Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR287C (DSS1)8.853ON96996951370.0
Smik_13.5038.853ON96996943790.0
Skud_13.4608.853ON96996942370.0
Suva_13.4778.853ON96996940940.0
TDEL0B002208.853ON93590823150.0
SAKL0D01078g8.853ON93692923000.0
ZYRO0C14938g8.853ON96691322660.0
CAGL0M07051g8.853ON92391222110.0
KNAG0E011408.853ON92990221570.0
KAFR0L019708.853ON93290921300.0
NCAS0C003008.853ON94090821090.0
KLTH0C03674g8.853ON94895120570.0
Kwal_27.102138.853ON93693820510.0
NDAI0K003208.853ON96292619160.0
TBLA0B029208.853ON102998918100.0
Kpol_237.48.853ON91692017900.0
TPHA0I003508.853ON94392217710.0
KLLA0C06314g8.853ON98394516710.0
AFR448W8.853ON81783215310.0
ZYRO0G01166g1.367ON9934721603e-10
TDEL0D023801.367ON9974361594e-10
CAGL0H04411g1.367ON10074361551e-09
NDAI0H035601.367ON10124371523e-09
TPHA0A023201.367ON10154371497e-09
KNAG0C019501.367ON9964361461e-08
SAKL0D10186g1.367ON9884361452e-08
Ecym_27151.367ON9884391424e-08
Skud_15.1371.367ON10304781408e-08
TBLA0D050701.367ON9974361398e-08
KAFR0C045301.367ON10004361381e-07
KLTH0H13420g1.367ON9864361343e-07
NCAS0D005901.367ON9984361334e-07
Smik_15.1451.367ON10014361301e-06
Suva_15.1471.367ON10014721292e-06
Kpol_1043.421.367ON9884361282e-06
YOL021C (DIS3)1.367ON10014361273e-06
Skud_4.5555.307ON12523661157e-05
Suva_2.4595.307ON12581391010.003
TBLA0C032805.307ON1313354970.010
YDR293C (SSD1)5.307ON1250138950.015
TDEL0E032005.307ON1257140920.037
NDAI0C040505.307ON1260161820.54
Smik_4.5425.307ON1251138810.60
Kpol_1023.505.307ON1253306781.4
NCAS0A137307.282ON14257731.8
Kwal_23.57055.307ON1228111772.1
SAKL0G10142g5.307ON1249355772.1
KLTH0G06248g5.307ON122594762.7
Kpol_1004.685.307ON1250109762.7
TBLA0A067206.307ON50069744.4
KNAG0F007702.6ON826118744.7
KLLA0F23221gsingletonON53856735.4
Ecym_34773.349ON25571708.7
NCAS0F025705.307ON1245127719.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR287C
         (969 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...  1983   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...  1691   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...  1636   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...  1581   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   896   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   890   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   877   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   856   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   835   0.0  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   825   0.0  
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   816   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...   796   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...   794   0.0  
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   742   0.0  
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   701   0.0  
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   694   0.0  
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   686   0.0  
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   648   0.0  
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   594   0.0  
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    66   3e-10
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    66   4e-10
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    64   1e-09
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    63   3e-09
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    62   7e-09
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    61   1e-08
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    60   2e-08
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    59   4e-08
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    59   8e-08
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    58   8e-08
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    58   1e-07
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    56   3e-07
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    56   4e-07
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    55   1e-06
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    54   2e-06
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    54   2e-06
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    54   3e-06
Skud_4.555 Chr4 complement(988201..991959) [3759 bp, 1252 aa] {O...    49   7e-05
Suva_2.459 Chr2 complement(810378..814154) [3777 bp, 1258 aa] {O...    44   0.003
TBLA0C03280 Chr3 complement(794118..798059) [3942 bp, 1313 aa] {...    42   0.010
YDR293C Chr4 complement(1045640..1049392) [3753 bp, 1250 aa] {ON...    41   0.015
TDEL0E03200 Chr5 (603078..606851) [3774 bp, 1257 aa] {ON} Anc_5....    40   0.037
NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {...    36   0.54 
Smik_4.542 Chr4 complement(977225..980980) [3756 bp, 1251 aa] {O...    36   0.60 
Kpol_1023.50 s1023 (111088..114849) [3762 bp, 1253 aa] {ON} (111...    35   1.4  
NCAS0A13730 Chr1 (2698652..2699080) [429 bp, 142 aa] {ON} Anc_7....    33   1.8  
Kwal_23.5705 s23 complement(1284606..1288292) [3687 bp, 1228 aa]...    34   2.1  
SAKL0G10142g Chr7 (862958..866707) [3750 bp, 1249 aa] {ON} simil...    34   2.1  
KLTH0G06248g Chr7 (494464..498141) [3678 bp, 1225 aa] {ON} simil...    34   2.7  
Kpol_1004.68 s1004 complement(143077..144804,144807..146831) [37...    34   2.7  
TBLA0A06720 Chr1 complement(1638092..1639594) [1503 bp, 500 aa] ...    33   4.4  
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    33   4.7  
KLLA0F23221g Chr6 (2163234..2164850) [1617 bp, 538 aa] {ON} some...    33   5.4  
Ecym_3477 Chr3 (893706..894473) [768 bp, 255 aa] {ON} similar to...    32   8.7  
NCAS0F02570 Chr6 (516508..520245) [3738 bp, 1245 aa] {ON} Anc_5....    32   9.0  

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score = 1983 bits (5137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 959/969 (98%), Positives = 959/969 (98%)

Query: 1   MVVRRKVHVLLIARSFHSYTPCFRVTTRGXXXXXXXXXXAKVELDHTRELDNDQATETVV 60
           MVVRRKVHVLLIARSFHSYTPCFRVTTRG          AKVELDHTRELDNDQATETVV
Sbjct: 1   MVVRRKVHVLLIARSFHSYTPCFRVTTRGKRQRSKSKQQAKVELDHTRELDNDQATETVV 60

Query: 61  DRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120
           DRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW
Sbjct: 61  DRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120

Query: 121 RSLTKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180
           RSLTKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC
Sbjct: 121 RSLTKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240
           VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK
Sbjct: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240

Query: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360
           LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360

Query: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420
           EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY
Sbjct: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNP 480
           PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNP
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNP 480

Query: 481 LLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHE 540
           LLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHE
Sbjct: 481 LLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHE 540

Query: 541 IDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT 600
           IDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT
Sbjct: 541 IDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT 600

Query: 601 VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFP 660
           VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFP
Sbjct: 601 VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFP 660

Query: 661 KATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN 720
           KATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN
Sbjct: 661 KATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN 720

Query: 721 ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA 780
           ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA
Sbjct: 721 ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA 780

Query: 781 QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP
Sbjct: 781 QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL 900
           DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL
Sbjct: 841 DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL 900

Query: 901 EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL 960
           EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL
Sbjct: 901 EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL 960

Query: 961 EGMLELEKL 969
           EGMLELEKL
Sbjct: 961 EGMLELEKL 969

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 1691 bits (4379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 809/969 (83%), Positives = 877/969 (90%)

Query: 1   MVVRRKVHVLLIARSFHSYTPCFRVTTRGXXXXXXXXXXAKVELDHTRELDNDQATETVV 60
           MV R   H+LLIARSFHS  PCFRVTTRG          AK + D+T+ LDN+Q  E+  
Sbjct: 1   MVARGNAHILLIARSFHSCGPCFRVTTRGKRQQSKKRQQAKAQFDYTQLLDNEQVIESGA 60

Query: 61  DRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120
           + SVG EKDIESINKDFLQRTKGLEPDIELKQL QIK+EF QRYKDRY+KPSE WY N+W
Sbjct: 61  NGSVGTEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNTW 120

Query: 121 RSLTKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180
           RSLTKPKI  +KLINSD QL TKLK  +PMEFQP QLME+PLNVGD VLLK++PNELAMC
Sbjct: 121 RSLTKPKISFHKLINSDVQLDTKLKDLDPMEFQPAQLMENPLNVGDLVLLKVKPNELAMC 180

Query: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240
           VSLPSSTMDPRYTFV IDGTMCFATKNRVLLRIPHKLP G++SLIQPE HHKHLPIGT+K
Sbjct: 181 VSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLK 240

Query: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           N SNQTNILPIV RQLITSRYPAQISKLAWK LPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360
           LVGLVQKLDLNKALD K GI+YLT LVNNYHT +++ INSPTFVSTYWAI+QQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQQQESNLWG 360

Query: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420
           EIHLNTALLSPISVTI+PLKSQHLYYAQVIEKLEANSY+EVN FVKLVNERKYRDIS LY
Sbjct: 361 EIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNP 480
           PSVIQLLKDFAAGNFHNNGIIV LISKIFRKI RYKD DITRD+CQDLINEI PNS+ NP
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVPNSLSNP 480

Query: 481 LLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHE 540
           LLLNMDLALP+SSKL++ QQKLY LTNIE+LQ + SG D DRYDFGDLRVFCIDS+TAHE
Sbjct: 481 LLLNMDLALPSSSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHE 540

Query: 541 IDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT 600
           IDDGVSV+N+G+DG+YTL+IHIADPTSMFPEST +D  GISTDILN+A KRSFTTYLPD 
Sbjct: 541 IDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDV 600

Query: 601 VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFP 660
           VVPMLPQ+ICHLSDLGK G+RTKTISFSVDVK+  +  GKS+EIMYDSF+IRKG VSNFP
Sbjct: 601 VVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIMYDSFRIRKGFVSNFP 660

Query: 661 KATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN 720
           KATY+DVD+IL  P++E+SPVK DLESLSMISKLLREQRIK +NAVIFGEGFNKG+V LN
Sbjct: 661 KATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLN 720

Query: 721 ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA 780
           A++EGELTEV+FS+QEET ST+LVSEMMILANTLTGRYFAEN IGGVFRCYKQLPL  +A
Sbjct: 721 ANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIA 780

Query: 781 QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           QQQYDSMIT TKKG+FPKL+DIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP
Sbjct: 781 QQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL 900
           DLINHLQIHRHLQKKPLCF QTQIDSLIW IQSRADILKRASR+SSTYWTLNYLKKL K 
Sbjct: 841 DLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKS 900

Query: 901 EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL 960
           +P RT+DVM+TSVPQNGF GCVFP LSFARGTLKL P + +YPMIGDIVK+CKISKIDCL
Sbjct: 901 DPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCL 960

Query: 961 EGMLELEKL 969
           EGMLELEKL
Sbjct: 961 EGMLELEKL 969

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 1636 bits (4237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 779/969 (80%), Positives = 864/969 (89%)

Query: 1   MVVRRKVHVLLIARSFHSYTPCFRVTTRGXXXXXXXXXXAKVELDHTRELDNDQATETVV 60
           M+ R   H LLIARSFHSY PCFRVT RG           K + D+T+ LDN + +E  V
Sbjct: 1   MIPRGNTHALLIARSFHSYKPCFRVTIRGKRQRSKTKQQGKAQEDYTQLLDNGKVSEVTV 60

Query: 61  DRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120
           + S+   KDIESINKDFL RTKGLEP+IELKQL QIK+EF QRY+DRY+KPSE WY NSW
Sbjct: 61  NSSIKSAKDIESINKDFLHRTKGLEPNIELKQLSQIKEEFQQRYRDRYIKPSETWYTNSW 120

Query: 121 RSLTKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180
           RSL KPKI  + LINS+ QL  +LK  NP+EFQPVQLME PLNVGD VLL++RPNELAMC
Sbjct: 121 RSLAKPKISSHNLINSNIQLDAQLKFSNPLEFQPVQLMERPLNVGDLVLLRVRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240
           VSLPSSTMDPRYTFV IDG+MCFATKNR+LLRIPH+LP G++SLIQPE  + HLPIGT+K
Sbjct: 181 VSLPSSTMDPRYTFVAIDGSMCFATKNRILLRIPHRLPVGVNSLIQPEERYGHLPIGTIK 240

Query: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           NFSNQTNILPI ARQ+ITSRYPAQISKLAW+DLP TTKKLQLLHRSLQ+Y GPWQIPFFT
Sbjct: 241 NFSNQTNILPIAARQIITSRYPAQISKLAWRDLPFTTKKLQLLHRSLQDYRGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360
           LVGLVQ+LDLN+ALDDK G  YL +L+  + T +++PI+S TFVSTYWAIMQQQESN WG
Sbjct: 301 LVGLVQRLDLNEALDDKYGATYLANLLGTHQTADNVPISSATFVSTYWAIMQQQESNFWG 360

Query: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420
           EIHLNTALLSPISVT+IPLKS+HLYY QV+ KLEA+ Y E+N+FVKLVNERKYRDIS LY
Sbjct: 361 EIHLNTALLSPISVTVIPLKSRHLYYEQVVGKLEADDYNEINRFVKLVNERKYRDISTLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNP 480
           PSVIQ+LKDFAAGNFHNNGIIV L+SKIFRKIERYKDCDITRDICQDLINEI PNS+ NP
Sbjct: 421 PSVIQMLKDFAAGNFHNNGIIVTLVSKIFRKIERYKDCDITRDICQDLINEILPNSMSNP 480

Query: 481 LLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHE 540
           LLLNMDLALPASSKLV+ QQKLYDLTNIE+LQ K S    +RYDFGDL+VFCIDSETAHE
Sbjct: 481 LLLNMDLALPASSKLVRSQQKLYDLTNIEDLQRKNSDNSSERYDFGDLKVFCIDSETAHE 540

Query: 541 IDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT 600
           IDDGVS++N+G DGLYTL+IHIADPTSMFPESTN D EGI TDILNVAL+RSFTTYLPD 
Sbjct: 541 IDDGVSIENHGTDGLYTLHIHIADPTSMFPESTNYDSEGIITDILNVALERSFTTYLPDV 600

Query: 601 VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFP 660
           VVPMLP+SIC+LSDLGKQGQ+TKTISFSVDVK+ SK  G+S+EIM+DSFKIRKGIVSNFP
Sbjct: 601 VVPMLPKSICNLSDLGKQGQKTKTISFSVDVKVMSKGDGESLEIMFDSFKIRKGIVSNFP 660

Query: 661 KATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN 720
           K TY+DVDRIL TPN EASPVKKDLESLSM+S LLR++RIKN+NAVIFGEGFNKGLV LN
Sbjct: 661 KVTYDDVDRILNTPNDEASPVKKDLESLSMVSNLLRDRRIKNNNAVIFGEGFNKGLVTLN 720

Query: 721 ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA 780
           A+ EGELTE++FSDQ ETLST+LVSEMMILANTLTG+YFA+NKI GVFRCYKQLPL  +A
Sbjct: 721 ANEEGELTEISFSDQVETLSTVLVSEMMILANTLTGKYFADNKICGVFRCYKQLPLDIIA 780

Query: 781 QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           Q+QYDSMITSTKKG+FP+LKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP
Sbjct: 781 QEQYDSMITSTKKGLFPQLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL 900
           DLINHLQIHRHLQKKPLCF+Q QID LIWPIQSRADILKRA RNSSTYWTLNYLKKL KL
Sbjct: 841 DLINHLQIHRHLQKKPLCFSQVQIDRLIWPIQSRADILKRAGRNSSTYWTLNYLKKLKKL 900

Query: 901 EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL 960
           +PE+T+DVM+T+VPQNGF  CVFPDLSFARGTLKLHPS+ HYPMIGDIVKNCKI +IDCL
Sbjct: 901 DPEKTYDVMITAVPQNGFVSCVFPDLSFARGTLKLHPSAKHYPMIGDIVKNCKILRIDCL 960

Query: 961 EGMLELEKL 969
           EGMLELE L
Sbjct: 961 EGMLELETL 969

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 1581 bits (4094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/969 (78%), Positives = 843/969 (86%)

Query: 1   MVVRRKVHVLLIARSFHSYTPCFRVTTRGXXXXXXXXXXAKVELDHTRELDNDQATETVV 60
           MVVR     L IARSFH+Y PCFRVT R            K   D+T     D+  +T +
Sbjct: 1   MVVRGNPQALRIARSFHAYRPCFRVTIRNERQRSKNNQKEKALFDYTALFKKDKVKDTAI 60

Query: 61  DRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120
            R V  EK+IESIN+DFL R KGLEPDIELKQL QIK+EF +RY+DRYV PSE WY NSW
Sbjct: 61  TRPVENEKEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNSW 120

Query: 121 RSLTKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180
           RSLTKPKIP YKLIN D    TKL++   MEFQP QLM++PLNVGD VLLK RPNELAMC
Sbjct: 121 RSLTKPKIPSYKLINLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMC 180

Query: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240
           VSLPSSTMDPRYTF +IDG+M FATKNRVLLRIP KLP GI SL+QPE HHKHLPIGTVK
Sbjct: 181 VSLPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVK 240

Query: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           NFSNQT+ILPIVARQ+ITS+ PAQISKLAWK LPITTKKLQLLHRSLQNYMGPWQIPFFT
Sbjct: 241 NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360
           LVGLVQKLDLNKALD+KNG+NYL  LVN+Y + + +P+NS TFVSTYWAI+QQQESNLWG
Sbjct: 301 LVGLVQKLDLNKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQESNLWG 360

Query: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420
           +IHLNTALLSP SVTIIPLKS+HLYYAQVIEKLEA++Y+++++FVKLVNERKYRDIS+LY
Sbjct: 361 KIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLY 420

Query: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNP 480
           PSVIQLLKDFAAGNFHNNGIIV LISKIFRKIE YK  DITRDICQDL+NEI PN + NP
Sbjct: 421 PSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINP 480

Query: 481 LLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHE 540
           LLLNMDLALPASSKL + QQKLY+LTNIE +Q K S  + DRYDFGDL+VFCIDSETAHE
Sbjct: 481 LLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHE 540

Query: 541 IDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT 600
           IDDGVS++N+ +DGLYTL+IHIADP S+FPEST+++ +GI+TD+LNVALKRSFTTYLPD 
Sbjct: 541 IDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDL 600

Query: 601 VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFP 660
           VVPMLP+SIC LSDLGKQGQ+T+T+SFSVDVK+  K +GK IEI+Y+S KIRKGIVSNFP
Sbjct: 601 VVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIRKGIVSNFP 660

Query: 661 KATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN 720
           KATY DVDRIL   +SEA P K+DLESLSMISKLLRE RIK +NAVIFGEGFN+GLV LN
Sbjct: 661 KATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLN 720

Query: 721 ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA 780
            + EGELTEV+FSDQ ET ST+LVSEMMILANTL GR+FAENKI GVFRCYKQLPL  +A
Sbjct: 721 TNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIA 780

Query: 781 QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           QQQY+S+ITS KKG+FPKL+DI KLSSLLNSSFYTG+PFRHEMIGA QYLTVTSPLRRFP
Sbjct: 781 QQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFP 840

Query: 841 DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL 900
           DLINHLQIHRHLQKKPLCF+Q QID LIWPIQSRADILK ASRNSSTYWTLNYLK + K 
Sbjct: 841 DLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKS 900

Query: 901 EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL 960
            PE+T+DVM+TSVPQNGF GCVFPDLSFARGTLKL+PS+ HYPMIGD VK CKI KIDCL
Sbjct: 901 NPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCL 960

Query: 961 EGMLELEKL 969
           EG+LELEKL
Sbjct: 961 EGILELEKL 969

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/908 (49%), Positives = 624/908 (68%), Gaps = 25/908 (2%)

Query: 64  VGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRSL 123
           + PE DIE IN  FL RTK LEP +E+KQLPQI +EF  R+  RY +PS+ W+  +W + 
Sbjct: 48  LSPE-DIERINLQFLSRTKDLEPGMEVKQLPQIGREFRDRFDARYYEPSKIWFEKNWLNR 106

Query: 124 TKPKIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMCVSL 183
           TK      K++N+   +  K       +++   LM  PL+VGD VLLK  P+EL+MC+ +
Sbjct: 107 TKFS---RKMLNA---VPRKEDTKEVFQYKASALMAKPLDVGDLVLLKSHPSELSMCIDV 160

Query: 184 PSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLP---AGIHSLIQPESHHKHLPIGTVK 240
           PSST DPRY F T+DG++ F +++ VL+RIPH LP   + + +L+  E+ H   PIGT+K
Sbjct: 161 PSSTKDPRYCFTTVDGSLKFGSRSLVLMRIPHSLPQELSKMAALLVREAKHGFEPIGTIK 220

Query: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           N +N+T +LP++ARQL+TS    +ISK AW  LP+T KKL+LLHR LQ+  GP  +PFF 
Sbjct: 221 NQANETLVLPVIARQLVTSCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVPVPFFD 280

Query: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360
           LV ++Q LD+ KA+ +++G  Y+  ++ N  T +   I+S   ++TYWAI  QQ+++L+G
Sbjct: 281 LVMMIQSLDITKAISNRDGEPYIRDVIENSRTGSTSTIDSSCALATYWAIEAQQKNHLFG 340

Query: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420
           +I ++ ALLSP+SV I+P  SQHL+Y+++ E+L++N    + +F KL N+ KY +++  +
Sbjct: 341 DIQISGALLSPVSVLILPFASQHLFYSELKEQLKSNGQEAIQEFSKLANKGKYTELTTRF 400

Query: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITP-NSIPN 479
           P +IQ+LK +AAGN HN+  IV+LI+ IFRKI+ +KD DITRD C+ L++   P  ++ N
Sbjct: 401 PHIIQVLKGYAAGNLHNDEGIVSLIAAIFRKIDEFKDNDITRDACEKLLSRTLPQGTVEN 460

Query: 480 PLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAH 539
           P+  N  L LP SS   + QQ++YDL+     Q     + ++R+DF  LRV+CIDSE AH
Sbjct: 461 PIYANFTLGLPDSSARSRTQQQVYDLSKPASAQ-----STENRHDFKHLRVYCIDSEEAH 515

Query: 540 EIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPD 599
           EIDDG+S+++ G +G YTL+IHIADP S+FPES + +  GI+ ++L VA +R FTTYLPD
Sbjct: 516 EIDDGISIEDCG-NGKYTLHIHIADPASLFPESESSEQSGINDEVLKVAAERCFTTYLPD 574

Query: 600 TVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNF 659
            V PMLPQ+   + DLG QG++TKTI+FSVDV +       +I+I +DS+KIR G+VSNF
Sbjct: 575 VVSPMLPQTFTTVCDLGHQGKKTKTITFSVDVLVKDG----AIKIFFDSYKIRLGLVSNF 630

Query: 660 PKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVML 719
           PK TYE VDR L  P +    +  DL+ +  I+++LRE RI+   A++FG GFN+GLV +
Sbjct: 631 PKVTYETVDRYLSEPKNVNEEILYDLKLMHKIAEILREARIQKDGAIVFGSGFNQGLVAV 690

Query: 720 NADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEV 779
           +   +    E++F DQ+E+ ST+LVSE MILAN+L GR+FAE +I G+FR Y+ L L   
Sbjct: 691 SPVDQ----EISFFDQKESKSTLLVSEFMILANSLAGRFFAEKEIPGIFRTYQPLTLRGQ 746

Query: 780 AQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRF 839
           A Q+Y+ M  S KKGI P  KDI  LSSLLNSSFY   P  H MIGA QYLTVTSPLRRF
Sbjct: 747 ADQEYERMKKSVKKGILPTTKDINMLSSLLNSSFYCEYPTAHAMIGASQYLTVTSPLRRF 806

Query: 840 PDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTK 899
           PD+INHLQIHR L+  PLCF +  +  ++W IQ R   LK+AS + ++YWTL Y+K L +
Sbjct: 807 PDIINHLQIHRVLRNLPLCFTEDALSKMLWHIQLRDAALKKASAHQASYWTLKYIKNLIR 866

Query: 900 LEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDC 959
             P + FDV +TSVPQ     CV  +   ARG LKL PS+ + P +GD VK CK+SKIDC
Sbjct: 867 DTPHQRFDVTITSVPQLNVARCVLANFPSARGVLKLKPSATNIPTVGDTVKGCKVSKIDC 926

Query: 960 LEGMLELE 967
           L+ +LELE
Sbjct: 927 LDSLLELE 934

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/929 (48%), Positives = 625/929 (67%), Gaps = 45/929 (4%)

Query: 67  EKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRSLTKP 126
           ++  +++ K F    K LEP++E+KQL Q++Q+ + RY  RY  PS+ W+  +  S T+ 
Sbjct: 21  DRSKDNLEKIFFSHAKDLEPEVEIKQLSQVRQDSDNRYYHRYFTPSKIWFTQNV-SRTQS 79

Query: 127 KIPLYKL---INSDFQLITKL------KAPNPMEFQPVQLMESPLNVGDFVLLKMRPNEL 177
               + L    +SD  ++  L      K  +     P  LM +PL +GD VLL+  P +L
Sbjct: 80  FKHFFNLDPQRSSDKYILPTLNERLYDKGSHTFYLSPSDLMNTPLKIGDLVLLRSNPTQL 139

Query: 178 AMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIG 237
           +MCV LP+  MDPRYTF ++DG + FA +  ++LRIP      +  L+Q E  H + PIG
Sbjct: 140 SMCVDLPTDIMDPRYTFASMDGGLQFAARTMIMLRIPSCHKQELDGLVQLERKHSYEPIG 199

Query: 238 TVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIP 297
            VKN    T +LPI+ARQLITS  P +I+K AW  +PI +KKL+LLHR LQ   GPWQI 
Sbjct: 200 VVKNSPTHTYVLPILARQLITSYVPFEITKKAWNQVPIVSKKLELLHRFLQRSTGPWQIS 259

Query: 298 FFTLVGLVQKLDLNKALDDKNGI--NYLTSLVN--------------NYHTVNDIPINSP 341
            FTL  LVQ LDL +AL  ++G   +Y++SL                N H      I++ 
Sbjct: 260 IFTLCELVQNLDLQRALSKQDGSLQDYMSSLFQKVGLDSNLYCLGEQNLHVNPPNKIDAS 319

Query: 342 TFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREV 401
            F+STYW++++QQE  +WG I  +  +L+PISVT++PL S+HLYY  V+  L+ ++YR +
Sbjct: 320 YFLSTYWSLVKQQELQIWGGIQTHRGILTPISVTVLPLNSEHLYYENVVSTLKQDNYRML 379

Query: 402 NKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDIT 461
           ++F +LVN++ Y+ I   +P +IQ+LK++AAGNF+NNG ++ L+SKIFRK+  YK+ D T
Sbjct: 380 DEFAELVNKKNYKPIQNRFPQLIQILKNYAAGNFNNNGAMITLVSKIFRKLHTYKERDTT 439

Query: 462 RDICQDLINEITPNSIPNPLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDD 521
           RD+C +L+ +I+P+ + NPLLLN DL LP +S+    +Q +YD++       K   T+DD
Sbjct: 440 RDMCHELLTQISPDKLINPLLLNKDLGLPMASQRSALEQVVYDIS-------KPPLTEDD 492

Query: 522 ---RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIE 578
              R+DFGD+ V+CIDSETAHEIDDG+S++       Y L+IHIADP S F +ST+ +  
Sbjct: 493 SYVRHDFGDMPVYCIDSETAHEIDDGISIETLSEKK-YRLHIHIADPASSFAKSTDPEAR 551

Query: 579 GISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCS 638
               D+L++A +RSFTTYLPD V+PMLP+S C  +DLGK G +TKT+SFS+D+       
Sbjct: 552 D---DVLDIAFQRSFTTYLPDMVLPMLPESYCRAADLGKDGNKTKTLSFSIDIYFHQG-- 606

Query: 639 GKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQ 698
             ++ ++ D+FK+R G+VS FP+ TYE VD +L  P  +      DL+ +  ++K LR +
Sbjct: 607 --TLRLLDDTFKMRLGLVSRFPRVTYEKVDILLQYPEKQPKEAS-DLKLMYEVAKSLRAK 663

Query: 699 RIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRY 758
           R+KN +A+IFGEGFNKGLV L+ D  GELT+++F DQ E+ ST+LVSEMMILANTLTG Y
Sbjct: 664 RVKNQDAIIFGEGFNKGLVKLSPDETGELTKISFEDQVESKSTVLVSEMMILANTLTGGY 723

Query: 759 FAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRP 818
           F +NKI GVFRCY +L L + A ++Y  M   TK G FP ++DI  +SSLLNSSFYTG+P
Sbjct: 724 FKKNKIPGVFRCYNELQLKDRALKEYTKMKEMTKSGQFPTIRDINTISSLLNSSFYTGKP 783

Query: 819 FRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADIL 878
            +HEMIGA +YLTVTSPLRRFPD+INHLQIHRHL+  PLCF+Q ++D + W IQSR  +L
Sbjct: 784 KKHEMIGASEYLTVTSPLRRFPDMINHLQIHRHLRGLPLCFSQQEVDGITWHIQSRDVVL 843

Query: 879 KRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPS 938
           K A+R S+TYWTL +LK   + + +  F VMVTSVP  G   C FP+L+ ARGTL L P 
Sbjct: 844 KNAARMSATYWTLKFLKNELEKKKDIRFTVMVTSVPHMGTVSCAFPNLNAARGTLNLDPK 903

Query: 939 SMHYPMIGDIVKNCKISKIDCLEGMLELE 967
              YP IGD++  CK++K+DCL+G++ELE
Sbjct: 904 HTPYPAIGDLIHKCKLTKLDCLDGVIELE 932

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/913 (49%), Positives = 616/913 (67%), Gaps = 29/913 (3%)

Query: 67  EKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRSLTKP 126
           ++DI+ IN  FL RTK LEP +E+K L +IKQEF  RY  RY+ P   W+  S +++   
Sbjct: 70  QEDIDRINYMFLSRTKDLEPGVEVKDLNRIKQEFYSRYGARYLNPCNSWFQRSEQNILGK 129

Query: 127 KIPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMCVSLPSS 186
                 LIN+D + +  +K    ++F P +LM  PL +GD VLLK +  +L MC+ +PSS
Sbjct: 130 SFS-RSLINADPEALG-IKNKRFLKFDPKELMSRPLQIGDLVLLKHQSPQLCMCIDVPSS 187

Query: 187 TMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVKNFSNQT 246
           T DPRYTF T+DGT+ F+T+N+VL+RIPH LP     L+  E  H   P+G VKN + +T
Sbjct: 188 TRDPRYTFTTVDGTIIFSTRNKVLMRIPHHLPNV--PLLMKEMKHGFEPVGCVKNTTTET 245

Query: 247 NILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQ 306
            ILPIV RQ ITS    QISK AW+++P T KKL+LLHR LQ+  GPWQ+PF  LV +V+
Sbjct: 246 FILPIVPRQQITSPISHQISKRAWEEMPFTLKKLELLHRHLQDARGPWQVPFMNLVSMVE 305

Query: 307 KLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWGEIHLNT 366
           KLD+  A     G  Y+  L+          ++S  F+S Y AI  QQ+S+LWG IH + 
Sbjct: 306 KLDMQLASASNTGAAYVEDLIRTCTFEPQAKLDSAIFLSVYCAIENQQQSHLWGNIHSSR 365

Query: 367 ALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQL 426
           ALLSP+SVT++PL+SQHLY+  V++ L+  +Y  V+KF +LV+  KY +    YP +++L
Sbjct: 366 ALLSPVSVTVMPLRSQHLYHRSVLQNLKVRNYEAVSKFARLVDTGKYNEAIMEYPEIVKL 425

Query: 427 LKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEI-TPNSIPNPLLLNM 485
           L+D+AAGNF+N+   ++++SKIFRKI+R+++ DITRDIC  L+ E+ +  +  NPL  N+
Sbjct: 426 LQDYAAGNFYNDATAISVVSKIFRKIQRFQEEDITRDICHQLLKELDSSQTTRNPLHYNL 485

Query: 486 DLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDD-RYDFGDLRVFCIDSETAHEIDDG 544
           DL LP+SS     +Q +Y+L +    +    G D + R+DFGD++V+CIDSETAHEIDDG
Sbjct: 486 DLGLPSSSLRSSSEQDIYNLAHPVTFE----GQDKNLRHDFGDMKVYCIDSETAHEIDDG 541

Query: 545 VSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPM 604
           VS++++  D   TL+IHIADP S F E       GI ++IL +AL +SFTTYLPD + PM
Sbjct: 542 VSIESHS-DVKRTLHIHIADPASFFRECQE-GTHGIESEILQIALNKSFTTYLPDLMSPM 599

Query: 605 LPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATY 664
           LP S    +DLGKQGQ+ KTI+FSVD    S       ++  +SF+I+ G+VSNFP+ TY
Sbjct: 600 LPGSYSKAADLGKQGQKAKTITFSVD---GSWIKNGQFQLQPESFRIKLGLVSNFPQVTY 656

Query: 665 EDVDRILGTPNSEASPVK----------KDLESLSMISKLLREQRIKNSNAVIFGEGFNK 714
             VD +L    ++AS VK          ++L+ L  IS+ LR  RI    AV+FG  FNK
Sbjct: 657 NTVDSML----AQASEVKNGSANLTDDQRNLKELYAISQNLRANRINTQQAVVFGSEFNK 712

Query: 715 GLVMLNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQL 774
           G V L+ D  G L +V+F DQ ET S++LVSEMMILANTL+G++F +N + GVFRCY+ L
Sbjct: 713 GQVALSPDENGVLQKVSFKDQLETPSSVLVSEMMILANTLSGQFFKDNNLPGVFRCYQPL 772

Query: 775 PLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTS 834
            LG  AQ +Y+ + +  K+G     KDI  +S++LNSSFY+   +RHEMIGA  YLTVTS
Sbjct: 773 ALGPQAQNEYELLKSKIKEGKSLTFKDICMISTILNSSFYSSDGYRHEMIGAPHYLTVTS 832

Query: 835 PLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYL 894
           PLRRFPD+INHLQIHR L+  PLCFN+  +D  +W IQSR  ILK ASR S+TYWTL YL
Sbjct: 833 PLRRFPDMINHLQIHRLLKGLPLCFNKDDVDRFVWHIQSRDSILKDASRCSNTYWTLKYL 892

Query: 895 KKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKI 954
           K+L + +  + F VM+ SVPQ GF  CV PD S AR TLKL P+ + +P+IGDI++NC+I
Sbjct: 893 KQLVENDKNKKFSVMINSVPQVGFVRCVLPDYSSARATLKLKPNEISHPVIGDIIENCRI 952

Query: 955 SKIDCLEGMLELE 967
           +KID LEG+LE+E
Sbjct: 953 TKIDALEGLLEME 965

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/912 (49%), Positives = 615/912 (67%), Gaps = 30/912 (3%)

Query: 70  IESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRS------- 122
           +E+  K++L RTKGLEPD E++QLPQI   FN+RY+ RY++PS+ W+   W++       
Sbjct: 21  LENSVKNYLARTKGLEPDFEIRQLPQIISGFNKRYRARYLEPSQRWFKADWKASDHGEDK 80

Query: 123 ---LTKPKIPLYKLINSDFQL--ITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNEL 177
              L +P++    +INSDF    + + +    + F P +L+ + LNVGD VLLK   +EL
Sbjct: 81  ATRLLRPEVFDKFIINSDFHRGNMEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSEL 140

Query: 178 AMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIG 237
            MCV+LP ST DPRYTF   DGT+ +A KN V+LRIP  LP  ++ L++ ES+H +  IG
Sbjct: 141 TMCVNLPQSTTDPRYTFAKKDGTLVYAMKNSVILRIPKDLPEEVNQLLKRESNHPYQKIG 200

Query: 238 TVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIP 297
           T+KN SN+T ILP++ RQLI S   A  +K AW  LPI  KKL+L+HR LQ+  G   + 
Sbjct: 201 TIKNSSNETEILPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVN 260

Query: 298 FFTLVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESN 357
           F +LV +++ L++ +A D  NG  Y+  +++   +V +  I+  T ++TYW + +QQ++N
Sbjct: 261 FMSLVRIIKNLNIKEATDAINGDAYVRKVIDESMSVVNKSIDPTTLLATYWGVREQQQNN 320

Query: 358 LWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDIS 417
           LWG ++ NTALLSP +V ++PLK  HL+Y +VI +LE+N Y+E+  F KLVN++ Y  I+
Sbjct: 321 LWGSVYTNTALLSPTTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIA 380

Query: 418 ALYPSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNS- 476
             Y  +  LL D+AAGN   N ++  +ISKIFR I+ Y+D D+TR +C  L+ EI+P S 
Sbjct: 381 KRYDYIRTLLNDYAAGNIEENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSN 440

Query: 477 IPNPLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSE 536
             N +L N DL +P SS +   +QKLYD T +  +      +D DRYDFGD+ VFCIDSE
Sbjct: 441 SSNFILGNWDLNIPKSSGISSVEQKLYD-TAMPTIV-----SDTDRYDFGDMPVFCIDSE 494

Query: 537 TAHEIDDGVSVKNYGRDGLYT-LYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTT 595
            AHEIDDG+S++    DG+ + ++IHIADP  +FPES +    GIS D+L V+LKR+FTT
Sbjct: 495 DAHEIDDGISIEEL--DGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTT 552

Query: 596 YLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGI 655
           YLPD VVPMLP+S C+ +DLGK  ++T+TISFS +  + +K  G  + + YD+F++R GI
Sbjct: 553 YLPDLVVPMLPKSFCNRADLGKHDRKTETISFSFE--LVNKEDG-GLHVDYDTFQVRLGI 609

Query: 656 VSNFPKATYEDVDRIL-GTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNK 714
           VSNFPK TY+ VD IL G  NS  S  KK LE L  ++  L  +RI + NAV+FG+GFNK
Sbjct: 610 VSNFPKVTYDKVDSILNGDDNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNK 669

Query: 715 GLVMLNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQL 774
           GLV L+ D +GEL   TF DQ +T ST+LVSE MIL N L   +F ENKI GV+RCY  L
Sbjct: 670 GLVSLSPDDDGELCIPTFYDQSQTKSTLLVSEFMILTNKLCAAFFQENKIPGVYRCYNGL 729

Query: 775 PLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTS 834
            LG  A+ Q++ +  + K G  P LKDI K+SS L+SSFY+  P  H+MIG   YLTVTS
Sbjct: 730 NLGNQAKAQFELLKENIKLGKLPSLKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVTS 789

Query: 835 PLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYL 894
           P+RR PDLINHLQ+HR L+K PLCF Q  +D  +W  Q+RADILK   R+SSTYWTL +L
Sbjct: 790 PMRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKHL 849

Query: 895 KKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKI 954
           ++       +T DV+VTSVPQNG   C+FP+ S+ARGTLKL P+    P IGD +++CK+
Sbjct: 850 EQ----SGTKTHDVIVTSVPQNGTVNCLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCKV 905

Query: 955 SKIDCLEGMLEL 966
             I  L+G+L L
Sbjct: 906 ESIHPLDGILTL 917

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/902 (48%), Positives = 591/902 (65%), Gaps = 30/902 (3%)

Query: 69  DIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRSLTKPKI 128
           DIE IN+ FL RTK LEP +E+K+L QIK+EFN R+ +RY  PS+ W+ ++W  + +P  
Sbjct: 51  DIERINEMFLSRTKDLEPGMEIKKLKQIKKEFNTRFAERYFNPSKQWFQDNW--VVEPST 108

Query: 129 PLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMCVSLPSSTM 188
                 +S   +  K K      F+  + + S L +GD VL    PNELAMCV LP S  
Sbjct: 109 NTAGKSSSQNSMTGKNKH---YTFKLSEFISSVLQMGDLVLTTPYPNELAMCVGLPESAE 165

Query: 189 DPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVKNFSNQTNI 248
           DPRYTFVT+ G M F TK+ V LRIP++LP  +  LI  E  H   P+GT+K   + T I
Sbjct: 166 DPRYTFVTVSGKMFFGTKSFVHLRIPYRLPEKVRYLISKEGPHAFEPVGTIKGTRDVTYI 225

Query: 249 LPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKL 308
           LP +ARQL+TS  P+QI+KLAW+ LP   K+L+LL R L+ Y G WQ+PF  LV  VQ+L
Sbjct: 226 LPYLARQLVTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVPFVQLVDAVQRL 285

Query: 309 DLNKALDDKNG---INYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWGEIHLN 365
           +      +K G     Y+ SL       +   I++ T+++TYWAI +QQ  N+WG+IH+N
Sbjct: 286 E------EKGGPGEFEYIKSLFERPSLGSRRSIHAATYLATYWAIKEQQNFNIWGKIHVN 339

Query: 366 TALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQ 425
            A L+PIS +++P  S   ++ ++I   +    + VNK   L+N + Y  +   YP  +Q
Sbjct: 340 KAFLAPISTSVVPAASLRSFHDELINDPKR---KHVNKITDLINTKDYELVRERYPEFLQ 396

Query: 426 LLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITP-NSIPNPLLLN 484
           LL DF AGNF NN  +V LIS+IFR ++ Y++C++TRD C DL+ EI+  N   NP+L N
Sbjct: 397 LLSDFTAGNFDNNCEVVTLISQIFRMLDVYRECNVTRDTCFDLLKEISEDNFCENPILSN 456

Query: 485 MDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDG 544
            DLAL  SS+    Q+ +Y +    ++Q     T   R+DF D+ V+CIDSETAHEIDDG
Sbjct: 457 SDLALAQSSERSALQKCVYSVVQ-PDIQLD---TKTKRHDFLDMPVYCIDSETAHEIDDG 512

Query: 545 VSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPM 604
           VS++  G+ G YTL++HIADP S FPES     +   +D+L +A  +SFTTYLPD V  M
Sbjct: 513 VSIEKNGK-GSYTLHVHIADPASFFPESYTESTK--LSDVLKIAFDKSFTTYLPDVVEAM 569

Query: 605 LPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATY 664
           LP+S C  +DLGKQ ++T+TI+FSV VK+        + I  D+F+ R G+VSNFPK TY
Sbjct: 570 LPESFCRAADLGKQDKKTRTITFSVRVKMDEH---GGLHIQSDTFRARLGLVSNFPKVTY 626

Query: 665 EDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSE 724
             VD +L   +S  SP+++DL +L  I+  LR  R+K + AV+FGEGFN G V L  DS 
Sbjct: 627 NIVDSVLNDSSSN-SPLRQDLLTLYKIASGLRHNRVKLNGAVVFGEGFNNGQVRLIRDSA 685

Query: 725 GELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQY 784
            ++ ++TF +  ET ST+LVSE+MILANTL+G +F ENKI G+FRCY +L L   A   Y
Sbjct: 686 NKVKDITFENNNETPSTVLVSELMILANTLSGNFFRENKIPGIFRCYNELKLDGKALSDY 745

Query: 785 DSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLIN 844
            S+  + ++G  P LKDI K++SL+NSSFY+G P  H+MIGAKQYLTVTSPLRR+PDLIN
Sbjct: 746 RSIQDNVQRGKNPTLKDIAKITSLMNSSFYSGEPRNHQMIGAKQYLTVTSPLRRYPDLIN 805

Query: 845 HLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPER 904
           H+Q+H+HL  KPL F+Q  ID +IW +QSRADILK  S   S YWTL YLKK  + +   
Sbjct: 806 HIQLHKHLANKPLTFSQQAIDQMIWQVQSRADILKSISTTVSAYWTLTYLKKRIEKDSSA 865

Query: 905 TFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGML 964
            FDVMVTS PQ+G   C+FP+ S+ARG LKL    +  P IGDIVK+C+I+ IDCL+  L
Sbjct: 866 RFDVMVTSFPQDGMVNCLFPNHSYARGKLKLKVDRLP-PQIGDIVKDCQITSIDCLDSNL 924

Query: 965 EL 966
           +L
Sbjct: 925 QL 926

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/909 (46%), Positives = 602/909 (66%), Gaps = 29/909 (3%)

Query: 67  EKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRSLTKP 126
           +++I+ INK FL RT GLEPD+E+K+L  I++++N+RY  R + PS+ WY + W+  +  
Sbjct: 44  KEEIKLINKLFLSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHDWKDRSTK 103

Query: 127 KIPLYKLINSDFQLITKLKAPN------PMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180
            + + +   +   LI   K PN       + F   +L+ESPL VGD VLLK    EL+MC
Sbjct: 104 ILGMERFSKN---LINGAK-PNFNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMC 159

Query: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVK 240
           V+LP S  DPRYTF TI G + F+T++ + LRIP+ +P GI +LI  E  H   PIG +K
Sbjct: 160 VALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIK 219

Query: 241 NFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT 300
           +  N+T ILP V RQ ITS  P  +S +AW++LP+T KKL++LHR LQN +G +QIPFF 
Sbjct: 220 SSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQ 279

Query: 301 LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQQESNLWG 360
           LV LV  +D++   D K    Y+ +L++N    +   +++   +STYWAI++QQE+N+WG
Sbjct: 280 LVHLVDTIDMSSCNDRK----YMKTLIDNSKNDSYNNLDASRCLSTYWAIIEQQETNMWG 335

Query: 361 EIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALY 420
           +I  N+  +SPISVT+ PLK+   +   ++   +     ++ +  +L+NE+ Y  I   Y
Sbjct: 336 DIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKY 395

Query: 421 PSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSI-PN 479
           P  + +LKD+A+GN + N  +  LIS   RK+  YKD D+++ +C  L+ EI P     N
Sbjct: 396 PEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDN 455

Query: 480 PLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAH 539
            LL N DL L  SS L +  ++LY L         +   D DR DFG+LRV+CIDSETAH
Sbjct: 456 ILLFNHDLNLSNSSNLGQSNKQLYALCG------PQISADADRVDFGNLRVYCIDSETAH 509

Query: 540 EIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEG-ISTDILNVALKRSFTTYLP 598
           EIDDG+S+ N G +G+Y+L IHIADP+ +F  ++  +I+G ++ D+  +A+++SFTTYLP
Sbjct: 510 EIDDGISIINKG-NGIYSLSIHIADPSILFSGAS--EIQGPLNDDVFKLAMEKSFTTYLP 566

Query: 599 DTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSN 658
           D V P+LP +    +DLGK GQ T  ++F+V+VK       +++ ++YD+F I+   + N
Sbjct: 567 DIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKT---LPDETLHVLYDTFDIKLSKIRN 623

Query: 659 FPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVM 718
           FPK TY  V++IL + +     VK+DLE L  I++ LR  R+KN  AV+FGEGFNKG++ 
Sbjct: 624 FPKVTYSRVNKILQSSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIE 683

Query: 719 LNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGE 778
              + + E+  V F DQEET +T+LVSE+MIL NTL G +F +N I G++R Y +L LG 
Sbjct: 684 FFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGS 743

Query: 779 VAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRR 838
            A  +Y S+ +STK G+ P +KD+ ++SSL+NSS YT +P  HEMIGA+QYLTVTSPLRR
Sbjct: 744 KATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRR 803

Query: 839 FPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLT 898
           FPDL+NH QIHR L+K P  FN  ++ +LIW IQSRADILK+ SR  +TYWTL YL+K  
Sbjct: 804 FPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAI 863

Query: 899 KLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKID 958
              P + FDVM+TSVP NG   C+FPD+SFARG LKL    M YP+IGD V NC+I K++
Sbjct: 864 FENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLK-KGMPYPVIGDTVTNCRIVKLE 922

Query: 959 CLEGMLELE 967
            L+G+L LE
Sbjct: 923 SLDGILYLE 931

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/908 (47%), Positives = 606/908 (66%), Gaps = 21/908 (2%)

Query: 69  DIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW-RSLTKPK 127
           DI+ I + FL+RT  LEP+I+LK LPQI +E+ +R+  RY++PS+ WY   W  + TKP 
Sbjct: 46  DIKFIRESFLKRTNWLEPNIQLKSLPQIYREYEKRFLSRYIRPSKFWYETLWLNNDTKP- 104

Query: 128 IPLYKLINSDFQLITKLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMCVSLPSST 187
            P  KL  ++  L   +     + F    L ++PL + D  +L+  P+EL+MCV LP S 
Sbjct: 105 -PFNKLFLNN-PLPDSISKKQLLNFDYNDLAKTPLKIRDLAILRATPSELSMCVQLPESV 162

Query: 188 MDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVKNFSNQTN 247
            DPRYTF +  G + F  ++ + +RIP+++P GI  LI  E  H+  PIGT+K+ +  T 
Sbjct: 163 EDPRYTFASRSGKLYFVYRSMIKIRIPYQVPKGIQGLILKELQHEFSPIGTLKSNTKDTF 222

Query: 248 ILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQK 307
           ILP +AR L++    + I+K A    PI  KKL+LLHR LQN  GP  IPF  L+ LV K
Sbjct: 223 ILPYLARNLLSRTGLSDINKAASYQRPIVMKKLELLHRYLQNDKGPTSIPFTHLINLVNK 282

Query: 308 LDLNKALDDKNGINYLTSLVNNYHTVNDIP--INSPTFVSTYWAIMQQQESNLWGEIHLN 365
           LDL++AL  + G +Y+ +L+      ND P  +N+   ++ YW++++  E+ LW  I+ N
Sbjct: 283 LDLSQALHLQAGNDYIINLIKE---ANDPPSIMNASLTIAVYWSLVELSETFLWDGINRN 339

Query: 366 TALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQ 425
           +A L P +VT++PL S  ++Y ++IE LE N+Y+++NKF  LVN++ Y++I   +  +I 
Sbjct: 340 SASLFPTTVTVLPLLSYRVHYTELIEDLERNNYKQLNKFSNLVNDKNYQEIEQSFSKIIN 399

Query: 426 LLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINE---ITPNSIPNPLL 482
           LL+++ AGN  NN  I  LISK+FR I+ Y+ CDITRD+C +L+ +   I PNS  NPLL
Sbjct: 400 LLQEYTAGNLQNNPKITTLISKLFRGIKEYQRCDITRDLCNELLMKFPSIKPNS--NPLL 457

Query: 483 LNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHEID 542
            N DLA  A S+  + QQ LYD     +L  ++S  D  R+DFGDLRV+CIDSETAHEID
Sbjct: 458 KNHDLATRADSQHGQRQQILYDYVKPNDLLIQESLRD--RFDFGDLRVYCIDSETAHEID 515

Query: 543 DGVSVKNYGRDGLYTLYIHIADPTSMFPESTN-VDIEGISTDILNVALKRSFTTYLPDTV 601
           DG+S++    +G +TL+IHIADP   FPE  N   + G+  D+L +A + SFTTYLPDTV
Sbjct: 516 DGISIEK-KFNGKFTLHIHIADPAIFFPECNNEKGVLGLQDDVLKIAYENSFTTYLPDTV 574

Query: 602 VPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPK 661
           VPMLP+S C ++DLG  G++T +ISFSVDV +  + S  +++I YD+F+IR G+VSNFPK
Sbjct: 575 VPMLPKSYCKMADLGINGKKTPSISFSVDVILNKEKS--NLKICYDTFQIRLGLVSNFPK 632

Query: 662 ATYEDVDRILGTP-NSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLN 720
           ATY++VD IL +  NSE   ++ DL  LSMI+ +LR +R + + A+ FGEGFN+G    +
Sbjct: 633 ATYDNVDDILSSEVNSEQKLLQDDLRQLSMIAGILRNKRTQENGAITFGEGFNRGTPKYS 692

Query: 721 ADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVA 780
            DSE E   ++F DQ+ T S  LV+E+MILANTL GRYF ENKI GV+RCY  L L   A
Sbjct: 693 EDSETESDVISFVDQKNTKSNELVTELMILANTLCGRYFKENKIFGVYRCYNDLNLEPKA 752

Query: 781 QQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFP 840
           + QY+ +    K G  P L+DIVK+ SLLNSS+Y+  P RH+MIG++QYLTVTSPLRRF 
Sbjct: 753 KMQYNKLREECKNGKLPTLEDIVKVQSLLNSSYYSEHPSRHDMIGSEQYLTVTSPLRRFT 812

Query: 841 DLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL 900
           DL++H+Q+H HL+  PL FNQ  I + +  IQSRAD L++ S  S+   TL+YLK L K 
Sbjct: 813 DLVSHIQLHNHLKGHPLPFNQKAIRNFVPHIQSRADKLRKISTESNVCMTLSYLKNLLKT 872

Query: 901 EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCL 960
           +P+  FDV +TSVP  G   C+ P+ SFARG ++L PS   YP +GD V +CK+ KI C+
Sbjct: 873 KPDTMFDVKITSVPSEGRARCLIPEYSFARGEIRLSPSLKVYPKVGDTVNSCKVVKISCV 932

Query: 961 EGMLELEK 968
           +G+LE  K
Sbjct: 933 DGILEFNK 940

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/951 (44%), Positives = 595/951 (62%), Gaps = 61/951 (6%)

Query: 48  RELDNDQATETVVDRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDR 107
           R L     T   +D   GP K +        QR   LEP +E+KQL  I++  ++R+ ++
Sbjct: 26  RALKKSPETLKSLDNIPGPAKFV-------YQRPGQLEPGVEIKQLSHIQKGLDERFYNQ 78

Query: 108 YVKPSEDWYVNSWRSLTKPKIPLYKLINSDF-QLITKLKA--------------PNPMEF 152
           +  PS++W  ++  +    K      +N D   L +K +A                    
Sbjct: 79  HFLPSKNWCRDNAVNWANMK----DYLNMDLTSLSSKQRADMNDSLKPEVFDSESGTFRM 134

Query: 153 QPVQLMESPLNVGDFVLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLR 212
            P  L++S L +GD VLL+  P++L MCV +P+   +P Y F TIDG + F  +N +LLR
Sbjct: 135 HPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLR 194

Query: 213 IPHKLPAGIHSLIQPESHHKHLPIGTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKD 272
           IP    A    LI+ E    +  IG VK+   +T +L IVARQL TS  P +I+K AW  
Sbjct: 195 IPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNR 254

Query: 273 LPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDDKNGINYLTSLVNNYHT 332
           + +TTKKL+LLHR LQ   GPWQ+  F L  LV  LD++K      G +Y+  ++     
Sbjct: 255 MGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTG-SYIEGILKEAGM 313

Query: 333 VNDI------------PINSPTFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTIIPLK 380
             D              I++  F++TYW+++QQQE NLWG+IH + A+L+PISVT++PL 
Sbjct: 314 FRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLT 373

Query: 381 SQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFHNNGI 440
           S HLYY +V+++L+ ++Y  +  F KL+N  +       YP + +LL+D+AAGNFHNNG 
Sbjct: 374 SHHLYYKEVLKELKKDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGP 433

Query: 441 IVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLVKWQQ 500
           I+ ++SK+FRK+++Y++ DITRD+C + + E+T  SIPNP LL+ ++  P++S+    +Q
Sbjct: 434 IITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERAVLEQ 493

Query: 501 KLYDLTNIEELQWKKSGTDDD---RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYT 557
           K+YDL             +DD   R+DFG + V+CIDSETAHEIDDG+S++  G +  YT
Sbjct: 494 KIYDLA--------LPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENA-YT 544

Query: 558 LYIHIADPTSMFPESTNVDIEG-ISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLG 616
           L+IHIADP S+F  S     EG  S +I N+AL+R FT+YLPD V PMLP+S     DLG
Sbjct: 545 LHIHIADPVSLFSNSQ----EGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLG 600

Query: 617 KQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNS 676
           K G  +KT+SFSVD++    C   ++EI+ ++F ++ G+VS FP+ TY+ VDRILG    
Sbjct: 601 KDGIASKTLSFSVDIR----CRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGL-EQ 655

Query: 677 EASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQE 736
           +AS   ++L +L  I+ LLR +R+K  NA+IFGEGFN+GLV L        T ++F DQE
Sbjct: 656 DASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQE 715

Query: 737 ETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIF 796
           ET ST+LVSE+MILANT+ G++F +  I GVFRCYK L L + A+Q Y+S+        F
Sbjct: 716 ETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKF 775

Query: 797 PKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKP 856
           P  KDI KLSSLLNSSFY+ R  +HEMIGA  YL VTSPLRRF DL+NH Q+H +L   P
Sbjct: 776 PSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFP 835

Query: 857 LCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQN 916
           L F++ Q+  L W IQSR  +L++A+R+S+++WTL +LK   +L P R   VMVTSVP+ 
Sbjct: 836 LKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRL 895

Query: 917 GFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGMLELE 967
           G   CV P+LS ARG LKL P +     IGD+V NC+I+++DCL+ ++ELE
Sbjct: 896 GVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMELE 946

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/938 (44%), Positives = 592/938 (63%), Gaps = 51/938 (5%)

Query: 62  RSVGPEKDIESI---NKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVN 118
           R  GP + ++++    K   +R   LEP +E+KQL +I+   N RY ++Y+ PS++W  +
Sbjct: 16  RGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRD 75

Query: 119 S---WRSLTKP-KIPLYKL-----INSDFQLITKL--KAPNPMEFQPVQLMESPLNVGDF 167
           +   W  +     + L  L      + D  L  K+  K        P +L++SPL +GD 
Sbjct: 76  NGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDL 135

Query: 168 VLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQP 227
           VLL+  P +L  CV +P+  M+P Y F TIDG + +A ++ +LLRIP       H LI+ 
Sbjct: 136 VLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIPSFHRRSAHHLIRE 195

Query: 228 ESHHKHLPIGTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSL 287
           E  +    IGTVK+   +T ILPI+ARQL TS  P +I+K AW  + I T+KL+LLHR L
Sbjct: 196 EKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFL 255

Query: 288 QNYMGPWQIPFFTLVGLVQKLDLNK-----------ALDDKNGIN----YLTSLVNNYHT 332
           Q   GPWQ+  F L  +   LDL K            L  K G+N           N H 
Sbjct: 256 QRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHY 315

Query: 333 VNDIPINSPTFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEK 392
           +  +  ++  +++T+WA+ QQQE+NLWG+   + A+L+P+SVT++PL S+HLYY  V++ 
Sbjct: 316 IESV--DAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLKD 373

Query: 393 LEANSYREVNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVALISKIFRKI 452
           L+ +++R + KF  LVN   +    +  P   Q+LKD+AAGNFHNNG +  ++SK+FR I
Sbjct: 374 LKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAMATVVSKLFRSI 433

Query: 453 ERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLVKWQQKLYDLTNIEELQ 512
           + +K  DITRD+C +L+ +++  +  NPLLL+ DLALP+SS     ++K+Y++       
Sbjct: 434 DVFKGRDITRDLCHELMEKLSHRNTLNPLLLSDDLALPSSSANTALEEKIYEMA------ 487

Query: 513 WKKSGTDDD---RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMF 569
             +  T +D   R+DF  + V+CIDSE+AHEIDDG+S++  GR+  +TL+IHIADP S+F
Sbjct: 488 --QPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNA-FTLHIHIADPVSLF 544

Query: 570 PESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSV 629
            E         + ++ N+A +R FTTYLPD V+PMLPQS C    LG    ++KT+SFSV
Sbjct: 545 TEDGGTKF---NDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSV 601

Query: 630 DVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLS 689
           ++K+        + I  +SFK+R G  + FPK TY+ VDRIL   N++ +   K+L +L 
Sbjct: 602 NIKMHDG----GLRIDEESFKVRLGYATKFPKVTYDSVDRIL-QQNNDKTQEAKELRTLY 656

Query: 690 MISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMI 749
            IS LL+ +RI    A+IFGEGFN+GLV LN    G L ++ F DQ +T ST+LVSEMMI
Sbjct: 657 QISLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMI 716

Query: 750 LANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLL 809
           LANTL GRYF  NKI GVFRCYK+L L   A++ Y+S+   T+    P ++DI KLSSLL
Sbjct: 717 LANTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLL 776

Query: 810 NSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIW 869
           NSSFYTG P RH MIGA  YLTVTSPLRRFPDLINHLQI +HL + PL F++  ID +IW
Sbjct: 777 NSSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIW 836

Query: 870 PIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFA 929
            +QSR  ++++A+R+S+++WTL +LK L    P+R   VMVTS+P+ GF  CV PDLS A
Sbjct: 837 HLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAA 896

Query: 930 RGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGMLELE 967
           RG LKL P       IGD++ NC I+K+DCL+ ++EL+
Sbjct: 897 RGILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELK 934

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/926 (43%), Positives = 583/926 (62%), Gaps = 49/926 (5%)

Query: 68  KDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRSLTKPK 127
           +DI+ I  +FL+RT  LEPDI LK   QI  E ++R+  RY++PS+ WY ++W  L + +
Sbjct: 52  EDIQLIQANFLKRTNDLEPDIRLKTTAQIHYELDKRFNARYLQPSKSWYESNWEKLNEKR 111

Query: 128 IPL--YKLINSDFQLITKLKAPNPMEFQ---------PVQLMESPLNVGDFVLLKMRPNE 176
           + L   +LIN D           P EF+          ++ +  PL +GD VLLK   +E
Sbjct: 112 LTLSIRELINKD-----------PAEFKFNYYKNLKFNIEDVTEPLKIGDIVLLKTNTSE 160

Query: 177 LAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPI 236
            +MC+ LP S  DPRYTF++  G + F  ++ +LL+IP KLP  I  LI  E  HK+ PI
Sbjct: 161 FSMCIDLPQSLKDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNIERLIIKEPAHKYNPI 220

Query: 237 GTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQI 296
           GT+K+  ++T ++P++ARQL+ +  PAQISK A K LP+  KKL+LLHR LQ++ GP QI
Sbjct: 221 GTIKSSLDETVLVPVIARQLLINFMPAQISKCATKQLPVIIKKLELLHRYLQDFSGPQQI 280

Query: 297 PFFTLVGLVQKLDLNKALDDKNGINYLTSLV-----NNYHTVNDIPINSPTFVSTYWAIM 351
            F  L+ +++ L+L++A D + G  Y+  L+     N+Y  ++   +++   +STYWAI+
Sbjct: 281 HFHKLINIIEALNLDRATDYEKGNEYVNELLKQKYYNDYTDLSLSSLDATVALSTYWAII 340

Query: 352 QQQESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNER 411
           +QQ+  LWGEI  N++ L P +VTI+P  S H+YY ++I+ L  N++R  N+F   +NE 
Sbjct: 341 EQQDLFLWGEIKRNSSSLFPTTVTILPF-SHHVYYTKLIKSLRKNNFRRTNEFSAFINEH 399

Query: 412 KYR----DISALYPSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQD 467
                  +I   +P  + LLK++ AGN  +N  I+ ++SKIFR +  +K+ DIT+D+  +
Sbjct: 400 NLNTSSPEIQFKFPEFLHLLKEYCAGNLLDNPKIITILSKIFRNLNDFKERDITKDLAYE 459

Query: 468 LINEITPNS--IPNPLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDF 525
           L+ ++ P S  + NPLL N DL+LP +S   + Q KLY+L    +++  ++ T   R++F
Sbjct: 460 LLTKLIPTSNLLANPLLANHDLSLPTNSGRGENQSKLYELATPTKIESGETTTK--RHNF 517

Query: 526 GDLRVFCIDSETAHEIDDGVSVKNYGR-DGLYTLYIHIADPTSMFPESTNVDIEGISTDI 584
            DL V+CIDSETAHEIDDG+S+K Y + D LY+  +      SM  +S      GI  DI
Sbjct: 518 NDLNVYCIDSETAHEIDDGISIKKYLKIDLLYSFILLTLQFISM-KDSNKEKKTGIDDDI 576

Query: 585 LNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGK-SIE 643
           L +A  RSFTTYLPD VVPMLP   C +SDLGK  Q  +T++FSVD+ I    + + +++
Sbjct: 577 LKIAYYRSFTTYLPDNVVPMLPSKYCEMSDLGKSNQNIETLTFSVDITIFDGSNNEETLK 636

Query: 644 IMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASP---VKKDLESLSMISKLLREQRI 700
           I+YD+FKI+ G+VSNFPK TY+ VD+IL   NS   P   + +DL  LS I+KLLR+ RI
Sbjct: 637 ILYDTFKIQFGLVSNFPKVTYDTVDKILD--NSTKIPDTSITEDLRQLSRIAKLLRKYRI 694

Query: 701 KNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFA 760
             +NA++FGEGFN+G+  L +  +    E+ F+DQ+ + S  LVSEMMILANTLTG+Y  
Sbjct: 695 NENNAIVFGEGFNRGIPDLQSTED----EIIFTDQKNSDSNELVSEMMILANTLTGKYCK 750

Query: 761 ENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFR 820
           ++KI  ++RCY  L +G  AQQ+   ++ S      P   D+ K+SS LNSS+Y+G P R
Sbjct: 751 DHKIPVIYRCYSPLDIGPEAQQEC-IILRSKNIDRLPSNIDMAKMSSFLNSSYYSGTPSR 809

Query: 821 HEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKR 880
           H M+G+ +Y TVTSPLRRFPDL+NH+Q+H HL+   L F    +   +  IQSR+D LK 
Sbjct: 810 HSMLGSDEYATVTSPLRRFPDLLNHIQLHNHLKGYQLPFTPNHVAHYLTTIQSRSDTLKN 869

Query: 881 ASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSM 940
                 T  TLNY+K L   EP + FDV+VTSVP  G   C      +ARGT+KL     
Sbjct: 870 IGNAVYTEMTLNYIKLLINKEPTKAFDVLVTSVPIEGSARCAIVGYEYARGTIKLKAEIN 929

Query: 941 HYPMIGDIVKNCKISKIDCLEGMLEL 966
             P+IGDI+  CK++KI  +EG LEL
Sbjct: 930 PVPIIGDIITKCKVTKIFPIEGALEL 955

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/989 (42%), Positives = 584/989 (59%), Gaps = 105/989 (10%)

Query: 68   KDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVN-SWRSLT-K 125
            +DIE I + FL R K L+P I +K+LP+I  E+ +R+  R++ PS  W+ +  W S T  
Sbjct: 53   EDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTIT 112

Query: 126  PKIPLYKLINSDFQLIT----KLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMCV 181
            PK   Y ++NS F         +     + F    L   PLN+GD +LL    N L MCV
Sbjct: 113  PKFSKY-MLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSN-LLMCV 170

Query: 182  SLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGI--HSLIQPESHHKHLPIGTV 239
             +P +T DPRYTF + DG + F T++ + LRIP+KLP  +    L+  E  H +  IGT+
Sbjct: 171  DIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTI 230

Query: 240  KNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFF 299
            KN  N   +LPI+ARQL+       ++K A   L I  KKL+L+HR +QN  GP+QI FF
Sbjct: 231  KNTQNIKILLPIIARQLVVRPILNNLNKSANDKLSIILKKLELIHRLIQNGNGPYQISFF 290

Query: 300  TLVGLVQKLDLNKALDDKN---GINYLTSLVNN-YHTVND-IPINSPTFVSTYWAIMQQQ 354
             L+ L+  L+LN   + K     +N+   L +N   ++N    I++ TF++TYWAI  QQ
Sbjct: 291  KLIKLIDILNLNDFDNSKKFDINLNFSKLLSSNEIESLNSSTEIDASTFLATYWAIRLQQ 350

Query: 355  ESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLE---ANSYREVNKFVK----- 406
            +  LWG+I +N ALLSPISVT++PL   H YY   +++      N    ++ F+      
Sbjct: 351  QDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDINNQ 410

Query: 407  ---------------------LVNERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVALI 445
                                        ++IS  YP  I + +++ AGNF +N  I+ALI
Sbjct: 411  STTNTTNNNNNTTIITTTTTNNNKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALI 470

Query: 446  SKIFRKIERYKDCDITRDICQDLIN--------------------------------EIT 473
            SKI R++ ++KD D+T+D C++L++                                + T
Sbjct: 471  SKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDT 530

Query: 474  PNSIPNP------LLLNMDLALPASSKLVKWQQKLYDLTNIEEL-QWKKSGTDDDRYDFG 526
            PN I N       L  N+++ALP SSKL K Q   Y+L    +L Q+ K       +DF 
Sbjct: 531  PNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKF-----HHDFN 585

Query: 527  DLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMF-PESTNVDIEGISTDIL 585
            DL+V+CIDSETAHEIDDG+S++    + L+TL+IHIADP+S+F     N DI+    ++L
Sbjct: 586  DLKVYCIDSETAHEIDDGISIEKLN-NNLFTLHIHIADPSSIFLNHEKNSDIQ----NLL 640

Query: 586  NVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIM 645
            N+AL +SFTTYLPD V PMLP+S C LSDLG   Q+T TISFSV+V++ S  + +SI+I+
Sbjct: 641  NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDS--NNESIKIL 698

Query: 646  YDSFKIRKGIVSNFP-KATYEDVDRILGTPNSE------ASPVKKDLESLSMISKLLREQ 698
            +++FK+R GIVS FP   TY++VDRIL     E       S ++ DL +LS IS LL++ 
Sbjct: 699  HNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKN 758

Query: 699  RIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRY 758
            RI+N NAVIFGEGFNKGLV L+   +G    + F DQ +T S  LV+EMMILAN+L  R 
Sbjct: 759  RIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-INFKDQNDTKSVTLVTEMMILANSLAARL 817

Query: 759  FAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTK-KGIFPKLKDIVKLSSLLNSSFYTGR 817
            F ENKI G+FRCY +L L + AQ ++D +  + K     P +K+I K  SLLNSSFYT  
Sbjct: 818  FKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDL 877

Query: 818  PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADI 877
            P  H+MIGA  YLTVTSPLRRFPDL+NH+QI   ++KKP  ++ T I  ++  IQSR  I
Sbjct: 878  PLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDII 937

Query: 878  LKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHP 937
            ++  S   + Y+ LNYLK+  K  P +TFDV++TSV   GF  C+ P+ S + G LKL P
Sbjct: 938  IRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKP 997

Query: 938  SSMHYPMIGDIVKNCKISKIDCLEGMLEL 966
                 P IGD+++NCKI KID L+G L+ 
Sbjct: 998  DLDFTPSIGDVIRNCKIDKIDALDGRLDF 1026

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/920 (43%), Positives = 568/920 (61%), Gaps = 46/920 (5%)

Query: 71  ESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSWRSLTKPKIPL 130
           ++I K FL RT GLE       + +IK    +R+   Y +PS  WY +   S   P +P 
Sbjct: 20  DTIIKKFLNRTSGLETISIPHSIQKIKSNSIKRFNLTYNQPSNTWYKSLLISSPPPSLPC 79

Query: 131 YKLINSDFQLITKLKAPNP---MEFQP-------VQLMESPLNVGDFVLLKMRPNELAMC 180
               ++     T     N    + F P       +  +    N GD VLL    + L MC
Sbjct: 80  SPSTSTSTSATTATSTSNSPKWLSFIPKNNHTFNINQLNKKFNRGDIVLLSQDLSNLYMC 139

Query: 181 VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGI---HSLIQPESHHKHLPIG 237
           + LP ST DPRY+F   +G + FA ++ VLLRIP +LP  +      +QPE       +G
Sbjct: 140 IELPQSTADPRYSFANSNGDIIFANRSSVLLRIPLQLPTNLLLSDDFLQPEPTQG---VG 196

Query: 238 TVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIP 297
           TVKN  +   +LP++ RQL+ S   + IS  A   LPI  KKLQLLHR+LQ +     IP
Sbjct: 197 TVKNSIDNPYVLPVLLRQLVISPSLSTISSNANNLLPIVLKKLQLLHRNLQAFK---IIP 253

Query: 298 FFTLVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDI-PINSPTFVSTYWAIMQQQES 356
              L  LVQ LDL KA  + +G +Y+++ + N +    I  INS   ++T+WAI QQQ+ 
Sbjct: 254 LVQLSSLVQNLDLTKATSN-DGESYISNFIANSNENYSIESINSSNLIATFWAIRQQQQD 312

Query: 357 NLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDI 416
           +LWG+IH + ALL P++V+I+PL+S ++YY +++  +E +    + +F K        + 
Sbjct: 313 HLWGDIHYSKALLFPLAVSILPLQSNYMYYKEILPAIELD--HSIERFTK----NGIPNT 366

Query: 417 SALYPSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNS 476
              +P ++ LLK +A+G    +  IV +ISKIFR ++ YK  D++RD+CQ L NE+ P  
Sbjct: 367 PNEFPQLLNLLKQYASGAVLMDDKIVTMISKIFRNLDDYKKYDVSRDLCQKLYNELVPKE 426

Query: 477 --IPNPLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCID 534
             I N LL N DLALP +S   + Q+K+Y + N  +     +  + +R+DFGDLRVFCID
Sbjct: 427 QKIQNSLLYNTDLALPLASNRTEEQEKVYQMYNPIQ-----TSNNSNRHDFGDLRVFCID 481

Query: 535 SETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFP--ESTNVDIEGISTDILNVALKRS 592
            +TAHEIDDGVS++ Y ++ +YTL++HIADP+S F      NV+IE  + +IL +AL+RS
Sbjct: 482 EKTAHEIDDGVSIE-YKQNNVYTLHVHIADPSSYFKICNDHNVNIE--NDEILKIALQRS 538

Query: 593 FTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIR 652
           FTTYLPD V+PMLP+ +C  +DLGK G++TKTI+FSVDVK+  K    +++++ ++F++R
Sbjct: 539 FTTYLPDQVLPMLPKLLCRAADLGKTGEKTKTITFSVDVKLNKK--DMTVKVLDNTFQVR 596

Query: 653 KGIVSNFPK-ATYEDVDRILGTPNSEA--SPVKKDLESLSMISKLLREQRIKNSNAVIFG 709
            G VSNF K  TY DVD IL           V+KDL+S+ +I+K L   RI N NAVIF 
Sbjct: 597 LGYVSNFVKDMTYSDVDSILNDSKESGRDKKVEKDLKSMFLIAKGLNNSRIMN-NAVIFS 655

Query: 710 EGFNKGLVMLNADS-EGELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAENKIGGVF 768
           +  N G + L  D   GE+T++ F   + T S ILVSE+MILAN+L G++FAEN I  ++
Sbjct: 656 DEINNGKIELTKDEITGEVTQINFKGGKFTDSNILVSELMILANSLAGKFFAENGIPAIY 715

Query: 769 RCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQ 828
           R Y  L LG+ AQ +Y++M+++ K G  P LKDI K+SSL N+S +T  P  H MI  K 
Sbjct: 716 RSYSDLLLGKDAQSEYNAMLSNLKLGKRPTLKDINKISSLFNTSKFTTYPSPHSMIATKY 775

Query: 829 YLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTY 888
           Y TVTSPLRRFPD+INHLQIHR L K+PLCF Q  ++++ W IQ++  IL+ +SR  +TY
Sbjct: 776 YATVTSPLRRFPDMINHLQIHRILSKQPLCFTQRDLENMNWNIQTKDVILRSSSRMINTY 835

Query: 889 WTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDI 948
           WTL ++K     +P++ FDVM+TSV QNG   C+    SFA+G L   P+   +P+IGD 
Sbjct: 836 WTLRHIKDQLSEDPDKKFDVMITSVQQNGVAHCILAQFSFAKGKLVFDPNDESHPLIGDT 895

Query: 949 VKNCKISKIDCLEGMLELEK 968
           V NCKI+KIDCL  +LE  K
Sbjct: 896 VSNCKITKIDCLGNVLEFSK 915

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/922 (42%), Positives = 578/922 (62%), Gaps = 53/922 (5%)

Query: 69  DIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWY--VNSWRSLTKP 126
           ++E +   FL+RTKGLE   E+K++ +I+ +    + + Y+ PS+ W+  V S  S +  
Sbjct: 36  NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSN- 94

Query: 127 KIPLYKLINSDFQLITK---------LKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNEL 177
                 LIN    LI+K         +K      F  +QL +  L++GD VLL+    EL
Sbjct: 95  -----DLINE--TLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKEL 147

Query: 178 AMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGI--HSLIQPESHHKHLP 235
            MCV +P S  DPR+TF   DGT+ F+TK  V LRI + LP  I  H LI+  + ++   
Sbjct: 148 LMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIK--NKYEAGL 205

Query: 236 IGTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQ 295
           I   +N + +   LP+VARQ+ TS  P++IS++A +DL +  KKL++LHR + + +    
Sbjct: 206 INRKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSS 265

Query: 296 IPFFTLVGLVQKLDLNKALDDK--NGINYLTSLVNNYHTVNDI----PINSPTFVSTYWA 349
           I F  LV LVQ +DLNK   ++  +  N++++++ N  T +DI     I++ T +STYWA
Sbjct: 266 ISFLKLVHLVQNVDLNKLARNRADHDANHISNIIRN--TKDDIQYMTKIDAITLLSTYWA 323

Query: 350 IMQQQESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYREVNKFVKLVN 409
           ++QQQ+S LWG+I +++ALL PISV+++P  +  +Y  + I ++  +    +NKF + +N
Sbjct: 324 VIQQQQSQLWGDIQIHSALLFPISVSVLPFNNV-IYLNETIPRVATD--ENINKFTEAIN 380

Query: 410 ERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLI 469
           +     I+  +P  + +LK++  G ++ N  I  +ISK+FR+IE YK+ +++RD CQ L 
Sbjct: 381 KHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLY 440

Query: 470 NEITP-NSIPNPLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDL 528
           NE+ P N I N LLL+ DL LP  S   + +Q +Y LT ++      +  D  R+DF DL
Sbjct: 441 NELNPSNKILNSLLLSKDLCLPEISGTTRTEQLIYSLTEVDN----HAIIDQRRHDFKDL 496

Query: 529 RVFCIDSETAHEIDDGVSVKNYGRDGLYT-LYIHIADPTSMFPESTNVDIEGISTDILNV 587
           +VFCID +TAHEIDDGVSV    +DG  T L+IHIADP S+FP    ++    S +ILN+
Sbjct: 497 KVFCIDEKTAHEIDDGVSV--LRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNI 554

Query: 588 ALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYD 647
           A +R+FTTYLP+ V+PMLP+S C  SDLG  G+ T TI+FSVD    S CS     I+ D
Sbjct: 555 AFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFD-KSSCS-----ILED 608

Query: 648 SFKIRKGIVSNFPK-ATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAV 706
           +F+I+ G V+NFPK  TY++VD+IL +     + +++DL  +  I+  LR+ RI NS AV
Sbjct: 609 TFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNS-AV 667

Query: 707 IFGEGFNKGLV-MLNADSEGELT-EVTFSDQEETLSTILVSEMMILANTLTGRYFAENKI 764
           IFGEGFNKG V ++    +GE + +V F D E T S I+VSE MILAN+L G+YF  +KI
Sbjct: 668 IFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKI 727

Query: 765 GGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDIVKLSSLLNSSFYTGRPFRHEMI 824
             +++ YK L +   A  Q+  ++   KK + P +K+I K+ SLL+SS ++ +P  HEMI
Sbjct: 728 PAIYKTYKGLNMKPKASSQFKKILNVNKKRL-PSIKEISKIGSLLSSSTFSSKPSIHEMI 786

Query: 825 GAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRADILKRASRN 884
           G  QY TVTSPLRRFPDLINH Q+HR+L  +PLCF+Q ++D ++W +  R  IL+  SR 
Sbjct: 787 GTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRK 846

Query: 885 SSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPM 944
            + YWTL YL +  +  P   FDVMV SV +NG   C+ P LS+A GTLKL PS+   P 
Sbjct: 847 FNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPA 906

Query: 945 IGDIVKNCKISKIDCLEGMLEL 966
           IG+I+KNCKI+ IDCL   LE 
Sbjct: 907 IGEIIKNCKIANIDCLGNSLEF 928

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/945 (38%), Positives = 553/945 (58%), Gaps = 53/945 (5%)

Query: 65  GPEKDIESINKD----FLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVNSW 120
           G     ES+ +D    F  + K + P++E+K   + K E   R+ DR+V+PS DWY    
Sbjct: 39  GTNVTTESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVG 98

Query: 121 RS------------LTKPKIPLYKLINSDFQLITK--LKAPN-----------PMEFQPV 155
           +S            L +  I    L     + ++K   K  N              F P 
Sbjct: 99  KSHGENTDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPS 158

Query: 156 QLMESPLNVGDFVLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPH 215
            ++ S L  GD  +LK  P EL +CV  PS  MD R+TF   DG + +A K  V LR P 
Sbjct: 159 AIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPT 218

Query: 216 KLPAGIHSLIQPESHHKHLPIGTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPI 275
                   ++Q E  H + P+G+VKN  + T ++P + R+++ S    +I+  A + LPI
Sbjct: 219 IFNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPI 278

Query: 276 TTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDD-------KNGI--NYLTSL 326
             KKL+L+HR LQ+   PWQIP   LV +   L+L+  ++        K+G+  + L SL
Sbjct: 279 IKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDALYSL 338

Query: 327 VNNYHTVND-IP--INSPTFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTIIPLKSQH 383
            N++  ++  +P  +     ++ YWA++ QQ + +WGE+ ++  +  P +VT++PL  QH
Sbjct: 339 ANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQH 398

Query: 384 LYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVA 443
           L+Y  +I KL  +    +N+   L+NE     ++  +P ++ LL+D+AAGN  +N  I +
Sbjct: 399 LHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITS 458

Query: 444 LISKIFRKIERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLVKWQQKLY 503
           LIS +FRK++ YK+ +I+RD+C DL+  I P+  PNPLL+N +L LP +++ VK +QK+Y
Sbjct: 459 LISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKLEQKIY 518

Query: 504 DLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIA 563
           DL     +  K   + + R ++ DL  +CIDS  AHEIDD VS+K+ G    Y +YIH+A
Sbjct: 519 DLA----VPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLG-GAKYRIYIHVA 573

Query: 564 DPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTK 623
           DP S+FPE+ N D   I++ +L++A +R+FTTYLPD V PMLP +    SDLG+ G+ TK
Sbjct: 574 DPASLFPEA-NEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTK 632

Query: 624 TISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVK- 682
            ++FSVD   +     K + ++ DS K+   ++    + TYE VD +L  P ++    K 
Sbjct: 633 AVTFSVDCTFS---KSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKH 689

Query: 683 KDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTI 742
           +DL++L  I+K LR QRI +  AV+F E  + G+V L+ D   EL EV+F DQ ET STI
Sbjct: 690 EDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSELVEVSFKDQIETKSTI 748

Query: 743 LVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLKDI 802
           LVSE+MILAN+LT  YF EN+I G++R Y+ L + E A    + +   T++       DI
Sbjct: 749 LVSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADI 808

Query: 803 VKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQT 862
            K+ S L SSFY+  P  H+M+G   YLT+TSPLRRFPDL+NHLQ+HR L+  PL + Q+
Sbjct: 809 AKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQS 868

Query: 863 QIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCV 922
           Q+D ++W I +R   LK AS ++  YWTL +LKK  +   +  + + +TS+  NG+  CV
Sbjct: 869 QLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCV 928

Query: 923 FPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGMLELE 967
             D +FA G LK++ +  + P++GD + +C+IS I CL+G+L+ E
Sbjct: 929 ILDKAFAVGQLKINLNK-NPPLVGDQISDCEISNIQCLDGILQFE 972

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/832 (38%), Positives = 504/832 (60%), Gaps = 34/832 (4%)

Query: 152 FQPVQLMESPLNVGDFVLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLL 211
            +P  L  + L +GD  +L   P +L +CV  P+   D RY F   DG +C+ATK+ V L
Sbjct: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRL 60

Query: 212 RIP--HKLPAGIHSLIQPESHHKHLPIGTVKNFSNQTNILPIVARQLITSRYPAQISKLA 269
           R+P  HK P  +  L+  E+ H + P+GTVKN  ++T +LP+  R+L  +    +IS+ A
Sbjct: 61  RVPGLHKRP--LRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQA 118

Query: 270 WKDLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDL-NKALDDKNGINYLTSLVN 328
              LP    KL+LLHR LQ+++GPWQ+  F LV LV +L+L N   +    +  L + +N
Sbjct: 119 VAQLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELN 178

Query: 329 ----NYHTVNDI--------PINSPTFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTI 376
               +Y +  DI         ++   +++TYW ++QQQ   +WG+I  + AL SP+SVT+
Sbjct: 179 IGQGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTV 238

Query: 377 IPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFH 436
           +PL+ Q L+Y  ++  ++ + Y  +++F  LVN+ KY++  + Y SV+QLL+D+ AGN +
Sbjct: 239 LPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNIN 298

Query: 437 NNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLV 496
           +N  ++ L++++FR+++ YK+ ++TR I   L+ ++ P +  NPL  N  L LP S+   
Sbjct: 299 SNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRT 358

Query: 497 KWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLY 556
             +QK+YDL +   L  ++ G    R +F  +  +CIDS  AHEIDDGVS++   +   Y
Sbjct: 359 ALEQKVYDLAS-PPLDQEEPGP---RKEFSGV-CYCIDSPDAHEIDDGVSIERL-KGSRY 412

Query: 557 TLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLG 616
            L++HIA P S+F +S       I   ++++A +R+FTTYLPD V PM+P+S    SDLG
Sbjct: 413 RLHVHIAYPYSLFKKSYTPGEVPIDP-VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLG 471

Query: 617 KQGQRTKTISFSVDVKITSKCSGKSIEIMYDS-FKIRKGIVSNFPKATYEDVDRILGTPN 675
           +  + TKTI+ SVDV ++ K     + ++ ++  +I  G      + TY+ VD +L +  
Sbjct: 472 QWDKPTKTITISVDVDLSKK-----LRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKR 526

Query: 676 SEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQ 735
            +A     DL  L  +++ LRE+R    +A++FG+  N GL+ L  + +G+L  V   D 
Sbjct: 527 QDAE--ASDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDS 583

Query: 736 EETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGI 795
           + T S  LVSE+MI+AN+L GRYF EN I GV+R   +L L   A  QY S+  + ++  
Sbjct: 584 KSTKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKG 643

Query: 796 FPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKK 855
                D+VK+++ L +S Y+  P RH M+G ++YLT+TSPLRR PD+INH+Q+HRHL+  
Sbjct: 644 SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSL 703

Query: 856 PLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQ 915
           P CF+Q QID+L W I +R   LK AS+ SS +WTL YLK     EP++ +D++VTS+P 
Sbjct: 704 PPCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPL 763

Query: 916 NGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGMLELE 967
           NGF  C  P + ++ G LK+ PS  + P +G  V NC I+++D L+G L  E
Sbjct: 764 NGFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFE 814

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 110/472 (23%), Positives = 185/472 (39%), Gaps = 74/472 (15%)

Query: 498 WQQKLYDLTNIEELQWKKSGTDDD------------RYDFGDLRVFCIDSETAHEIDDGV 545
           + +K+ +    E   WK   T DD            R D  D  +  ID     +IDD +
Sbjct: 487 FSKKVLECLPPEGHDWKAPETLDDASAVSKDPLLPKRRDLRDKLICSIDPPGCVDIDDAL 546

Query: 546 SVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPML 605
             K    +G + + +HIAD T     +T +D EG S         R  + YL D  + ML
Sbjct: 547 HAKKLP-NGNWEVGVHIADVTHFVKPNTALDGEGAS---------RGTSVYLVDKRIDML 596

Query: 606 PQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYE 665
           P  +   +DL          +FSV  ++       +++      K R+         +YE
Sbjct: 597 PMLLG--TDLCSLKPYVDRFAFSVLWELNENADIVNVDFAKSVIKSREAF-------SYE 647

Query: 666 DVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSE- 724
                +  PN +   +   + +L  +S  L+E+RI N+ A+          V ++ DSE 
Sbjct: 648 QAQLRIDDPNQQ-DELTHGMRALLKLSIKLKEKRI-NAGAL----NLASPEVKVHMDSET 701

Query: 725 GELTEVTFSDQEETLSTILVSEMMILANTLTGRYFAEN-KIGGVFRCYKQLP------LG 777
            +  EV       T S  LV E M+LAN    R   ++     + R +   P      L 
Sbjct: 702 SDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYDSFPQTAMLRRHASPPSTNFELLN 759

Query: 778 EVAQ---------QQYDSMITSTKKGIFPK---LKDIVKLSS----LLNSSFYTG----R 817
           E+ Q         +   ++  S  + I PK      +V++ S    +    FY+G     
Sbjct: 760 EMLQTRKGMSISLESSKALADSLDRCIDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYS 819

Query: 818 PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCF---NQTQIDSLIWPIQSR 874
            FRH  +    Y   TSP+RR+ D++ H Q+   +  +PL     ++ ++D +   I  +
Sbjct: 820 DFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLDLSHRDKNRMDMICKNINKK 879

Query: 875 ADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVM----VTSVPQNGFTGCV 922
               + A R S  Y+    ++    +E      V+    V  VP+ G  G +
Sbjct: 880 HRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVLNNGIVVLVPKFGVEGLI 931

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 101/436 (23%), Positives = 177/436 (40%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T     +T +D EG S
Sbjct: 527 RRDLRDKLICSIDPPGCVDIDDALHAKRLS-NGNWEVGVHIADVTHFVKPNTALDAEGAS 585

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL       +  +FSV  ++    +  +
Sbjct: 586 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVERFAFSVIWELDDNANIVN 634

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           ++ M    K R+         +YE     +  PN +   + + + +L  +S  L+++R+ 
Sbjct: 635 VDFMKSVIKSREAF-------SYEQAQLRIDDPN-QKDELTEGMRALLQLSIKLKQKRL- 685

Query: 702 NSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGR-YF 759
           ++ A+          V ++ DSE  +  EV       T S  LV E M+LAN    R  F
Sbjct: 686 DAGAL----NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIF 739

Query: 760 AENKIGGVFRCYKQLP------LGEVAQ---------QQYDSMITSTKKGIFPK---LKD 801
                  + R +   P      L E+ Q         +   ++  S  + I P+      
Sbjct: 740 DAFPQTAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCIDPQDPYFNT 799

Query: 802 IVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 800 LVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 859

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVM- 909
            +PL     ++ ++D +   I  +    + A R S  Y+    ++    +E      V+ 
Sbjct: 860 YEPLDLMHRDKNKMDMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVEAGYVIKVLN 919

Query: 910 ---VTSVPQNGFTGCV 922
              V  VP+ G  G +
Sbjct: 920 NGIVVLVPRFGVEGLI 935

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 100/436 (22%), Positives = 177/436 (40%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG S
Sbjct: 537 RRDLRDKLICSIDPPNCVDIDDALHAKML-ENGNWEVGVHIADVTHFVKPGTALDAEGAS 595

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++    +  +
Sbjct: 596 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDQDANIVN 644

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           ++         K ++ +    +YE     +  PN +   + + + +L  +SK L+++R+ 
Sbjct: 645 VDFT-------KSVIRSREAFSYEQAQIRIDDPN-QTDELTQGMRALLQLSKKLKQKRL- 695

Query: 702 NSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGRYFA 760
           ++ A+          V ++ DSE  +  EV       T S  LV E M+LAN    R   
Sbjct: 696 DAGAL----NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIY 749

Query: 761 EN-KIGGVFRCYKQLP------LGEVAQQQYDSMIT-STKKGIF-----------PKLKD 801
           ++     + R +   P      L E+ Q +    I+  + K +            P    
Sbjct: 750 DSFPQTAMLRRHAAPPSTNFEILNEMLQTKKGLTISLESSKALADSLDRCVDKNDPYFNT 809

Query: 802 IVKLSS----LLNSSFYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 810 LVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAIG 869

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            +PL     ++T++D +   I  +    + A R S  Y+    ++    +E      V  
Sbjct: 870 YEPLSLTHRDKTKMDMICKNINRKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVFN 929

Query: 909 --MVTSVPQNGFTGCV 922
             +V  VP+ G  G +
Sbjct: 930 NGIVVLVPKFGVEGLI 945

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 98/437 (22%), Positives = 172/437 (39%), Gaps = 62/437 (14%)

Query: 521 DRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGI 580
           +R D  D  +  ID     +IDD +  K    +G + + +HIAD T    + T +D EG 
Sbjct: 541 NRKDLRDKLICSIDPPGCVDIDDALHAKKLP-NGNWEVGVHIADVTHFVKQGTALDAEGA 599

Query: 581 STDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGK 640
           S         R  + YL D  + MLP  +   +DL          +FSV  ++ S     
Sbjct: 600 S---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDSNADIV 648

Query: 641 SIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRI 700
            ++      K R+         +YE     +  PN +   + + + +L  +S  L+++R+
Sbjct: 649 KVDFTKSVIKSREAF-------SYEQAQLRIDDPN-QTDDLTQGMRALLQLSIKLKQKRL 700

Query: 701 KNSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGRYF 759
            N              V ++ DSE  +  EV       T S  LV E M+LAN    R  
Sbjct: 701 DNG-----ALNLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKI 753

Query: 760 AEN-KIGGVFRCYKQLP------LGEVAQQQYDSMIT-STKKGIF-----------PKLK 800
            +      + R +   P      L E+  ++ +  I+  + K +            P   
Sbjct: 754 YDAFPQTAMLRRHAAPPSTNFELLNEMLHRRKNMSISLESSKALADSLDRCEDPKDPYFN 813

Query: 801 DIVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHL 852
            +V++ S    +    FY+G      F+H  +    Y   TSP+RR+ D++ H Q+   +
Sbjct: 814 TLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAI 873

Query: 853 QKKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV- 908
             +PL     ++ ++D +   I  +    + A R S  Y+    ++    +E      V 
Sbjct: 874 GYEPLSLSHRDKNKMDMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVETGYVIKVF 933

Query: 909 ---MVTSVPQNGFTGCV 922
              +V  VP+ G  G +
Sbjct: 934 NNGIVVLVPKFGVEGLI 950

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 103/437 (23%), Positives = 176/437 (40%), Gaps = 62/437 (14%)

Query: 521 DRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGI 580
           +R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG 
Sbjct: 544 NRQDLRDKLICSIDPPGCVDIDDALHAKRLP-NGNWEVGVHIADVTHFVKPGTALDAEGA 602

Query: 581 STDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGK 640
           S         R  + YL D  + MLP  +   +DL          +FSV  ++       
Sbjct: 603 S---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDNA--- 648

Query: 641 SIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRI 700
             EI+    K  K ++ +    +YE     +   N +   + K + +L  +S  L+++R+
Sbjct: 649 --EII--DVKFTKSVIRSREAFSYEQAQLRIDDKN-QTDELTKGMRALLELSVKLKQKRL 703

Query: 701 KNSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGR-Y 758
            ++ A+          V ++ DSE  +  EV       T S  LV E M+LAN    R  
Sbjct: 704 -DAGAL----NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKI 756

Query: 759 FAENKIGGVFRCYKQLP------LGEVAQQQYD---------SMITSTKKGIFPK---LK 800
           F       + R +   P      L E+ Q++ +         ++  S  + I PK     
Sbjct: 757 FDAFPQTAMLRRHASPPSTNFAILNEMLQKRKNLSISLESSKALADSLDRCIDPKDPYFN 816

Query: 801 DIVKLSS----LLNSSFYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHL 852
            ++++ S    +    FY+G      FRH  +    Y   TSP+RRF D+I H Q+   +
Sbjct: 817 TLIRIMSTRCMMAAQYFYSGAYQYSDFRHYGLAVDIYTHFTSPIRRFCDVIAHRQLAGAI 876

Query: 853 QKKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVM 909
             +PL     ++ +++ +   I  +    + A R S  Y+    ++     E      V+
Sbjct: 877 GYEPLALMHRDKNKMEMICKNINKKHRNAQFAGRASIEYYVGQVMRNNECTETGYVIKVL 936

Query: 910 ----VTSVPQNGFTGCV 922
               V  VP+ G  G +
Sbjct: 937 NNGIVVLVPKFGVEGLI 953

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 96/436 (22%), Positives = 168/436 (38%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG S
Sbjct: 526 RKDLRDKLICSIDPPGCVDIDDALHAKKLP-NGHWEVGVHIADVTHFVKPGTALDAEGAS 584

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++       +
Sbjct: 585 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENADIIN 633

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           +E         K ++ +     YE     +  P        K  + L++  + L +  IK
Sbjct: 634 VEF-------HKSVIRSREAFAYEQAQLRIDDP--------KQQDELTLGMRALLQLSIK 678

Query: 702 NSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLST-ILVSEMMILANTLTGRYFA 760
                +     N     +    + E ++    + ++ L+T  LV E M+LAN    R   
Sbjct: 679 LKQKRLEAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKIY 738

Query: 761 EN-KIGGVFRCYKQLP------LGEVAQQQYD-SMITSTKKGIF-----------PKLKD 801
           ++     + R +   P      L E+ Q++ + S+   + K +            P    
Sbjct: 739 DSFPQTAMLRRHAPPPATNFEILNEMLQRRKNMSISVESSKALADSLDRCEDPKDPYFNT 798

Query: 802 IVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 799 LVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDIVAHRQLAGAID 858

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            +PL     ++ ++D +   I  +    + A R S  Y+    +K    LE      V  
Sbjct: 859 YEPLSLDHRDKHKMDMICRNINRKHRNAQFAGRASIEYYVGQVMKNNESLESGYVIKVFN 918

Query: 909 --MVTSVPQNGFTGCV 922
             +V  VP+ G  G +
Sbjct: 919 NGIVVLVPKFGVEGLI 934

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 94/436 (21%), Positives = 175/436 (40%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG S
Sbjct: 518 RRDLRDKLICSIDPPGCVDIDDALHAKQLP-NGNWEVGVHIADVTHFVKAGTPLDAEGAS 576

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++  K S  +
Sbjct: 577 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDQKASIVN 625

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           ++         K ++ +    +YE     +  PN +   + + + +L  +S  L+++R+ 
Sbjct: 626 VDFT-------KSVIRSREAFSYEQAQLRIDDPN-QKDELTQGMRALLNLSVKLKQKRLD 677

Query: 702 NSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLST-ILVSEMMILAN-TLTGRYF 759
                      N     +    + E ++    + ++ L+T  LV E M+LAN ++  + +
Sbjct: 678 -------AGALNLASPEVKVHMDSETSDPGDVEIKKLLATNSLVEEFMLLANISVAKKIY 730

Query: 760 AENKIGGVFRCYKQLP------LGEVAQ---------QQYDSMITSTKKGIFPK---LKD 801
                  + R +   P      L E+ Q         +   ++  S  + I P+      
Sbjct: 731 EAFPQTAMLRRHAAPPSTNFETLNEMLQLRKSMSISLESSKALADSLDRCIDPQDPYFNT 790

Query: 802 IVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 791 LVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 850

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            +PL     ++ +++ +   I  R    + A R S  Y+    ++    +E      V  
Sbjct: 851 YEPLDLTHRDKNKMEMICKNINKRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIRVFN 910

Query: 909 --MVTSVPQNGFTGCV 922
             +V  VP+ G  G +
Sbjct: 911 NGIVVLVPKFGVEGLI 926

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 93/439 (21%), Positives = 173/439 (39%), Gaps = 62/439 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T     +T +D EG S
Sbjct: 519 RRDMRDKLICSIDPPGCVDIDDALHAKKLI-NGNWEVGVHIADVTHFVKPNTALDAEGAS 577

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R+ + YL D  + MLP  +   +DL          +FSV  ++ +  +  S
Sbjct: 578 ---------RATSVYLVDKRIDMLPMLLG--TDLCSLKASVDRFAFSVIWELDNDANIVS 626

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           +E         K ++ +    +YE     +  PN +   +   + +L  +SK L+++R+ 
Sbjct: 627 VEFT-------KSVIRSREAFSYEQAQLRIDDPN-QNDELTLGMRALLQLSKKLKQKRLD 678

Query: 702 NSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLST-ILVSEMMILANTLTGRYFA 760
                      N     +    + E ++ +  + ++ LST  LV E M+LAN    R   
Sbjct: 679 -------AGALNLASPEVKVHMDSETSDPSEVEIKKLLSTNSLVEEFMLLANISVARKIY 731

Query: 761 EN-------------------KIGGVFRCYKQLPLG-EVAQQQYDSM--ITSTKKGIFPK 798
           ++                    +  + +  K + +  E ++   DS+     +    F  
Sbjct: 732 DSFPQTAMLRRHAAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDSDDVYFNT 791

Query: 799 LKDIVKLSSLLNSS-FYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           L  I+    ++ +  FY+G      FRH  +    Y   TSP+RR+ D+I H Q+   + 
Sbjct: 792 LVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHRQLAAAIG 851

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            + L     ++ +++ +   I  R    + A R S  Y     ++    +E      V  
Sbjct: 852 YESLDLSHRDKQKMEIICRNINKRHRNAQFAGRASIEYHVGQVMRNNESIETGYVIKVFN 911

Query: 909 --MVTSVPQNGFTGCVFPD 925
             +   VP+ G  G +  +
Sbjct: 912 NGIAVLVPKFGVEGLILAE 930

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 102/478 (21%), Positives = 181/478 (37%), Gaps = 67/478 (14%)

Query: 480 PLLLNMDLALPASSKLVKWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAH 539
           P   N+   LPA     K   KL D+  I      K      R D  D  +  ID     
Sbjct: 523 PFSKNVLECLPAEGHDWKAPTKLDDMEAI-----AKDPLLTKRKDLRDKVICSIDPPGCV 577

Query: 540 EIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPD 599
           +IDD +  +    +G + + +HIAD T     ST +D EG +         R  + YL D
Sbjct: 578 DIDDALHARKLP-NGNWEVGVHIADVTHFVKPSTALDAEGAA---------RGTSVYLVD 627

Query: 600 TVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNF 659
             + MLP  +   +DL          +FSV  ++       ++E M    K R+      
Sbjct: 628 KRIDMLPMLLG--TDLCSLKPYVDRFAFSVMWELDDNADIVNVEFMKSVIKSREAF---- 681

Query: 660 PKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVML 719
              +YE     +   N +   +   + +L  +S  L+++R++           N     +
Sbjct: 682 ---SYEQAQLRIDDKNQD-DELTLGMRALLKLSIKLKQKRLE-------AGALNLASPEV 730

Query: 720 NADSEGELTEVTFSDQEETLST-ILVSEMMILANTLTGRYFAE----------------- 761
               + E ++    + ++ L+T  LV E M+LAN    R   +                 
Sbjct: 731 KVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPST 790

Query: 762 --NKIGGVFRCYKQLPLG-EVAQQQYDSM--ITSTKKGIFPKLKDIVKLSSLLNSS-FYT 815
               +  +    K + +  E ++   DS+     ++   F  L  I+    ++ +  FY+
Sbjct: 791 NFETLNEMLNTRKNMSISLESSKALADSLDRCVDSEDPYFNTLVRIMSTRCMMAAQYFYS 850

Query: 816 GR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCF---NQTQIDSLI 868
           G      FRH  +    Y   TSP+RR+ D++ H Q+   +  +PL     ++ ++D + 
Sbjct: 851 GAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLSLAHRDKNKMDMIC 910

Query: 869 WPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV----MVTSVPQNGFTGCV 922
             I  +    + A R S  Y+    ++     E      V    +V  VP+ G  G +
Sbjct: 911 RNINRKHRNAQFAGRASIEYYVGQVMRSNESTETGYIIKVFNNGIVVLVPKFGVEGLI 968

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 99/436 (22%), Positives = 175/436 (40%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T     +T +D EG S
Sbjct: 527 RKDLRDKLICSIDPPGCVDIDDALHAKKLP-NGNWEVGVHIADVTHFVKPNTPLDAEGAS 585

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++    +   
Sbjct: 586 ---------RGTSVYLVDKRIDMLPLLLG--TDLCSLKPYVDRYAFSVLWELDD--NANI 632

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           +++ +    IR     ++ +A     D+      S+   + + + +L  +S  L+++R+ 
Sbjct: 633 VDVNFTKSVIRSREAFSYEQAQIRIDDK------SQTDELTQGMRALLKLSIKLKQKRL- 685

Query: 702 NSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGRYFA 760
           ++ A+          V ++ DSE  +  EV       T S  LV E M+LAN    R   
Sbjct: 686 DAGAL----NLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIF 739

Query: 761 EN-------------------KIGGVFRCYKQLPLG-EVAQQQYDSM--ITSTKKGIFPK 798
           E+                    +  +    KQ+ +  E ++   DS+      K   F  
Sbjct: 740 ESFPQTAMLRRHGVPPSTNFETLNEMLHQRKQMTISLESSKALADSLDRCVDPKDPYFNT 799

Query: 799 LKDIVKLSSLLNSS-FYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           L  I+    ++ +  FY+G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 800 LIRIMSTRCMMAAQYFYSGAYSYSEFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 859

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVM- 909
            +PL     ++ ++D +   I  R    + A R S  Y+    ++    +E      V+ 
Sbjct: 860 YEPLDLSHRDKNKMDMICRNINKRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVLN 919

Query: 910 ---VTSVPQNGFTGCV 922
              V  VP+ G  G +
Sbjct: 920 NGIVVLVPRFGVEGLI 935

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 98/436 (22%), Positives = 174/436 (39%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG S
Sbjct: 530 RTDLRDKLICSIDPPGCVDIDDALHAKRLP-NGNWEVGVHIADVTHFVKPGTALDAEGAS 588

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++       +
Sbjct: 589 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELNEDADIVN 637

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           ++         K ++ +    +YE     +   N +   +   + +L  +SK L+++R+ 
Sbjct: 638 VDFT-------KSVIRSREAFSYEQAQVRIDDSN-QKDELTLGMRALLHLSKKLKQKRL- 688

Query: 702 NSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGRYFA 760
           ++ A+          V ++ DSE  +  EV       T S  LV E M+LAN    R   
Sbjct: 689 DAGAL----NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIY 742

Query: 761 EN-KIGGVFRCYKQLP------LGEVAQQQYDSMIT---------STKKGIFPK---LKD 801
           +      + R +   P      L E+  Q+ +  I+         S  + I P+      
Sbjct: 743 DAFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMTISLESSKALADSLDRCIDPQDAYFNT 802

Query: 802 IVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           +V++ S    +    FY+G      F+H  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 803 LVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAID 862

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            +PL     ++ ++D +   I  +    + A R S  Y+    ++    +E      V  
Sbjct: 863 YEPLSLMHRDKNKMDMVCRNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVFN 922

Query: 909 --MVTSVPQNGFTGCV 922
             +V  VP+ G  G +
Sbjct: 923 NGIVVLVPKFGVEGLI 938

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 986

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 97/436 (22%), Positives = 170/436 (38%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T     +T +D EG S
Sbjct: 516 RRDLRDKLICSIDPPGCVDIDDALHAKKLP-NGNWEVGVHIADVTHFVKANTPLDAEGAS 574

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   ++L          +FSV  ++    +  +
Sbjct: 575 ---------RGTSVYLVDKRIDMLPMLLG--TNLCSLKPYVDRFAFSVLWELDENANIVN 623

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           ++      K R+       +   +D         S+   + + + +L  +S  L+++R+ 
Sbjct: 624 VDFTKSVIKSREAFSYEQAQLRIDD--------ESQKDELTQGMRALLQLSIKLKQKRL- 674

Query: 702 NSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILAN-TLTGRYF 759
           ++ A+          V ++ DSE  +  EV       T S  LV E M+LAN ++  R +
Sbjct: 675 DAGAL----NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARRIY 728

Query: 760 AENKIGGVFRCYKQLP------LGEVAQQQYDSMIT-STKKGIFPKLKDIVKLSS----- 807
                  + R +   P      L E+ Q +    I+  + K +   L   V L       
Sbjct: 729 EAFPQTAMLRRHAAPPATNFETLNEMLQLRKGMSISLESSKALANSLDRCVDLEDPYFNT 788

Query: 808 ----------LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
                     +    FY G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 789 LVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAAIG 848

Query: 854 KKPLCFN---QTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            +PL  N   + ++D +   I  +    + A R S  Y+    ++    +E      V  
Sbjct: 849 YEPLDLNHRDKNKMDFMCRNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIRVFH 908

Query: 909 --MVTSVPQNGFTGCV 922
             +V  VP+ G  G +
Sbjct: 909 NGIVVLVPKFGVEGLI 924

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 97/436 (22%), Positives = 170/436 (38%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG S
Sbjct: 528 RKDLRDKLICSIDPPGCVDIDDALHAKRLP-NGNWEVGVHIADVTHFVKPGTALDAEGAS 586

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++       +
Sbjct: 587 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDENADIVN 635

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           ++      K R+       +   +D         S+   + + + +L  +S  L+++R+ 
Sbjct: 636 VDFTKSVIKSREAFSYEQAQLRIDDA--------SQTDDLTQGMRALLQLSIKLKQKRL- 686

Query: 702 NSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGRYFA 760
           ++ A+          V ++ DSE  +  EV       T S  LV E M+LAN    R   
Sbjct: 687 DAGAL----NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIY 740

Query: 761 EN-KIGGVFRCYKQLP------LGEVAQQQYDSMIT-STKKGIF-----------PKLKD 801
           +      + R +   P      L E+  Q+ +  I+  + K +            P    
Sbjct: 741 DAFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMSISLESSKALADSLDRCEDPKDPYFNT 800

Query: 802 IVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           +V++ S    +    FY+G      F+H  +    Y   TSP+RRF D++ H Q+   + 
Sbjct: 801 LVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRFCDVVAHRQLAGAIG 860

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            +PL     ++ ++D +   I  +    + A R S  Y+    ++     E      V  
Sbjct: 861 YEPLDLSHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVFN 920

Query: 909 --MVTSVPQNGFTGCV 922
             +V  VP+ G  G +
Sbjct: 921 NGIVVLVPKFGVEGLI 936

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 94/436 (21%), Positives = 171/436 (39%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG +
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDALHAKRLP-NGNWEVGVHIADVTHFVKPGTALDAEGAA 589

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++    +  +
Sbjct: 590 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENANIVN 638

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           ++ M    + R+       +   +D+++     N E   +   + +L  +S  L+++R++
Sbjct: 639 VDFMKSVIRSREAFSYEQAQLRIDDINQ-----NDE---LTLGMRALLQLSVKLKQKRLE 690

Query: 702 NSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGRYFA 760
                          V ++ DSE  +  EV       T S  LV E M+LAN    R   
Sbjct: 691 AG-----ALNLASPEVKVHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIY 743

Query: 761 EN-KIGGVFRCYKQLP------LGE---------VAQQQYDSMITSTKKGIFPK---LKD 801
           +      + R +   P      L E         ++ +   ++  S  + + P+      
Sbjct: 744 DAFPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNT 803

Query: 802 IVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 804 LVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 863

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            +PL     ++ ++D +   I  +    + A R S  Y+    ++     E      V  
Sbjct: 864 YEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVFN 923

Query: 909 --MVTSVPQNGFTGCV 922
             +V  VP+ G  G +
Sbjct: 924 NGIVVLVPKFGVEGLI 939

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 95/472 (20%), Positives = 184/472 (38%), Gaps = 74/472 (15%)

Query: 498 WQQKLYDLTNIEELQWKKSGTDDD------------RYDFGDLRVFCIDSETAHEIDDGV 545
           + +K+ +    E   WK     DD            R D  D  +  ID     +IDD +
Sbjct: 495 FSKKVLECLPSEGHDWKAPAKLDDPEAVSKDALLTKRKDLRDKLICSIDPPGCVDIDDAL 554

Query: 546 SVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPML 605
             K    +G + + +HIAD T     +T +D EG +         R  + YL D  + ML
Sbjct: 555 HAKRLP-NGNWEVGVHIADVTHFVKPNTALDAEGAA---------RGTSVYLVDKRIDML 604

Query: 606 PQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYE 665
           P  +   +DL          +FSV  ++    +  +++ M    K R+    ++ +A + 
Sbjct: 605 PMLLG--TDLCSLKPYVDRFAFSVIWELDDDANIVNVDFMKSVIKSREAF--SYEQAQFR 660

Query: 666 DVDRILGTPNSEASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEG 725
             D+      ++   +   + +L  +S  L+++R++           N     +    + 
Sbjct: 661 IDDK------NQNDELTSGMRALLELSIKLKQKRLE-------AGALNLASPEVKVHMDS 707

Query: 726 ELTEVTFSDQEETLST-ILVSEMMILANTLTGRYFAEN-KIGGVFRCYKQLP------LG 777
           E ++    + ++ L+T  LV E M+LAN    R   +      + R +   P      + 
Sbjct: 708 ETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNFEIMN 767

Query: 778 E---------VAQQQYDSMITSTKKGIFPK---LKDIVKLSS----LLNSSFYTGR---- 817
           E         ++ +   ++  S  + + P+      +V++ S    +    FY+G     
Sbjct: 768 EMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYP 827

Query: 818 PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCF---NQTQIDSLIWPIQSR 874
            FRH  +    Y   TSP+RR+ D++ H Q+   +  +PL     ++ ++D +   I  +
Sbjct: 828 DFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKMDMICRNINRK 887

Query: 875 ADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV----MVTSVPQNGFTGCV 922
               + A R S  Y+    ++     E      V    +V  VP+ G  G +
Sbjct: 888 HRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVFNNGIVVLVPKFGVEGLI 939

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 100/436 (22%), Positives = 175/436 (40%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG S
Sbjct: 518 RVDLRDKLICSIDPPGCVDIDDALHAKKLP-NGHFEVGVHIADVTHFVKAGTPLDAEGAS 576

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++      ++
Sbjct: 577 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWEL-----DEN 620

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
            +I+   F   K ++ +    +YE     +   N +   +   + +L  +S  L+++R+ 
Sbjct: 621 ADIVKVDFS--KSVIRSREAFSYEQAQLRIDDKN-QTDELTLGMRALLDLSIKLKQKRL- 676

Query: 702 NSNAVIFGEGFNKGLVMLNADSE-GELTEVTFSDQEETLSTILVSEMMILANTLTGRYFA 760
           ++ A+          V ++ DSE  +  EV       T S  LV E M+LAN    R   
Sbjct: 677 DAGAL----NLASPEVKVHMDSETSDPGEVEIKKLLATNS--LVEEFMLLANISVARKIY 730

Query: 761 EN-KIGGVFRCYKQLP------LGEVAQQQ-------------YDSM--ITSTKKGIFPK 798
           ++     + R +   P      L E+ Q++              DS+      K   F  
Sbjct: 731 DSFPQTAMLRRHAAPPSTNFEILNEMLQKRKGLSISLESSKALADSLDRCVDKKDPYFNT 790

Query: 799 LKDIVKLSSLLNSS-FYTG----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           L  I+    ++ +  FY+G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 791 LVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 850

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVM- 909
            +PL     ++ +++ +   I  R    + A R S  Y+    ++    +E      V+ 
Sbjct: 851 YEPLDLSHRDKNKMEMICKNINRRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVLN 910

Query: 910 ---VTSVPQNGFTGCV 922
              V  VP+ G  G +
Sbjct: 911 NGIVVIVPKFGVEGLI 926

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 93/436 (21%), Positives = 171/436 (39%), Gaps = 62/436 (14%)

Query: 522 RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGIS 581
           R D  D  +  ID     +IDD +  K    +G + + +HIAD T      T +D EG +
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDALHAKKLP-NGNWEVGVHIADVTHFVKPGTALDAEGAA 589

Query: 582 TDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKS 641
                    R  + YL D  + MLP  +   +DL          +FSV  ++    +  +
Sbjct: 590 ---------RGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDSANIVN 638

Query: 642 IEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRIK 701
           +  M    + R+    ++ +A     D+   T N E   +   + +L  +S  L+++R++
Sbjct: 639 VNFMKSVIRSREAF--SYEQAQLRIDDK---TQNDE---LTMGMRALLKLSVKLKQKRLE 690

Query: 702 NSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLST-ILVSEMMILANTLTGRYFA 760
                      N     +    + E ++    + ++ L+T  LV E M+LAN    R   
Sbjct: 691 -------AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIY 743

Query: 761 EN-KIGGVFRCYKQLP------LGEVAQQQYDSMIT-STKKGIF-----------PKLKD 801
           +      + R +   P      L E+   + +  I+  + K +            P    
Sbjct: 744 DAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNT 803

Query: 802 IVKLSS----LLNSSFYTGR----PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQ 853
           +V++ S    +    FY+G      FRH  +    Y   TSP+RR+ D++ H Q+   + 
Sbjct: 804 LVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG 863

Query: 854 KKPLCF---NQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDV-- 908
            +PL     ++ ++D +   I  +    + A R S  Y+    ++     E      V  
Sbjct: 864 YEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVFN 923

Query: 909 --MVTSVPQNGFTGCV 922
             +V  VP+ G  G +
Sbjct: 924 NGIVVLVPKFGVEGLI 939

>Skud_4.555 Chr4 complement(988201..991959) [3759 bp, 1252 aa] {ON}
            YDR293C (REAL)
          Length = 1252

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 86/366 (23%), Positives = 157/366 (42%), Gaps = 63/366 (17%)

Query: 508  IEELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTS 567
            +E L+ +K+ TD + Y+   +      SE A      + VKN G DG   L  HI D TS
Sbjct: 685  VESLENRKNFTDANEYNILAISELGWVSEFA------LHVKNNG-DGTLELGCHIVDVTS 737

Query: 568  MFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISF 627
               E ++VD           A KRS   ++P  +V +LPQS      L   G+ + TIS 
Sbjct: 738  HIEEGSSVDRR---------ARKRSSAVFMPQKLVNLLPQSFNDELSLAP-GKESATIS- 786

Query: 628  SVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLES 687
               V  T   S   I+  +    + + I+S     + E ++  L   NS++      L S
Sbjct: 787  ---VVYTLDSSTLRIKTTW----VGESIISPLSVLSLEQLNEKLSIGNSDSY-----LSS 834

Query: 688  LSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEM 747
            +  I++    +RI +  A +        L +L + S+ E  +V  +  + TL  ++++E+
Sbjct: 835  VQEIARSFYARRINDPEAKLL-----PTLSLLES-SDDEKVKVDLNILDRTLGFVVINEI 888

Query: 748  MILAN-TLTGRYFAENKIGGVFRCYKQL-PLG--------EVAQQQYDSMITSTKKGIFP 797
                N T+  R +   K+G +    +Q+ P+         ++    YD  +++  + I  
Sbjct: 889  KRKVNATVAERIYT--KLGDLALLRRQMQPIATKMASFRKKIQNFGYDFDVSTADELIKA 946

Query: 798  KLK----------DIVKLSSLLNSSFY-TGR----PFRHEMIGAKQYLTVTSPLRRFPDL 842
             LK          +I+   ++  + ++  G+     + H  +    Y   T+P+RR+ D 
Sbjct: 947  VLKIKDDDVRVGIEILLFKTMPRARYFIAGKVDPDQYGHYALNLPIYTHFTAPMRRYADH 1006

Query: 843  INHLQI 848
            + H Q+
Sbjct: 1007 VVHRQL 1012

>Suva_2.459 Chr2 complement(810378..814154) [3777 bp, 1258 aa] {ON}
           YDR293C (REAL)
          Length = 1258

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 67/139 (48%), Gaps = 22/139 (15%)

Query: 509 EELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSM 568
           E L+ +++ TDD+ Y+     +  I SE        + V+N G DG   L  H+ D TS 
Sbjct: 692 ENLEKRRTFTDDNEYN-----ILAI-SELGWVSGFALHVRNNG-DGTLELGCHVVDVTSH 744

Query: 569 FPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTIS-- 626
             E ++VD           A KRS   ++P  +V +LPQS      L   G+ + TIS  
Sbjct: 745 IEEGSSVDRR---------ARKRSSAVFMPQKLVSLLPQSFNDTLSLAP-GKESPTISVV 794

Query: 627 FSVD---VKITSKCSGKSI 642
           +++D   +++ S   G+SI
Sbjct: 795 YTLDSSTLRVQSTWVGESI 813

>TBLA0C03280 Chr3 complement(794118..798059) [3942 bp, 1313 aa] {ON}
            Anc_5.307 YDR293C
          Length = 1313

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 82/354 (23%), Positives = 143/354 (40%), Gaps = 57/354 (16%)

Query: 521  DRYDFGDLRVFCIDS-ETAHEIDD-GVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIE 578
            DR DF DL  + + +  T+  + +  V VK+   DG   L  H+ D T+   E  +VD  
Sbjct: 717  DRVDFTDLNTYNVLAISTSDNLSEFAVHVKD-NSDGTLELACHVIDITAHIEEGGSVD-- 773

Query: 579  GISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCS 638
                     A +RS    +P   + +LP+++     L K  +++ TIS      I  K  
Sbjct: 774  -------RRARRRSTGVIMPQEKMALLPKAVNDAVSLFKD-KKSATIS------IIFKLD 819

Query: 639  GKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQ 698
             KS +++  S  I + I++    +   DVD I+    S+   V   L  L+ IS+    +
Sbjct: 820  SKSFKVI--SSTICESIIA---PSLLLDVDDIVEDLMSKE--VNPYLSLLAEISRCFYSE 872

Query: 699  RIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRY 758
            R+ + +  +        L+ + +  + E TEV  +  E  +   +V+E+    N++    
Sbjct: 873  RMHSPDIAL------DPLLSILSKLDDEDTEVNLNIFETNMGNFVVNELQRKCNSIIAES 926

Query: 759  FAENKIGGVFRCYKQLP---------LGEVAQQQYDSMITS---------------TKKG 794
               + IG      +QLP         + +V +  YD   TS               T+KG
Sbjct: 927  LLLH-IGDPAFLRRQLPPSPIKLKSFVKKVKRYGYDIDSTSPENIIKSILSINDPITRKG 985

Query: 795  IFPKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQI 848
            +       +  +     S      + H +     Y   TSPLRR+ D + H Q+
Sbjct: 986  VEVLFYKTMSRAKYFIKSNVENNQYEHYLNNFPVYTHFTSPLRRYSDHVVHRQL 1039

>YDR293C Chr4 complement(1045640..1049392) [3753 bp, 1250 aa] {ON}
           SSD1Translational repressor with a role in polar growth
           and wall integrity; regulated by Cbk1p phosphorylation
           to effect bud-specific translational control and
           localization of specific mRNAs; interacts with TOR
           pathway components; contains a functional N-terminal
           nuclear localization sequence and nucleocytoplasmic
           shuttling appears to be critical to Ssd1p function
          Length = 1250

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 68/138 (49%), Gaps = 22/138 (15%)

Query: 509 EELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSM 568
           E L+++++ TD + Y+     +F I SE     +  + V+N G +G   L  H+ D TS 
Sbjct: 684 ESLEYRRNFTDTNEYN-----IFAI-SELGWVSEFALHVRNNG-NGTLELGCHVVDVTSH 736

Query: 569 FPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTIS-- 626
             E ++VD           A KRS   ++P  +V +LPQS      L   G+ + T+S  
Sbjct: 737 IEEGSSVDRR---------ARKRSSAVFMPQKLVNLLPQSFNDELSLAP-GKESATLSVV 786

Query: 627 FSVD---VKITSKCSGKS 641
           +++D   ++I S   G+S
Sbjct: 787 YTLDSSTLRIKSTWVGES 804

>TDEL0E03200 Chr5 (603078..606851) [3774 bp, 1257 aa] {ON} Anc_5.307
           YDR293C
          Length = 1257

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 68/140 (48%), Gaps = 22/140 (15%)

Query: 509 EELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRD-GLYTLYIHIADPTS 567
           E+L+ ++  TD + YD     +  I +E+A+  D  V +KN   D G   L  H+ D T+
Sbjct: 690 EDLESRRQFTDQNTYD-----ILAI-TESANYCDFAVHIKNNTDDAGSIELGCHVVDATA 743

Query: 568 MFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTIS- 626
              E +++D           A KRS   ++P   V +LPQ++     L   G+ +  IS 
Sbjct: 744 YIEEDSSLDRR---------ARKRSTAVFMPQKFVDLLPQALNKSLTLAP-GKESACISV 793

Query: 627 -FSVD---VKITSKCSGKSI 642
            +++D   +K+ S   G+S+
Sbjct: 794 VYTLDGKTLKVKSTWIGESV 813

>NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {ON}
           Anc_5.307 YDR293C
          Length = 1260

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 76/161 (47%), Gaps = 30/161 (18%)

Query: 522 RYDFGDLRVFCI----DSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDI 577
           R DF D   + I    ++++  E    + VKN   DG + L  H+ D T+   E++++D 
Sbjct: 702 RTDFTDPSEYSILAIAENDSLSEF--ALHVKN-NNDGTFELGCHVVDATAHIEENSSLDR 758

Query: 578 EGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISF-------SVD 630
                     A KRS   ++P  VV +LP+++     L K+ +++ T+S        +++
Sbjct: 759 R---------ARKRSSGVFMPQKVVNLLPKALNESLSL-KKDKKSATLSVIYTLNAETLE 808

Query: 631 VKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRIL 671
           ++ T+ C  +SI I+   F   K I  N      +DVD  L
Sbjct: 809 IRSTTVC--ESI-ILPSRFMTAKEIDDNL---ASDDVDPYL 843

>Smik_4.542 Chr4 complement(977225..980980) [3756 bp, 1251 aa] {ON}
           YDR293C (REAL)
          Length = 1251

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 66/138 (47%), Gaps = 22/138 (15%)

Query: 509 EELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSM 568
           E L+ +++ TD + Y+     +F I SE     +  + V++ G +G   L  H+ D T  
Sbjct: 685 ESLECRRNFTDVNEYN-----IFAI-SELGWISEFALHVRDNG-NGTLELGCHVVDVTGH 737

Query: 569 FPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTIS-- 626
             E ++VD           A KRS   ++P  +V +LPQS      L   G+ + TIS  
Sbjct: 738 IEEGSSVDKR---------ARKRSSAVFMPQKLVNLLPQSFNDELSLAP-GKESATISVV 787

Query: 627 FSVD---VKITSKCSGKS 641
           +++D   ++I S   G+S
Sbjct: 788 YTLDSSTLRIKSTWVGES 805

>Kpol_1023.50 s1023 (111088..114849) [3762 bp, 1253 aa] {ON}
            (111088..114849) [3762 nt, 1254 aa]
          Length = 1253

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 126/306 (41%), Gaps = 56/306 (18%)

Query: 578  EGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTIS--FSVDVKITS 635
            EG+S D    A KRS   ++P T V +LP+++     L  Q + + T+S  +S+DV    
Sbjct: 743  EGLSLD--RRARKRSSAVFMPQTTVNLLPKTLNESLKL-DQNKTSATLSVVYSLDV---- 795

Query: 636  KCSGKSIEIMYDSFKIRKGIVSNFPKATYEDV--DRILGTPNSEASPVKKDLESLSMISK 693
                KS+E+   S  I + ++S     + +D+  D+   +PN   S     L ++  I++
Sbjct: 796  ----KSLEVK--SCWIGETVISPSSVISIDDITDDK---SPNHSGS-----LSTMKKIAR 841

Query: 694  LLREQRIKNSNAVIFGEGFNKGLVMLNA-DSEGELTEVTFSDQEETLSTILVSEMMILAN 752
               + RI+N  A +  E     L + ++ D E    E+   D++  L  ++V E+    N
Sbjct: 842  SFYQNRIQNDKAELIPE-----LPLFDSLDDERVKVELNILDKK--LGYVVVEEIERFVN 894

Query: 753  TLTGRYFAENKIGGVFRCYKQLPL--------GEVAQQQYDSMITSTKKGIFPKLK---- 800
                +    N     F   +  P          +V +  Y+  I+S    I   LK    
Sbjct: 895  NTIAKELYNNLGERAFLRRQASPTLNKMENFKRKVQKLGYEVNISSPSSLINSILKIDND 954

Query: 801  ------DIVKLSSLLNSSFYTG-----RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIH 849
                  +I+   S+  + ++         + H       Y   T+PLRR+ D + H Q+ 
Sbjct: 955  DIRIGVEILLFKSMPRAKYFVAGKVDVEQYDHFAFNFPLYTHFTAPLRRYADHVVHRQLK 1014

Query: 850  RHLQKK 855
              L  K
Sbjct: 1015 SILSGK 1020

>NCAS0A13730 Chr1 (2698652..2699080) [429 bp, 142 aa] {ON} Anc_7.282
          Length = 142

 Score = 32.7 bits (73), Expect = 1.8,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 796 FPKLKDIVKLSSLLNSSFY-----TGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQ 847
           FP +  +++ S + +S F+     T   F   M+ A  Y+TVTSPLRR P+LI   Q
Sbjct: 21  FPPVAVLLR-SGVCSSDFWLNVVLTCLGFMPGMVHAFYYITVTSPLRRDPELIYFYQ 76

>Kwal_23.5705 s23 complement(1284606..1288292) [3687 bp, 1228 aa]
           {ON} YDR293C (SSD1) - Product of gene unknown [contig
           11] FULL
          Length = 1228

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 54/111 (48%), Gaps = 15/111 (13%)

Query: 536 ETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTT 595
           ET    D  + +KN+  +G   +  HI D T+   E +++D           A KRS   
Sbjct: 684 ETDGLSDLALHIKNFA-NGDLEMGCHILDVTAHIEEGSSLDRR---------ARKRSSGV 733

Query: 596 YLPDTVVPMLPQSICHLSDLGKQGQRTKTIS----FSVDVKITSKCSGKSI 642
           ++P  VV +LPQ++     + K G+ + T+S    F  ++K+ S   G+++
Sbjct: 734 FIPQKVVNLLPQTLNDALTM-KNGRTSATLSVVYRFDSNLKVVSTWIGETL 783

>SAKL0G10142g Chr7 (862958..866707) [3750 bp, 1249 aa] {ON} similar to
            uniprot|P24276 Saccharomyces cerevisiae YDR293C SSD1
            Protein with a role in maintenance of cellular integrity
            interacts with components of the TOR pathway ssd1 mutant
            of a clinical S. cerevisiae strain displays elevated
            virulence
          Length = 1249

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 76/355 (21%), Positives = 135/355 (38%), Gaps = 60/355 (16%)

Query: 520  DDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEG 579
            + R  F D  VF I +E A   D  + +K   +DG   L  H+ D T+   E +++D   
Sbjct: 691  ESRRSFEDEDVFAI-TENASVSDFAIHIKTL-KDGSIELGCHVIDVTAHIEEGSSLDRR- 747

Query: 580  ISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSG 639
                    A KRS   ++P   V +LP+ +     L K          S  + +  K   
Sbjct: 748  --------ARKRSSAVFMPQKTVHLLPKQLNSSLALTKD-------KLSATISVVYKIDA 792

Query: 640  KSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQR 699
             S++I+  S  I +  +      T++ V++ + + N+      K +  +  ++     QR
Sbjct: 793  SSLDIV--STWIGESTIVPADLLTFDQVNKEITSGNA-----SKFISDVHKVANQFYCQR 845

Query: 700  IKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGRYF 759
            +      + G      L +L    + E   V  +  E +++  +  E+    N+      
Sbjct: 846  LN-----LSGARQKPNLALLET-LDDEKVNVDLNILENSIADTIFGEIQRKVNSTVAEKI 899

Query: 760  AENKIGGVFRCYKQL-PLGE--------VAQQQYDSMITSTKKGIFP-------KLKDIV 803
              NK+G +    +Q  P+          V    YD  ITS    I         K +  V
Sbjct: 900  Y-NKLGSLSFLRRQAEPITTKLKLFKKKVQNFGYDVDITSASAAISSILSIEDTKARACV 958

Query: 804  KLSSLLNSSFYTGRPFRHEMIGAKQYLT----------VTSPLRRFPDLINHLQI 848
            ++  LL  +F   + F    + + QY             T+PLRR+ D + H Q+
Sbjct: 959  EI--LLFKTFTRAKYFIAGKVDSDQYRNYSLNLPLYTHFTAPLRRYADHVVHRQL 1011

>KLTH0G06248g Chr7 (494464..498141) [3678 bp, 1225 aa] {ON} similar
           to uniprot|P24276 Saccharomyces cerevisiae YDR293C SSD1
           Protein with a role in maintenance of cellular integrity
           interacts with components of the TOR pathway ssd1 mutant
           of a clinical S. cerevisiae strain displays elevated
           virulence
          Length = 1225

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 14/94 (14%)

Query: 553 DGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHL 612
           DG   +  HI D T+   E +++D           A KRS   ++P  VV +LPQ++   
Sbjct: 697 DGSLEVGCHILDVTAHIEEGSSLDRR---------ARKRSSGVFIPQKVVHLLPQTLNDA 747

Query: 613 SDLGKQGQRTKTIS----FSVDVKITSKCSGKSI 642
             L K+G+ + TIS    F    K+ S   G+++
Sbjct: 748 LTL-KEGKTSATISVVHRFDKSFKVLSTWIGETL 780

>Kpol_1004.68 s1004 complement(143077..144804,144807..146831) [3753
           bp, 1250 aa] {ON}
           complement(143077..144804,144807..146831) [3753 nt, 1251
           aa]
          Length = 1250

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 17/109 (15%)

Query: 540 EIDD-GVSVKNYGRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLP 598
           EI D  + VK+  +DG      HI D T+   E +++D           A KRS   +LP
Sbjct: 709 EITDFSIHVKD-NKDGTIEFACHIVDVTAHIEEGSSLD---------RRARKRSTAVFLP 758

Query: 599 DTVVPMLPQSICHLSDLGKQGQRTKTISF-----SVDVKITSKCSGKSI 642
             VV +LP++I + S   ++ +++ TIS      S D  + S   G+SI
Sbjct: 759 QRVVNLLPEAI-NKSLTFERSKKSATISVIYTLDSKDYSLKSTWIGESI 806

>TBLA0A06720 Chr1 complement(1638092..1639594) [1503 bp, 500 aa]
           {ON} Anc_6.307 YNR012W
          Length = 500

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 7/69 (10%)

Query: 111 PSEDWYVNSWRSLTKPKIPLYK-LINSDF-----QLITKLKAPNPMEFQPVQLMESPLNV 164
           PS D +++S +  T P I + K LI SD      QL  +  APN  +F+ V LMES +  
Sbjct: 365 PSGDCFMHSLKK-TIPNISVSKILIQSDSKTGEPQLHCEYLAPNISQFKQVYLMESQIIT 423

Query: 165 GDFVLLKMR 173
           G  +++ +R
Sbjct: 424 GTSIIMAIR 432

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 370 SPISVTIIPLKSQHLYYAQVIEKLEANSYREVN--KFVKLVNERKYRDISALYPSVIQLL 427
           SP+ + +        Y + +I   EA    E+N   F     E+++  I+A YP     +
Sbjct: 106 SPLPIALPVPVPAPPYDSSMIPLKEAEEKLEINDPNF-----EKQWHLINANYPGNDVNV 160

Query: 428 KDFAAGNFHNNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPN-SIPNPLLLN 484
           KD   GN   +G++VA++         Y++ DI  + C +   +   N ++P P L +
Sbjct: 161 KDVWYGNVTGSGVVVAIVDDGV----DYENPDIADNFCAEGSWDFNDNTTLPKPRLAD 214

>KLLA0F23221g Chr6 (2163234..2164850) [1617 bp, 538 aa] {ON} some
           similarities with uniprot|O13581 Saccharomyces
           cerevisiae YDL128W VCX1 Vacuolar H+/Ca2+ exchanger, has
           similarity to sodium/calcium exchangers, including the
           bovine Na+/Ca2+,K+ antiporter
          Length = 538

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 209 VLLRIPHKLPAGIHSLIQPESHHKHLPIGTVKNFSNQT--NILPIVARQLITSRYP 262
           ++L +   LP  I SLI        L +      SNQ    +LPIV  QLI+SRYP
Sbjct: 428 IILPLAGSLPEHISSLISAHHGQMDLAVSLAIGSSNQVLGMVLPIV--QLISSRYP 481

>Ecym_3477 Chr3 (893706..894473) [768 bp, 255 aa] {ON} similar to
           Ashbya gossypii ADL326W
          Length = 255

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 264 QISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFF---TLVGLVQKLDLNKALDD-KNG 319
           Q S L W  L      ++L+H  L+ +  P Q PFF    L  ++  +D  + L D  NG
Sbjct: 56  QGSFLDWALL-----HMELVHSQLRRFESPDQTPFFPGEILKPILPPIDYPQILGDYANG 110

Query: 320 INYLTSLVNNY 330
           +NY  ++  NY
Sbjct: 111 VNYNETIKANY 121

>NCAS0F02570 Chr6 (516508..520245) [3738 bp, 1245 aa] {ON} Anc_5.307
           YDR293C
          Length = 1245

 Score = 32.0 bits (71), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)

Query: 509 EELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSM 568
           E+L  +KS T+ ++Y+     +  I SE     +  + V+N     +  L  H+ D TS 
Sbjct: 681 EDLAARKSFTNREQYN-----IMAI-SEKQSLSEFAIHVRNKDESTI-ELGCHVVDVTSY 733

Query: 569 FPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFS 628
             E++++D           A KRS   ++P   V +LP+++ +   L +  + + TIS  
Sbjct: 734 IEENSSLDRR---------ARKRSSGVFMPQKSVELLPRAVNNSITL-EANKESATISVV 783

Query: 629 VDVKITS 635
            D+ I S
Sbjct: 784 YDIDINS 790

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,258,182
Number of extensions: 4788508
Number of successful extensions: 14251
Number of sequences better than 10.0: 70
Number of HSP's gapped: 14477
Number of HSP's successfully gapped: 72
Length of query: 969
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 850
Effective length of database: 39,836,145
Effective search space: 33860723250
Effective search space used: 33860723250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)