTSTDRIQFNCLAVDPSGEVVCAGSLDNFEIHVWSV 451

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV--RSPSIPRNYKHNAPVN 120
                + +  GH G V+ ++F Q+N  + ++S D TI++W +  RS  +    +  + + 
Sbjct: 452 QTGQLLDTLAGHEGPVSCLAFSQENGVLASASWDKTIRIWSIFARSQQV-EPLEVYSDIV 510

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQ 149
            + I P+   + +    G I I+D+ E +
Sbjct: 511 ALTIRPDGKHVAASTIRGQISIFDIEEGK 539

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 84/188 (44%), Gaps = 7/188 (3%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN-VRLYD-IRT 62
           +V++  D  I+ W+ ++G C  T +   S V  ++     ++L +A     VR +D IR 
Sbjct: 351 VVTSSEDGKIKIWDVVSGFCLATFEEHTSSVTAVQFAKRGQVLFSASLDGTVRAWDLIRY 410

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
            N     S +  + N  +V           S ++  I VW V++  +      H  PV+ 
Sbjct: 411 RNFRTFTSTDRIQFNCLAVD-PSGEVVCAGSLDNFEIHVWSVQTGQLLDTLAGHEGPVSC 469

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTP-EDDTSLQSLSMASDGSMLAAANTK 180
           +      G L S   D  IRIW +     + Q+ P E  + + +L++  DG  +AA+  +
Sbjct: 470 LAFSQENGVLASASWDKTIRIWSIFAR--SQQVEPLEVYSDIVALTIRPDGKHVAASTIR 527

Query: 181 GNCYVWEM 188
           G   ++++
Sbjct: 528 GQISIFDI 535

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 107/275 (38%), Gaps = 30/275 (10%)

Query: 30  HSDSQVNRLEITNDKKLLATAGHQNVRL---YDIRTTNPNPVASFEGHRGNVTSVSFQ-- 84
           H+D  +N ++ T D   +ATA   N  +   Y+ RTT     A F+GH  +VTSV     
Sbjct: 404 HTD-LLNAVDATEDGLWIATASKDNSAILWRYNPRTTLFCKYAHFQGHVSSVTSVGLPNV 462

Query: 85  QDNRW---MVTSSEDGTIKVWDVRSPSIPRNYK-------------HNAPVNEVVIHPNQ 128
            +  W   ++T+S D T+K W V  P+   + +             H   +N + I PN 
Sbjct: 463 MNKGWPEYLITASNDLTVKKWKVPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPND 522

Query: 129 GELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEM 188
               +   D   +IWDL   +    L       L  +S       +A A+      +W +
Sbjct: 523 SIFATASYDKTCKIWDLETGELKATLNNHK-RGLWDVSFCQYDKFIATASGDKTVKIWSL 581

Query: 189 PNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248
              T       V     HS  + R    +  K L +  AD   ++W      +   TLDG
Sbjct: 582 DTFT------VVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTG-ECINTLDG 634

Query: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
           H   +W      D   ++TA +D   + W   T E
Sbjct: 635 HDNRIWALNVIKDGDIVITADADGVFQFWKDRTEE 669

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 124/277 (44%), Gaps = 38/277 (13%)

Query: 43  DKKLLAT--AGHQNVRLYDIRTTNPNPVAS--FEGHRGNVTSVSFQQDNRWMVTSSEDGT 98
           DK  LAT  +  + + + D+  +N   +++  +EGH   + +V   +D  W+ T+S+D +
Sbjct: 369 DKLALATNSSTLRIIPISDVDDSNSVSISTELYEGHTDLLNAVDATEDGLWIATASKDNS 428

Query: 99  IKVW--DVRSPSIPRNYKHNAPVNEV--VIHP---NQG---ELISCDRD----------- 137
             +W  + R+    +       V+ V  V  P   N+G    LI+   D           
Sbjct: 429 AILWRYNPRTTLFCKYAHFQGHVSSVTSVGLPNVMNKGWPEYLITASNDLTVKKWKVPKP 488

Query: 138 ---GNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDA 194
               +I I+ +  ++ T +   +D   +  LS++ + S+ A A+    C +W++    + 
Sbjct: 489 TDRFDIEIYSISSSEYTRRAHEKD---INMLSISPNDSIFATASYDKTCKIWDL----ET 541

Query: 195 SHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVW 254
             LK       H   +  +      K +AT S D T ++WS+ D F +  TL+GH   V 
Sbjct: 542 GELKAT--LNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSL-DTFTVVKTLEGHSNAVQ 598

Query: 255 DCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            C+F      LV+  +D  V+LWD ST E +    GH
Sbjct: 599 RCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGH 635

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 117/253 (46%), Gaps = 28/253 (11%)

Query: 5   LVSAGYDHTIRFWEA----------LTGVCSR--TIQHSDSQVNRLEITNDKKLLATAGH 52
           L++A  D T++ W+           +  + S   T +  +  +N L I+ +  + ATA +
Sbjct: 471 LITASNDLTVKKWKVPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDSIFATASY 530

Query: 53  -QNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPR 111
            +  +++D+ T      A+   H+  +  VSF Q ++++ T+S D T+K+W + + ++ +
Sbjct: 531 DKTCKIWDLETGELK--ATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVK 588

Query: 112 NYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASD 170
             + H+  V        Q +L+S   DG +++WD    +C + L   D+  + +L++  D
Sbjct: 589 TLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDN-RIWALNVIKD 647

Query: 171 GSMLAAANTKGNCYVW----EMPNHTDASHLK-PVTKFRAHSTYITRILLSSD--VKHLA 223
           G ++  A+  G    W    E     D    K  V + +    YI+    S D     L 
Sbjct: 648 GDIVITADADGVFQFWKDRTEEAREEDIEKEKLKVEQMQTLENYIS----SGDWTNAFLL 703

Query: 224 TCSADHTARVWSI 236
             + DH AR++++
Sbjct: 704 AITLDHPARLYNV 716

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATA-GHQNVRLYDIRT 62
           I  +A YD T + W+  TG    T+ +    +  +      K +ATA G + V+++ + T
Sbjct: 524 IFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDT 583

Query: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNE 121
                V + EGH   V   SF    + +V++  DG +K+WD  +         H+  +  
Sbjct: 584 FTV--VKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWA 641

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           + +  +   +I+ D DG  + W
Sbjct: 642 LNVIKDGDIVITADADGVFQFW 663

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 93/231 (40%), Gaps = 34/231 (14%)

Query: 96  DGTIKVWDVR-SPSIPRNY---------KHNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
           D T+++ D++ + S P+ Y          H    +  V+ PN  +L        +RI  +
Sbjct: 326 DQTLQLVDLKDTFSNPKEYIEVVSSLAGNHGTIADMKVVGPNFDKLALATNSSTLRIIPI 385

Query: 146 GENQCTHQLTPEDDTS------LQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKP 199
            +   ++ ++   +        L ++    DG  +A A+   +  +W     T  +    
Sbjct: 386 SDVDDSNSVSISTELYEGHTDLLNAVDATEDGLWIATASKDNSAILWRYNPRT--TLFCK 443

Query: 200 VTKFRAHSTYITRILLSSDV-----KHLATCSADHTARVWSI---DDDFKLET------- 244
              F+ H + +T + L + +     ++L T S D T + W +    D F +E        
Sbjct: 444 YAHFQGHVSSVTSVGLPNVMNKGWPEYLITASNDLTVKKWKVPKPTDRFDIEIYSISSSE 503

Query: 245 -TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            T   H++ +   + S + +   TAS D   ++WDL T E+      H +G
Sbjct: 504 YTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRG 554

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 44/231 (19%), Positives = 94/231 (40%), Gaps = 29/231 (12%)

Query: 78  VTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRD 137
           +T+++   D +++   S+   +K++ + +  I ++ K ++P   +   P    L     D
Sbjct: 76  ITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISSPSYVLETDPTSTLLAIGGTD 135

Query: 138 GNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGS----MLAAANTKGNCYVWEMPNHTD 193
           G++ + D+     TH L     T + SL    +      +L++ +T G   +W++ +   
Sbjct: 136 GSVTVIDIENGYITHSLKGHGAT-ISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSR-- 192

Query: 194 ASHLKPVTKFRAHSTYITRILL-------SSDVKHLATCSADHTARVWSIDD-----DFK 241
               K +   + H++ +  I         S D   L T + D     W   D       K
Sbjct: 193 ----K