Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR283C (RIT1)8.848ON51351326690.0
Smik_13.4968.848ON49449422430.0
Skud_13.4558.848ON49449421570.0
Suva_13.4728.848ON51049621240.0
Kpol_1068.28.848ON49148915090.0
NDAI0K003508.848ON50451314870.0
KNAG0J002208.848ON49949814720.0
TPHA0I003008.848ON49349314610.0
NCAS0C003508.848ON48649714450.0
TDEL0A079708.848ON48949414040.0
SAKL0D01276g8.848ON50250413660.0
ZYRO0G14344g8.848ON47249813390.0
KAFR0B039808.848ON48349013320.0
Kwal_27.102198.848ON50049513011e-176
Ecym_46238.848ON48049412951e-175
KLTH0C03696g8.848ON47448412731e-172
KLLA0D01386g8.848ON48950212671e-171
AFR451C8.848ON4084289501e-124
ZYRO0A01100g2.224ON30994830.11
TPHA0H019206.266ON979109800.44
TPHA0F026406.75aON27553780.52
TPHA0J030905.176ON564122714.1
CAGL0L06754g3.121ON43889714.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR283C
         (513 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...  1032   0.0  
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   868   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   835   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   822   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   585   0.0  
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   577   0.0  
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   571   0.0  
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   567   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   561   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   545   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   530   0.0  
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   520   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   517   0.0  
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   505   e-176
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   503   e-175
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   494   e-172
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   492   e-171
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   370   e-124
ZYRO0A01100g Chr1 (79473..80402) [930 bp, 309 aa] {ON} similar t...    37   0.11 
TPHA0H01920 Chr8 (450069..453008) [2940 bp, 979 aa] {ON} Anc_6.2...    35   0.44 
TPHA0F02640 Chr6 complement(590052..590879) [828 bp, 275 aa] {ON}      35   0.52 
TPHA0J03090 Chr10 (675915..677609) [1695 bp, 564 aa] {ON} Anc_5....    32   4.1  
CAGL0L06754g Chr12 (761178..762494) [1317 bp, 438 aa] {ON} highl...    32   4.4  

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score = 1032 bits (2669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/513 (97%), Positives = 501/513 (97%)

Query: 1   MVSRLSKRYRSRVQFSISVMDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRV 60
           MVSRLSKRYRSRVQFSISVMDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRV
Sbjct: 1   MVSRLSKRYRSRVQFSISVMDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRV 60

Query: 61  IPIFPHYPLIPNERCGLWYCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNK 120
           IPIFPHYPLIPNERCGLWYCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNK
Sbjct: 61  IPIFPHYPLIPNERCGLWYCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNK 120

Query: 121 GIIIVDSTRRGKKIPDALSKTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYD 180
           GIIIVDSTRRGKKIPDALSKTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYD
Sbjct: 121 GIIIVDSTRRGKKIPDALSKTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYD 180

Query: 181 MIKRKIPELVAKLQKLNIIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYE 240
           MIKRKIPELVAKLQKLNIIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYE
Sbjct: 181 MIKRKIPELVAKLQKLNIIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYE 240

Query: 241 AWETPEDQNIIPIILCTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEY 300
           AWETPEDQNIIPIILCTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEY
Sbjct: 241 AWETPEDQNIIPIILCTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEY 300

Query: 301 LGDASYSDDQLHDYIMDLAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTI 360
           LGDASYSDDQLHDYIMDLAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTI
Sbjct: 301 LGDASYSDDQLHDYIMDLAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTI 360

Query: 361 NKNLKQKLKSEYGKVIIFSNSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTF 420
           NKNLKQKLKSEYGKVIIFSNSVTVA            PFISIYKLQSGDKKSSKALRSTF
Sbjct: 361 NKNLKQKLKSEYGKVIIFSNSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTF 420

Query: 421 PRIHGEIQSLFTNRDEKIKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKL 480
           PRIHGEIQSLFTNRDEKIKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKL
Sbjct: 421 PRIHGEIQSLFTNRDEKIKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKL 480

Query: 481 IVRKHLTKLISHLKGRNVNPSRATLNSVNSFLM 513
           IVRKHLTKLISHLKGRNVNPSRATLNSVNSFLM
Sbjct: 481 IVRKHLTKLISHLKGRNVNPSRATLNSVNSFLM 513

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/494 (81%), Positives = 450/494 (91%)

Query: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79
           MDE I LSL++IN+D+RKENKSVRNRLQSILLDNKFLQDRVIP+FP++PL+PNERCG+WY
Sbjct: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60

Query: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139
           C PS++KQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS
Sbjct: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120

Query: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199
           KTVPIWCAVLNT+MLQETE+N  IDK LYLPPETVPKSEYDMIKRKIPELV KL+KLNII
Sbjct: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180

Query: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259
           DSKKLNELFMGK+LRPIWVHPGSSLL+HSVDYFTGE+Q++E WETPEDQNIIPIILCTVS
Sbjct: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240

Query: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319
           YQAQDGMDKRYGFTYVQGAADDHELWSFGLDS MFWAH+E+L D + SDDQLHDYI DL 
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300

Query: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379
           A KL++Q YIQDKG LDE+FG +DKIT+EISLGKV  GL IN+ LK++LKSEYGKV+I S
Sbjct: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360

Query: 380 NSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439
           +SVTVA            PFI++YKLQSGDKKSSKALRS  P+IH E++  F NR E+++
Sbjct: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420

Query: 440 PMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVN 499
           PML+CCNTGTDMSIGVILSILCTKYTEEWMLT ELP+++K+I+RKHLTKLISHL GRNVN
Sbjct: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480

Query: 500 PSRATLNSVNSFLM 513
           PSRATLNSVNSFLM
Sbjct: 481 PSRATLNSVNSFLM 494

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/494 (78%), Positives = 441/494 (89%)

Query: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79
           MD+ I LSLSQINKD+R+ENKSVRNRLQSILLDNKFLQ+RV+ IFPH+P++PNERCGLWY
Sbjct: 1   MDKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWY 60

Query: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139
           C PS+FK+TSYFKSTDGHVNQWDFSTRRLNFHLLETIRD KGIII+DSTRRGKKIPD+LS
Sbjct: 61  CEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLS 120

Query: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199
           KTVPIWCAVLNT+MLQ+ +++V IDKVLY+PPETVPKSEYDMIKRKIPELVAKL+KLN++
Sbjct: 121 KTVPIWCAVLNTIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVV 180

Query: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259
           DS+KLN+LFMGK+LRPIWVHPGSSLL+HSVDYFTGE++E E WE P+DQNIIPIILCTVS
Sbjct: 181 DSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVS 240

Query: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319
           YQAQDGMDKRYGFTYVQGAADDHELWSFGLDS MFW+H++YLGD   SDDQLHDYI DL 
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLV 300

Query: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379
           A KL NQ  I+DKGSLDE+FGNID ITNEISLGKV  GLTI+  LKQ+LK  Y KVI+FS
Sbjct: 301 AKKLENQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFS 360

Query: 380 NSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439
           +SV +              FIS++KLQSGDKKSSK LR+ FPRIH E+QS F NRD   K
Sbjct: 361 DSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTK 420

Query: 440 PMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVN 499
           P+LICCNTGTDMSIGVILSILCTKYTE+W LT ELP+++K+I+R+HLTKLISHL+GRNVN
Sbjct: 421 PILICCNTGTDMSIGVILSILCTKYTEDWKLTPELPEVNKIIIRRHLTKLISHLRGRNVN 480

Query: 500 PSRATLNSVNSFLM 513
           PSRATLNSVNSFLM
Sbjct: 481 PSRATLNSVNSFLM 494

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/496 (79%), Positives = 436/496 (87%), Gaps = 2/496 (0%)

Query: 20  MDENIYLSLS--QINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGL 77
           MDE I LSLS  QINKD+RKENKSVRNRLQSILLDN+FL+DRV+PIFP +P++PNERCGL
Sbjct: 15  MDEEILLSLSLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGL 74

Query: 78  WYCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDA 137
           WYC PSSF+QTSYFKSTDGHVNQWDFSTRRLNFHLLE I++NKGIIIVDSTRRGKKIPDA
Sbjct: 75  WYCEPSSFEQTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDA 134

Query: 138 LSKTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLN 197
           LSKTVPIWCAVLNT+MLQETE+NV IDKVLY+PPETVPKSEYDMIKRKIPELV KLQKLN
Sbjct: 135 LSKTVPIWCAVLNTIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLN 194

Query: 198 IIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCT 257
            IDSK LN+LF GK+LRPIWVHPGSSLL+HSVD FTGE++E E WE+PEDQNIIPIILCT
Sbjct: 195 AIDSKTLNKLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCT 254

Query: 258 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMD 317
           VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDS MFW+HI+YLGD + SDDQL  YI D
Sbjct: 255 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITD 314

Query: 318 LAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVII 377
           L   KL  Q  IQDKG+LD++F NIDKITNEISLGKV  GLTIN+ L+++LK  Y KVII
Sbjct: 315 LIGKKLEYQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVII 374

Query: 378 FSNSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEK 437
           FSNSV +A             FIS+YKLQSGDKKSSKALRSTFP IH E+Q +F N  + 
Sbjct: 375 FSNSVAIAAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKG 434

Query: 438 IKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRN 497
           +KP+L+CCNTGTDMSIGVILSILC KY EEW+LTSELP ++K+I+RKHLTKLISHL GRN
Sbjct: 435 MKPILVCCNTGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGRN 494

Query: 498 VNPSRATLNSVNSFLM 513
           VNPSRATLNSVNSFLM
Sbjct: 495 VNPSRATLNSVNSFLM 510

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/489 (59%), Positives = 364/489 (74%), Gaps = 11/489 (2%)

Query: 27  SLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYCNPSSFK 86
           S++QI+KDI+KE KS++NR+QSILLD +FL+D VIP FP +P+IPNERCGLWYCNP  F+
Sbjct: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLFE 69

Query: 87  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 146
           QTSYFKSTDGH+NQWDFSTRRLNFHLL T+  N GI+IVDSTRRGKKIPDALSKTVPIWC
Sbjct: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129

Query: 147 AVLNTLMLQETEK-NVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLN 205
           AVLN+LML+  ++ N    KVL++PP TVP SEY  I +K+P L+ +L KL IID   L 
Sbjct: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189

Query: 206 ELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSYQAQDG 265
           + F GKLLRPIW+HPGSSLL  + D FTGE    + WETPED+ IIPIILCTVSY+AQDG
Sbjct: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTN-DVWETPEDEEIIPIILCTVSYRAQDG 248

Query: 266 MDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLRN 325
           +DKR+GFTYVQGAADDHELWS GL+ +MFW +IE   D   S+D L   + DL AAK   
Sbjct: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAK--- 305

Query: 326 QCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTVA 385
           Q  + +  +L E F  +D IT +I LGK++ GL I  +L  +L S++  VI+FS S  ++
Sbjct: 306 QKEVSETETL-EAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364

Query: 386 XXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLF-TNRDEKIKPMLIC 444
                         I I +LQSG KKSSKALR T P +H  I+  F T++ +   P+LIC
Sbjct: 365 VSKNEEKITQR---IVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILIC 421

Query: 445 CNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVNPSRAT 504
           CN+GTDMSI ++L +LC  Y  +W  TS+  +++K+I+RKHLTKLISHLKGRNVNPSRAT
Sbjct: 422 CNSGTDMSIALVLMLLCKHYDLDWN-TSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT 480

Query: 505 LNSVNSFLM 513
           LNSVN +LM
Sbjct: 481 LNSVNEYLM 489

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/513 (57%), Positives = 371/513 (72%), Gaps = 28/513 (5%)

Query: 20  MDENIYL-SLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLW 78
           MD++ +  SLSQINKDI+KE KS+RNRLQSILLDN+FL D +I  FP+YP+IPNERCGLW
Sbjct: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60

Query: 79  YCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDAL 138
           Y +PS + QTSYFKSTDGH NQWDFSTRRLNFHLLETI  +KGI I+DSTRRGKKIPDAL
Sbjct: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120

Query: 139 SKTVPIWCAVLNTLMLQETEKN---VAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQK 195
           SKT+PIWCAVLN +ML+E +     V ++  L++PP TVPKSEYD I +KIP LV KL K
Sbjct: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180

Query: 196 LNIIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIIL 255
           L II++ +L   F GKLLRP+W++PGSS+L  S D FTGE  +  AWE PE  NIIPI+L
Sbjct: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIVL 238

Query: 256 CTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYI 315
           CT+SYQAQDG+DKRYGFTYVQGAADDHELWS GL   +FW+HI YLG+ ++SDD+L +Y+
Sbjct: 239 CTISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYV 298

Query: 316 MDLAAAKLRNQCYIQDKGSLDEVFGN-IDKITNEISLGKVSSGLTINKNLKQKLKSEYGK 374
             +   K+++      + ++D +F N +D IT EISLGK+ + + I K++  + K  +  
Sbjct: 299 RHMIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSL 358

Query: 375 VIIFSNSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNR 434
           V+I S +VT+               + IYKL SG KKSSK LR+  P+I+  ++   TN 
Sbjct: 359 VVILSETVTLNSDDKDEQQSDS---VKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG 415

Query: 435 DEKIKPMLICCNTGTDMSIGVILSILCTKY------TEEWM-LTSELPD-------ISKL 480
               KP+LICCNTGTD+SIG+IL+ILC  Y       + W+ L  E  D       + K 
Sbjct: 416 ----KPILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKT 471

Query: 481 IVRKHLTKLISHLKGRNVNPSRATLNSVNSFLM 513
           I+RK+LT LISHL+GRNVNPSRATLNSVN +LM
Sbjct: 472 IIRKNLTTLISHLEGRNVNPSRATLNSVNDYLM 504

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/498 (55%), Positives = 357/498 (71%), Gaps = 10/498 (2%)

Query: 18  SVMDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGL 77
             MD N+  SL QI+K+++++++S+RNR+QSILLDN+FL+ RV   FP +PLIPNERCGL
Sbjct: 10  GAMDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGL 69

Query: 78  WYCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDA 137
           WYCNPS F QTSYFKSTDGH NQWDFSTRRLNFHLL T+++  G++IVDSTRRGKKIPDA
Sbjct: 70  WYCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDA 129

Query: 138 LSKTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLN 197
           LSKTVP+WCAVLN+LML+   K   ++ VL++PPETVP+SE D + +K+P+LV KL+ LN
Sbjct: 130 LSKTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILN 189

Query: 198 IIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCT 257
           + D  K + +  GKLLRP WV PGSSLL    D FTGE Q    WE   D+NI+PIILCT
Sbjct: 190 VFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGE-QIQNKWEVSRDENIVPIILCT 248

Query: 258 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMD 317
           VSYQAQDG+DKR GFTYVQGAADDHELWS GL++N+FW++I+   + S  D +L++ +  
Sbjct: 249 VSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDK 308

Query: 318 LAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVII 377
           +   +  N       GSLD++   IDK+T+ +SLG++   +T++      L+  Y  VI+
Sbjct: 309 MVTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIV 368

Query: 378 FSNSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEK 437
            S +V +               + I++L SG KKSSK LR+  P I   I +      + 
Sbjct: 369 LSETVHLDKDASQDNE-----MVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIIL--QP 421

Query: 438 IKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSE--LPDISKLIVRKHLTKLISHLKG 495
           IKP+LICCNTG DMSIGV+L++LC  Y E W L  E   P +SK+++R+HLTKLI+HL G
Sbjct: 422 IKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNG 481

Query: 496 RNVNPSRATLNSVNSFLM 513
           RNVNPSRATLNS+NSFLM
Sbjct: 482 RNVNPSRATLNSINSFLM 499

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/493 (57%), Positives = 351/493 (71%), Gaps = 11/493 (2%)

Query: 27  SLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYCNPSSFK 86
           S++QI KDIRKENKS++NR+ SILLD+KFL ++VIP FP YPL+PNERCGLWYC  ++F 
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64

Query: 87  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 146
            TSYFKSTDGH+NQWDFSTRRLNFHL+  I + KGIII+DSTRRGKKIPDALSKTVPIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 147 AVLNTLMLQETEKNVAIDK-VLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLN 205
           AVLNT++LQ  E      + VL++PP TV KSEY+ IK KIPELV KL KL++ID KKL 
Sbjct: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184

Query: 206 ELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETP-EDQNIIPIILCTVSYQAQD 264
           E F G LLRPIW+HPGSS+L    D FTGE+    +WE P +++ IIPI+LCTVSYQ QD
Sbjct: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQD 244

Query: 265 GMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLR 324
           G+D R GFTYVQGAADDHELWS GL   +FW +IE L +   S++ L DY+ ++  ++  
Sbjct: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEILLSESM 304

Query: 325 NQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTV 384
               ++    +D VF +IDKIT E+ LG +  GL I +NL +     Y  VII SNS+ +
Sbjct: 305 KITNLE----VDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKL 360

Query: 385 AX----XXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIKP 440
           A                  I +++LQSG KKSSK LRS  P I   +    ++     KP
Sbjct: 361 ASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKP 420

Query: 441 MLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVNP 500
           +L+CCN G+DMSI VIL  L   YT+EW  TSE  +I+K+ +RKHLTK+ISHL GRNVNP
Sbjct: 421 ILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNP 480

Query: 501 SRATLNSVNSFLM 513
           SRATLNSVN FLM
Sbjct: 481 SRATLNSVNDFLM 493

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/497 (56%), Positives = 356/497 (71%), Gaps = 14/497 (2%)

Query: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79
           MD  +  SL QINKDIRKENKS+RNRLQSILLDNKFL D V+P FP +P+IPNERCGLWY
Sbjct: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60

Query: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139
             P  FKQTSYFKSTDGH NQWDFSTRRLNFHL  T+R + GIIIVDSTRRGKKIPDALS
Sbjct: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120

Query: 140 KTVPIWCAVLNTLML--QETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLN 197
           KT+PIWCAVLN +ML  Q    ++ I  VL+ PPET+ K+EYDMI R+IP+LV KL KL+
Sbjct: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180

Query: 198 IIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCT 257
           I+D  +L  L  GKLLRP WV+PGSSLL  S D FTGE+   ++W  P+  NIIPIILCT
Sbjct: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITG-DSWNVPQHANIIPIILCT 239

Query: 258 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMD 317
           +SY+AQDG DKR+GFTYVQGAADDHELWS GL   +FW+HI +  + +++++Q++ ++  
Sbjct: 240 ISYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVET 299

Query: 318 LAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVII 377
           L    ++ Q    ++  +++ F  ID +T ++ LGK+   + I K L++KL   +   II
Sbjct: 300 L----VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSII 355

Query: 378 FSNSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEK 437
            S +V +                 I+KLQSG KKSSK LR+    I G ++S   N    
Sbjct: 356 LSENVELDPVDNENLPIST----HIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNALN- 410

Query: 438 IKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTS-ELPDISKLIVRKHLTKLISHLKGR 496
            KP+LICCNTGTDMSIG++L++LC  Y+E W+L   E   + K+++RK LT+LISHL+GR
Sbjct: 411 -KPILICCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGR 469

Query: 497 NVNPSRATLNSVNSFLM 513
            +N SRATLNSVN++LM
Sbjct: 470 TINTSRATLNSVNNYLM 486

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/494 (56%), Positives = 351/494 (71%), Gaps = 10/494 (2%)

Query: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79
           MD N   SL  INKDI+KE KS+RNRLQSILLD  FL   V+P FP YPL+PNERCGLWY
Sbjct: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65

Query: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139
           CNP  F QTSYFKSTDGH NQWDFS+RRLNFH++ TI  + GIIIVDSTRRGKK+PDALS
Sbjct: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125

Query: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199
           KT+PIWCAVLN LML E++      + LY+PPETV +SE+  IK +IPELV KL+ L +I
Sbjct: 126 KTIPIWCAVLNHLML-ESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVI 184

Query: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259
           + K+L++   GKLLRP W++PGSS+L  + D FTGEV   + W  P D +IIPIILCTVS
Sbjct: 185 NGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTS-DKW-IPVDNSIIPIILCTVS 242

Query: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319
           YQAQDG+DKR GFTYVQGAADDHELWS GL++ +FW++I+ LG+   S+++L  ++  L+
Sbjct: 243 YQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLS 302

Query: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379
              LR  C +  +    + F  ID +T E+SLG V   L  N  L  +++  +  VI+ S
Sbjct: 303 ---LRG-CDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLS 358

Query: 380 NSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439
            SV                FISI+KLQSG K SS+ L++   +I   I+    + D++ K
Sbjct: 359 QSVNFPQKVAEMENASE--FISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRK 416

Query: 440 PMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVN 499
           P+LICCN+GTDMSIG++L +LC  Y  +W L +    +SK++V+KHL KLISHLKGRNVN
Sbjct: 417 PVLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPT-SVSKIVVKKHLAKLISHLKGRNVN 475

Query: 500 PSRATLNSVNSFLM 513
           P RATLNSVNS+LM
Sbjct: 476 PPRATLNSVNSYLM 489

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/504 (54%), Positives = 346/504 (68%), Gaps = 37/504 (7%)

Query: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79
           MD     SL+ I K+I+KE KS+RNRLQSI+ D++FL   VIP FP YPL+PNERCGLWY
Sbjct: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85

Query: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139
           CNP SF Q SYFKSTDGH+NQWDFSTRRLNFHLL +I  + GI+I+DSTRRGKKIPDALS
Sbjct: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145

Query: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199
           KT+PIWCAV+NTL+L+ + ++   ++VL+ PP TVP+SEYD IK +IP LV KL+ L I+
Sbjct: 146 KTIPIWCAVINTLILEASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIV 202

Query: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259
              +L + F GK+LRP+WV+PGSSL   S D FTG+    + WE PEDQ+ +P+ILCT S
Sbjct: 203 SGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTAS 262

Query: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYI---- 315
           YQ QDG+DKRYGFTYVQGAADDHELW+ GL  +MFW +  +LGD + S+ +L +Y+    
Sbjct: 263 YQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQK 322

Query: 316 ------MDLAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLK 369
                    A+    NQC+            ++D IT E+ LG V  GL +N+ L  +L 
Sbjct: 323 REATERTKEASGNDLNQCF------------SVDAITKELHLGTVVDGLELNEKLLSQLD 370

Query: 370 SEYGKVIIFSNSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQS 429
           S Y   ++ S SV +A            P   I+ L SG+KKSSK LRS    I   IQ+
Sbjct: 371 SRYALTVVLSESVKIA-------SIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQA 423

Query: 430 LFTNRDEKIKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKL 489
              +      P+LICCNTG DMS+GV+L+ LC  Y E+W + S     +K I+RKHLT+L
Sbjct: 424 SLNSP----LPILICCNTGKDMSVGVLLATLCQNYDEDWCIGSP-NSFNKTIIRKHLTRL 478

Query: 490 ISHLKGRNVNPSRATLNSVNSFLM 513
           ISHLKGRNVNPSRATLNSVN++LM
Sbjct: 479 ISHLKGRNVNPSRATLNSVNAYLM 502

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/498 (53%), Positives = 347/498 (69%), Gaps = 30/498 (6%)

Query: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79
           MD ++  SL+QIN+DI+KE  S+RNR+QSIL DN F+  RVIP FP+YPLIPNERCGLWY
Sbjct: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60

Query: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139
           C+P  F QTSYFKSTDGH NQWDFSTRRLN HLL  +++  GIIIVDSTRRGK +PDALS
Sbjct: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120

Query: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199
           KT+PIWCAVLN+LM  +        +VL+ PP+ V +SE+D IK +IP LV +L+KL+I+
Sbjct: 121 KTIPIWCAVLNSLMQPDKS------EVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDIL 174

Query: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259
           D++ L   F GK+LRP WV+PGS +L  S D FTGE+ E + WE   ++ IIPIILCT S
Sbjct: 175 DAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQ-WEPGPNEQIIPIILCTAS 233

Query: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319
           Y+AQDG+DKR+GFTYVQGAADDHELWS GLD  + W +  Y  D   +D +L  ++  L 
Sbjct: 234 YRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLI 293

Query: 320 --AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVII 377
             A    ++ ++ D          +D IT E+SLGK+     I  N+ ++L S++  VII
Sbjct: 294 ELAETTDHRNHLAD-------IVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVII 346

Query: 378 FSNSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRD-E 436
            S SVT++             FI  Y LQSG K+SSK LR+    I   I S   N+D  
Sbjct: 347 LSQSVTLSKPFD---------FIKTYNLQSGSKRSSKDLRAALIEI-DHIVSAHLNKDVV 396

Query: 437 KIKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPD-ISKLIVRKHLTKLISHLKG 495
           K KP+++CCN+GTD+S+GVIL ILC  Y+++W+L    PD ++K ++R+HL ++I+ +K 
Sbjct: 397 KRKPIMVCCNSGTDISVGVILMILCKYYSQDWLLGK--PDSVNKFVIRRHLVQIINKIKR 454

Query: 496 RNVNPSRATLNSVNSFLM 513
           RNVNPSRATLNS+NSFLM
Sbjct: 455 RNVNPSRATLNSINSFLM 472

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/490 (55%), Positives = 346/490 (70%), Gaps = 12/490 (2%)

Query: 27  SLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYCNPSSFK 86
           SLS I KDI+ E +S++NRLQSI+LDN FL++ V+P FP+YP+IPNERCGLWYC+P  F+
Sbjct: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62

Query: 87  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 146
           QTSYFKSTDGH+NQWDFSTRRLNFHLL  +  + GIIIVDSTRRGKKIPDALSKT+PIWC
Sbjct: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122

Query: 147 AVLNTLMLQE-TEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLN 205
           AVLN L+L+  + + +  +KVL++PP TV  SEY  I  KI ELV KL+ L ++  K+L 
Sbjct: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182

Query: 206 ELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSYQAQDG 265
            +  GKL+RP WV+PGSSLL   VD FTGE    E W  PE++NIIPIILCTVSYQAQDG
Sbjct: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGE-PTGERWSVPENENIIPIILCTVSYQAQDG 241

Query: 266 MDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLRN 325
           +DKR GF YVQGAADDHELWS GL+   FW +I+YL D   +D  L +++  L   +   
Sbjct: 242 VDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHE 301

Query: 326 QCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTVA 385
           +   +   S+ ++F +++++T EISLGK+     I+  L  +L  ++  VII S ++ + 
Sbjct: 302 K---KASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEIT 358

Query: 386 XXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDE-KIKPMLIC 444
                         I ++KLQSG KKSSK+LR   P I   I   F +      KP+LIC
Sbjct: 359 KLEEATTK-----IIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILIC 413

Query: 445 CNTGTDMSIGVILSILCTKYTEEWML-TSELPDISKLIVRKHLTKLISHLKGRNVNPSRA 503
           CN+G DMS+ VIL+IL  KY+E W L TS+   ISK ++RKHL KLIS L+GRNVNPSRA
Sbjct: 414 CNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRA 473

Query: 504 TLNSVNSFLM 513
           TLNS+NS+LM
Sbjct: 474 TLNSINSYLM 483

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  505 bits (1301), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 250/495 (50%), Positives = 347/495 (70%), Gaps = 22/495 (4%)

Query: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79
           MD     +L+ +NK+I+KENK++RNRLQSIL D++FL+++V+ +FP+YPLIPNERCGLWY
Sbjct: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86

Query: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139
           C+P  + QTSYFKSTDGH NQWDFS RRLN HLL TI    GI+IVDSTRRGK++PDALS
Sbjct: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146

Query: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199
           KTVPIWCAVLN++ML+  +     ++VL+ PP TV  SE++ IK +IP LVA+ ++L + 
Sbjct: 147 KTVPIWCAVLNSIMLEGRQSE---EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLF 203

Query: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259
            S +L ++  GK+LRPIWV+PG+SLL+   D FTG++     WE  +++N +P++LCTVS
Sbjct: 204 TSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVT-PTWEA-QNENFMPVVLCTVS 261

Query: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319
           YQ QDG+DKR+GFTYVQGAADDHELW+ GL + +FW HIE   D + SD +L  Y+ +L 
Sbjct: 262 YQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLV 321

Query: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379
            +   N   +     LD++  N +++T E+ LG+V+  + ++KNL  +LK +Y  V++ S
Sbjct: 322 TSGDANN-KLTKSLRLDDML-NANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLS 379

Query: 380 NSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439
            S++V               I I+KLQSG KKSS+ALR+   +I   I++   N      
Sbjct: 380 TSISVYEEAEN---------IRIFKLQSGSKKSSRALRAALTQICPLIEANLQNS----L 426

Query: 440 PMLICCNTGTDMSIGVILSILCTKY-TEEWMLTSELPDISKLIVRKHLTKLISHLKGRNV 498
           P+LICCN G DMS+ V+LS+LC  +  E W L  + P + K I++KHL K+I+ L GRN+
Sbjct: 427 PVLICCNNGKDMSVCVVLSVLCRNFNVESWQL-EQRPSVHKSIIKKHLAKMITKLDGRNL 485

Query: 499 NPSRATLNSVNSFLM 513
           NP R +LNSVN +LM
Sbjct: 486 NPPRVSLNSVNDYLM 500

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  503 bits (1295), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 254/494 (51%), Positives = 337/494 (68%), Gaps = 17/494 (3%)

Query: 21  DENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYC 80
           DE+   +L QI K+IR++  S+RNRLQS+  D+KF+ + V+P+FP+YPL+PNERCGLWYC
Sbjct: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62

Query: 81  NPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSK 140
           NP  ++QT YFKSTDGH NQWDFSTRRLNFH+L  + +  GIIIVDSTRRGKK+PDALSK
Sbjct: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122

Query: 141 TVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIID 200
           T+PIWCAVLN LML    K  +I   L+ PP TV K E+D I  K+P+LV KL+KLNII 
Sbjct: 123 TIPIWCAVLNNLMLDYKGKEDSIPS-LFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIIS 181

Query: 201 SKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSY 260
            ++L  +F GK+LRP WV+PGS LLD S D FTGEV     W++  +QN IP+ILCT SY
Sbjct: 182 GEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLG-NVWQS--EQNSIPVILCTASY 238

Query: 261 QAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA- 319
           Q QDG DK +GFTYVQGAADDHELW+ GL+  +FW +IE+LGD   S+ +L D++  +  
Sbjct: 239 QCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGR 298

Query: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379
             KL  Q   Q        F  +D+IT  + LG V+ G+ + +N++++LKS+Y   II S
Sbjct: 299 TEKLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICS 358

Query: 380 NSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439
            SVT                I +Y + +  KKSS+ LR     I G I+   T++     
Sbjct: 359 QSVTAKADCNCER-------IKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQ----L 407

Query: 440 PMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVN 499
           P+LICCNTG D+SIG++L+ LC  Y  +W L  E   ++K IV+KHL ++I+ L G N+N
Sbjct: 408 PILICCNTGKDISIGIMLTALCQHYDLQWHL-EEQETVNKTIVKKHLARIITKLSGININ 466

Query: 500 PSRATLNSVNSFLM 513
           PSR+TL +VN+FL+
Sbjct: 467 PSRSTLKNVNAFLL 480

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 249/484 (51%), Positives = 340/484 (70%), Gaps = 22/484 (4%)

Query: 31  INKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYCNPSSFKQTSY 90
           +N++I+KE +S+RNRLQSI+ D+KFL ++V  +FP YP+IPNERCG+WYC+P  + QTSY
Sbjct: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71

Query: 91  FKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWCAVLN 150
           FKSTDGH NQWDFS RRLNFHLL  +  + GI++VDSTRRGK++PDALSKTVPIWCAVLN
Sbjct: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131

Query: 151 TLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLNELFMG 210
           +L+L   E      +VL+ PP+TV + E++ IK +IP+LVAK +K+NI+    ++ LF G
Sbjct: 132 SLLL---EYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188

Query: 211 KLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSYQAQDGMDKRY 270
           K+LRP+WV PG+SLL    D FTGEV   + W T E +N IP++LCTVSYQ QDG+DKR+
Sbjct: 189 KILRPLWVFPGASLLSSQRDPFTGEVLS-QKWHTAELENFIPVVLCTVSYQCQDGVDKRH 247

Query: 271 GFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLRNQCYIQ 330
           GFTYVQGAADDHELW+ GL + +FW HI  L + + SD +L  ++ D    +  N    +
Sbjct: 248 GFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSA--E 305

Query: 331 DKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTVAXXXXX 390
           +  SLD++    D +T E+ LGK+SS + + ++L ++L+ +Y  VII SN+VT++     
Sbjct: 306 NGLSLDQILYT-DILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSEDEAA 364

Query: 391 XXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIKPMLICCNTGTD 450
                    I I+KLQS  KKSSKALR+   +I    ++   N      PML+CCNTG D
Sbjct: 365 ---------IKIFKLQSECKKSSKALRTELIKICPLAEAYLPNS----LPMLVCCNTGKD 411

Query: 451 MSIGVILSILCTKY-TEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVNPSRATLNSVN 509
           MS+ V L+ILC  Y    W L  +   I K+ ++KHL+K+I+ L+GRNVNP RA+LNSVN
Sbjct: 412 MSVCVSLAILCRNYNVGSWDLNVQ-QSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVN 470

Query: 510 SFLM 513
           ++LM
Sbjct: 471 AYLM 474

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  492 bits (1267), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 259/502 (51%), Positives = 340/502 (67%), Gaps = 21/502 (4%)

Query: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79
           MD+     + +I+K++RKE+KS++NRLQSI+ DN FL+++V P F  YP++PNERCGLWY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWY 59

Query: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139
           C+P  +  TSYFKSTDGH+NQWDFSTRRLNFHLL  + +N G++I+DSTRRGKKIPDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 140 KTVPIWCAVLNTLMLQETEKNVAI-DKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNI 198
           KTVPIWCAVLN LML+   K     +++L++PP TVP+SE+D +  K+PELV KL+KL+I
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDI 179

Query: 199 IDSKKLN-----ELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPI 253
           ID KKL      E    KLLRPIWV+PGSSLL    D F+GEV E   WE P   NIIP+
Sbjct: 180 IDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPP--SNIIPV 237

Query: 254 ILCTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHD 313
           ILCTVSYQ QDG DKRYGFTYVQGAADDHELW+  L   +FW +I+ LGD S SD +L D
Sbjct: 238 ILCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKD 297

Query: 314 -YIMDLAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEY 372
            Y   +  AK++N   I   G + ++   ID IT  + LGK++S   I     + L  +Y
Sbjct: 298 SYNAVILRAKVQNSLDIS--GDISKML-EIDTITARLHLGKITSQFRITPKTVKYLNQKY 354

Query: 373 GKVIIFSNSVTVAXXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFT 432
             V++   +++V               I I+ L SG KKSS+ LRS   +I+  I+   +
Sbjct: 355 SAVVLCHEAISVTEITELPRS------IHIFPLPSGSKKSSRELRSHLIKINALIEEQLS 408

Query: 433 NRDEKIK-PMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLIS 491
             D     P+LI C++G D+S+ ++L  LC  Y  +W L  +   ++K I++KHL K+I 
Sbjct: 409 RPDTAANLPILIACDSGKDISVSILLVALCKYYNLDWELQPQ-DSVNKTIIKKHLAKIIE 467

Query: 492 HLKGRNVNPSRATLNSVNSFLM 513
            L+GRNVNPSRA+LNSVNSFLM
Sbjct: 468 SLQGRNVNPSRASLNSVNSFLM 489

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  370 bits (950), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 195/428 (45%), Positives = 272/428 (63%), Gaps = 22/428 (5%)

Query: 86  KQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIW 145
           + T YFKSTDGHVN WDFS RRLNFHLL  + +  G IIVDSTRRGKKIPDALSKT+PIW
Sbjct: 3   ETTCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIW 62

Query: 146 CAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLN 205
           CAVLNTL+L+ TE +    +VL+ PP TV + EY+ I+ K+PELV KL++++ I   +L 
Sbjct: 63  CAVLNTLILEHTEGS---GEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELC 119

Query: 206 ELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSYQAQDG 265
            L  G+LLRP WV+PG+++L  + D FTGE  + E W+ P    +IP+ILCT S Q QDG
Sbjct: 120 SLLGGRLLRPFWVYPGAAMLGTTRDLFTGESLQ-EPWQPPP--GVIPLILCTASRQCQDG 176

Query: 266 MDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLRN 325
           +DK  G+ YVQGAADDHELW+ GL  ++FWA+++ L D S  +  L  ++  +   +L  
Sbjct: 177 VDKSQGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERI--VELHK 234

Query: 326 QCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTVA 385
             + +     +      D +T  + LG V+    I+    + L+ +Y  V++  +S+ ++
Sbjct: 235 STHTEAVAH-ELPCRETDVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELS 292

Query: 386 XXXXXXXXXXXXPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIKPMLICC 445
                       P I IY L SG KKSS+ALR        EI  L +    +  P+LICC
Sbjct: 293 -------AAAPHPRIRIYPLNSGCKKSSRALRPALI----EIIPLISTALCEALPVLICC 341

Query: 446 NTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVNPSRATL 505
           ++G+D+S+G++L+ LC  Y  EW    +  D++K I++KHL KL S + GR +NPSR TL
Sbjct: 342 SSGSDISVGIVLAALCKNYDLEWRHEDQ-KDMTKTIIKKHLIKLTSKIHGRIINPSRTTL 400

Query: 506 NSVNSFLM 513
           NSVN+FLM
Sbjct: 401 NSVNAFLM 408

>ZYRO0A01100g Chr1 (79473..80402) [930 bp, 309 aa] {ON} similar to
           uniprot|P53942 Saccharomyces cerevisiae YNL072W RNH201
           Ribonuclease H2 catalytic subunit removes RNA primers
           during Okazaki fragment synthesis cooperates with Rad27p
           nuclease
          Length = 309

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 12/94 (12%)

Query: 71  PNERCGLWYCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRR 130
           P E   L    P+  K T++ ++T   +  WD    R ++   ET+ DNKGI I    + 
Sbjct: 224 PPEAGPLGSGYPADAKTTAWLRNTMKPLMGWDPHLVRFSWQTSETLLDNKGIQIEWEEK- 282

Query: 131 GKKIPDALSKTVPIWCAVLNTLMLQETEKNVAID 164
                   SK+ P+W       MLQ   K + +D
Sbjct: 283 --------SKSKPVWAG---KSMLQAERKPLTLD 305

>TPHA0H01920 Chr8 (450069..453008) [2940 bp, 979 aa] {ON} Anc_6.266
           YMR185W
          Length = 979

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (48%), Gaps = 11/109 (10%)

Query: 156 ETEKNVAIDKVLYLPPETVPKSEYDMIKRKI-PELVAKLQKLNIIDSKKLNELFMGKLLR 214
           ETEK V I +VL   PE V  S+ D+   K+  EL+AKL+  N   ++ L  ++     +
Sbjct: 2   ETEKKVNIKEVLLKEPEFVRGSDLDLFFEKLNDELIAKLKAAN--KNQDLPNIY-----Q 54

Query: 215 PIWVHPGSSLLDHSVDYFTGEVQ---EYEAWETPEDQNIIPIILCTVSY 260
            +  H     +   +DYFT   Q     +   + E ++I+PI L  + +
Sbjct: 55  LLGFHNNEEFVTKIIDYFTQLHQITLSTQKQLSEEGKDILPISLHDIKF 103

>TPHA0F02640 Chr6 complement(590052..590879) [828 bp, 275 aa] {ON} 
          Length = 275

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 409 DKKSSKALRSTFPRIHGEIQSLFTNRDEKIKPMLICCNTGTDMSIGVILSILC 461
           D+ SSK L  TF  +  ++  LF +   K K +LICC  G  + +   + +LC
Sbjct: 78  DRSSSKKLTDTFGMV-AKLNVLFADAFLKHKKILICCLNGPAIGLSAAMVLLC 129

>TPHA0J03090 Chr10 (675915..677609) [1695 bp, 564 aa] {ON} Anc_5.176
           YGR171C
          Length = 564

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 14/122 (11%)

Query: 182 IKRKIPELVAKLQKLNIIDSKKLNELFMGKLLRPIW--VHPGSSLLDHSVDYFTGEVQE- 238
           I R+I  +  KL KL  I   KL +     LLR IW  +   ++L+ HS  +     Q+ 
Sbjct: 432 IVRQIDSIFEKLNKLPQIMDDKLQKYDTSSLLREIWGILFDANTLMQHSAPWKMTPTQQD 491

Query: 239 ---YEAWETPEDQNII--PII--LCTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDS 291
              +   ET    +I+  PII   C       +    R    Y++ A+D     S+GL+S
Sbjct: 492 CIIFICTETTRILSILCQPIIHSFCNKFLDKLEISKDRRSIDYIKFASDK----SYGLNS 547

Query: 292 NM 293
           N+
Sbjct: 548 NL 549

>CAGL0L06754g Chr12 (761178..762494) [1317 bp, 438 aa] {ON} highly
           similar to uniprot|P12385 Saccharomyces cerevisiae
           YBR143c SUP45 translational release factor
          Length = 438

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 7/89 (7%)

Query: 296 AHIEYLGDASYSDDQLHDYIMDLAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVS 355
           A +  + D SY  +   +  ++L+A  L N  ++Q+K  LDE F  I + T +   G   
Sbjct: 245 AKVVQIVDISYGGENGFNQAIELSADALANVKFVQEKKLLDEYFDEISQDTGKFCYG--- 301

Query: 356 SGLTINKNLKQKLKSEYGKVIIFSNSVTV 384
               I+  LK        K+I+F N  T+
Sbjct: 302 ----IDDTLKALDLGAVEKLIVFENLETI 326

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,287,518
Number of extensions: 2493005
Number of successful extensions: 7920
Number of sequences better than 10.0: 47
Number of HSP's gapped: 8081
Number of HSP's successfully gapped: 47
Length of query: 513
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 399
Effective length of database: 40,409,475
Effective search space: 16123380525
Effective search space used: 16123380525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)