Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR282C (AEP2)8.847ON58058029530.0
Smik_13.4958.847ON57658022500.0
Skud_13.4548.847ON58058022000.0
Suva_13.4718.847ON58158320900.0
Kpol_1068.38.847ON5664585084e-56
ZYRO0G14322g8.847ON5504824925e-54
SAKL0D01298g8.847ON5514174891e-53
TDEL0B005108.847ON5504214732e-51
KLTH0C03718g8.847ON5514544443e-47
Kwal_27.102248.847ON5464624408e-47
TPHA0I002908.847ON5693864181e-43
NDAI0K003408.847ON6244453247e-31
KNAG0J002308.847ON4743673064e-29
KAFR0B039708.847ON4745063064e-29
Ecym_46188.847ON5273513032e-28
NCAS0C003708.847ON4954992994e-28
CAGL0M03069g8.847ON5484122774e-25
KLLA0D01408g8.847ON5183702764e-25
TBLA0B033108.847ON6134472661e-23
ABL119C8.847ON5373541295e-07
Skud_7.5725.88ON883172870.076
TBLA0F017903.408ON109771771.0
CAGL0J02244g7.147ON42982751.6
KLLA0C13101g7.37ON708204723.9
ZYRO0B03564g7.401ON1456186724.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR282C
         (580 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...  1142   0.0  
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   871   0.0  
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   852   0.0  
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   809   0.0  
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   200   4e-56
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   194   5e-54
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   192   1e-53
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   186   2e-51
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   175   3e-47
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   174   8e-47
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   165   1e-43
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   129   7e-31
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   122   4e-29
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   122   4e-29
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   121   2e-28
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   119   4e-28
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   111   4e-25
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   110   4e-25
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   107   1e-23
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    54   5e-07
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    38   0.076
TBLA0F01790 Chr6 complement(442568..445861) [3294 bp, 1097 aa] {...    34   1.0  
CAGL0J02244g Chr10 complement(220448..221737) [1290 bp, 429 aa] ...    33   1.6  
KLLA0C13101g Chr3 (1115573..1117699) [2127 bp, 708 aa] {ON} weak...    32   3.9  
ZYRO0B03564g Chr2 complement(292045..296415) [4371 bp, 1456 aa] ...    32   4.0  

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/580 (97%), Positives = 565/580 (97%)

Query: 1   MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIND 60
           MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIND
Sbjct: 1   MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIND 60

Query: 61  ILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKSI 120
           ILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKSI
Sbjct: 61  ILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKSI 120

Query: 121 SYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEK 180
           SYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEK
Sbjct: 121 SYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEK 180

Query: 181 VDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNA 240
           VDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNA
Sbjct: 181 VDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNA 240

Query: 241 DISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTL 300
           DISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTL
Sbjct: 241 DISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTL 300

Query: 301 LKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR 360
           LKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR
Sbjct: 301 LKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR 360

Query: 361 GCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTP 420
           GCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTP
Sbjct: 361 GCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTP 420

Query: 421 ANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPG 480
           ANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPG
Sbjct: 421 ANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPG 480

Query: 481 IERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANR 540
           IERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANR
Sbjct: 481 IERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANR 540

Query: 541 MFLRSXXXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
           MFLRS               VRLDSFDDDEDDGMIIGSLW
Sbjct: 541 MFLRSKKMKNKIENKKEREKVRLDSFDDDEDDGMIIGSLW 580

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/580 (73%), Positives = 476/580 (82%), Gaps = 4/580 (0%)

Query: 1   MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIND 60
           MW+N+L K PS S+L  Y KR CT S KSL+E  VLPN  I H  + RRT V     IND
Sbjct: 1   MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCV----TIND 56

Query: 61  ILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKSI 120
              +KS+STH++CA     + N    YDKFE KGIPIDV+TL+RIISSSG  E +FSK I
Sbjct: 57  TSTRKSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGI 116

Query: 121 SYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEK 180
           SYLF KTVD  P++ LSL +LSFLL+KLY+ RFQIR ICRDI  KYSEFWFK+FSLYAEK
Sbjct: 117 SYLFTKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEK 176

Query: 181 VDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNA 240
           VDAKRN +NLRNT LDACEIFD NL+I+NFIELGQLGKAQKIL+FI+DRNPDILLSP NA
Sbjct: 177 VDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNA 236

Query: 241 DISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTL 300
           DI T+VHFL+LRCGALA YWKIPDNS Q Q  LRK+VRLGAKNTSIRLSSTYK MDHQTL
Sbjct: 237 DIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTL 296

Query: 301 LKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR 360
           LKIADL L EK+ LNSEDLLSTLIQSFGHLGQTQILERCIEHIW I+ QEFPSHV IK R
Sbjct: 297 LKIADLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPR 356

Query: 361 GCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTP 420
           GCYPSSKIL+SILVSF++ND+DLHRGLSILDSFIKHYP+VKLDALFWRRLFQLS+FAWTP
Sbjct: 357 GCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTP 416

Query: 421 ANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPG 480
           A DKKATSV+RCWHLMKQW+ SK L  SVDYETLRQLYDIMKKTGNFPLGIDVL+SFK G
Sbjct: 417 AKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSG 476

Query: 481 IERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANR 540
           IER R  N+ K+N ++IKYQK IIK+LV+RGR SAVREFI+ +GFDR +TK+LNIFC NR
Sbjct: 477 IERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTNR 536

Query: 541 MFLRSXXXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
           + LRS               +    FDDDEDDGMIIGSLW
Sbjct: 537 LLLRSKKNKSKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/580 (71%), Positives = 478/580 (82%)

Query: 1   MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIND 60
           MW+N+LVK+   +V   Y KRLC  S+ S+++F +LPNSTI HS   R+TYV  R ++ +
Sbjct: 1   MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVRN 60

Query: 61  ILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKSI 120
           I+I+K YSTH +   ++S   N   AYDKFE KGIPID HTL+RII+SSG +E EFSKS+
Sbjct: 61  IVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKSV 120

Query: 121 SYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEK 180
           +YLF K V+   +++L L DLS LL+KLY+QRF+IR IC++IN KYSEFWFKLFSLYAEK
Sbjct: 121 NYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEK 180

Query: 181 VDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNA 240
           VD +R+QVNLRNT LD+CEIFD NL+IKNFIELGQL KAQKILSFILDRNPDILLSP+NA
Sbjct: 181 VDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNA 240

Query: 241 DISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTL 300
           DI TIVHFLQLRCGAL  YWKIPDNS +KQ  LR+MVRLGAKNTSIRLSSTYKAMDHQTL
Sbjct: 241 DIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTL 300

Query: 301 LKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR 360
           LKIADL LQ+K+ LNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS QEFPSHV IK R
Sbjct: 301 LKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPR 360

Query: 361 GCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTP 420
           GCYPSSKIL+SILVSF+ ND DLHRGLSILDSFIKHYP+VKLDALFWRRL QLSHFAWTP
Sbjct: 361 GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTP 420

Query: 421 ANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPG 480
            NDK+A S+V+CWHLMK WY SK L PSVDYETLRQLY++MKKTGNF LGIDVL+SFK G
Sbjct: 421 VNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSG 480

Query: 481 IERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANR 540
           IE+ R  N  K+  I+IKYQKCIIK+LVNRG+ SA R+FI  +GF+R+  KDLNIFC+NR
Sbjct: 481 IEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNR 540

Query: 541 MFLRSXXXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
           +F RS               +   ++DDDEDDGMIIGSLW
Sbjct: 541 IFSRSKKIKNDIENKKKRDGLAPGNYDDDEDDGMIIGSLW 580

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/583 (68%), Positives = 473/583 (81%), Gaps = 5/583 (0%)

Query: 1   MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIN- 59
           MW+N+L K+PS S+L  YT+RLC  S +SL+E  +LPN  I ++V+ RRT V  R ++  
Sbjct: 1   MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC 60

Query: 60  DILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKS 119
           DI  +K YSTH + AID+  + N    +D F+ K IPID+ TL+RII SS M+E +FSKS
Sbjct: 61  DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS 120

Query: 120 ISYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAE 179
           ++YLF K ++ E ++ LSLEDLSFLL+ LY+QRF+I++IC+DIN +YSEFWFKLFSLYAE
Sbjct: 121 MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE 180

Query: 180 KVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKN 239
           KVD KRNQ+NLRNT LD+ EIFD NL+IKNFIELGQLGKAQK+LSFILDRN DILLSPKN
Sbjct: 181 KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN 240

Query: 240 ADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQT 299
           ADI TI+HFLQLRCGALA YWK+PDNSEQK  + RKMVRLGAKNTSIR++S+YKAMDHQT
Sbjct: 241 ADIGTIIHFLQLRCGALAAYWKMPDNSEQK--YSRKMVRLGAKNTSIRITSSYKAMDHQT 298

Query: 300 LLKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVI-- 357
           LLKIADL LQ+++LLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS QEFPSH  I  
Sbjct: 299 LLKIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKP 358

Query: 358 KHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFA 417
           K RGC PSSKIL+SILVSF+ ND+DLHRGLSILDSFIKHYP+VK+D LFWRRLFQLSHFA
Sbjct: 359 KTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFA 418

Query: 418 WTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSF 477
           WTP +DK+ATS+VRCWHLMKQW+ SK    SVDYETLRQLYD+ KKTGN+ LGIDVL++F
Sbjct: 419 WTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNF 478

Query: 478 KPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFC 537
           KPGI RT A    K+N I+IK+QK IIK+LVNRG+ SA REFI+ + FD    K+LN+FC
Sbjct: 479 KPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFC 538

Query: 538 ANRMFLRSXXXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
            NR+ LRS                   +FDDD+DDGM+IGSLW
Sbjct: 539 TNRILLRSKKLKNKTENRKERNRSGQGNFDDDDDDGMVIGSLW 581

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  200 bits (508), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 229/458 (50%), Gaps = 24/458 (5%)

Query: 136 LSLEDLSFLLSKLY-TQRFQIRRICRDINA-KYSEFWFKLFSLYAEKVDAKRNQVNLRNT 193
           L+  +LS  ++++Y +    I+R+ ++ ++  Y+E  +++F LY   +  +   +     
Sbjct: 120 LTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGII----- 174

Query: 194 KLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRC 253
           KL+A  + D NL I  FI+  QL KAQ +L +I+D    I    K  D  T+V+FL+LRC
Sbjct: 175 KLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSI---EKITDHDTMVNFLRLRC 231

Query: 254 GALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLL-KIADLALQEK- 311
           G L  +W +P  S       +K  RL + + + R  S+YK+    T+L ++ ++ L +K 
Sbjct: 232 GGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKV 291

Query: 312 -KLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR--GCYPSSKI 368
            K  +S  L ST++ S  H  Q Q+++  I+  W IS    P  + IK +     PS++I
Sbjct: 292 WKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEI 351

Query: 369 LVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATS 428
           L++I+ S+ + D ++   + ILD FI+ YPD+ LD +FWRRL Q  +  W P  D++ T 
Sbjct: 352 LIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTF 411

Query: 429 VVRCWHLMKQWYASKRLRPSV---DYETLRQLYDIMKKTGNFPLGIDVLRS-FKPGIERT 484
              CW++MK W  +   +  V   D++   + Y + K+T N  +  +++ +   P +   
Sbjct: 412 GYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEK 471

Query: 485 RAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANR--MF 542
                    N++ KYQ   +  L+ R +F     FI+ +  DR     L      R  + 
Sbjct: 472 NVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLM 531

Query: 543 LRSXXXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
           LR                 R D +D+ E++ MIIG LW
Sbjct: 532 LRKLSTRDKKSQSQKK---RQDRYDEMEEEDMIIGRLW 566

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  194 bits (492), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 142/482 (29%), Positives = 234/482 (48%), Gaps = 58/482 (12%)

Query: 105 IISSSGMDESEFSKSISYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINA 164
           + ++ G+ +SE+S  I+ L            LS E+L   LS +              + 
Sbjct: 121 LFTTGGLTKSEYSLFINKL------------LSEEELDVKLSNVIP------------DT 156

Query: 165 KYSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILS 224
            ++E  +KL+  Y + +  + N        L   +++D NL +K FI   QL KA  +L 
Sbjct: 157 PHTELIYKLYEFYCDHIVDQHN--------LTPLQLYDLNLFLKTFIAEAQLSKAHNVLD 208

Query: 225 FILDRNP--DILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAK 282
           FIL R P  D+L    N D+  ++ FL+L+CGAL+ +WKI   S++        + LG K
Sbjct: 209 FILLRRPLNDLL---ANTDVEILIQFLRLKCGALSKFWKIQPASQRNS----TAITLGEK 261

Query: 283 NTSIRLSSTYKAMDHQTLLKIADLALQEKKLLN--SEDLLSTLIQSFGHLGQTQILERCI 340
            +   L+ +YK  + + LL+I +  L E    N  S  L + +I S G+LGQT ++E+ +
Sbjct: 262 ASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYV 321

Query: 341 EHIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDV 400
              W  S  E             P+S +LV++L S+   + ++ +GL +LD FI+ YP+V
Sbjct: 322 NRTWSPSKDEGVK--------TNPNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEV 373

Query: 401 KLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDI 460
           +LD LFWRRL QLS   W    D+KAT    CW +MKQW+A ++ +   DY  +++LY I
Sbjct: 374 ELDPLFWRRLLQLSSLLWDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPI 433

Query: 461 MKKTGNFPLGIDVL-RSFKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREF 519
             +T N    ++V+ +SF     +          +++ KYQ+ I+K +  +G +    EF
Sbjct: 434 FVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEF 493

Query: 520 IDSYGFDRKMTKDLNIFCANRMFLRSXXXXXXXXXXXXXXXVRL-DSFDDDEDDGMIIGS 578
              + F        N F     F++                  L + +D+ E+D M++G 
Sbjct: 494 CQEWSFS-----STNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEMEEDDMLLGR 548

Query: 579 LW 580
           LW
Sbjct: 549 LW 550

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  192 bits (489), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/417 (29%), Positives = 213/417 (51%), Gaps = 27/417 (6%)

Query: 166 YSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSF 225
           ++E  FKL+ +Y + V        + N  L   +++D N  IK F    QL KAQ++L F
Sbjct: 160 HTEVLFKLYEIYRDSV--------VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF 211

Query: 226 ILDRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTS 285
           +L+    I   P+     T++++L+L+CGA+   W IP +  +    L K   LG+++  
Sbjct: 212 VLENYGSIPRDPQ-----TLINYLELKCGAMPRNWSIPLSRPE----LGKT--LGSQSFM 260

Query: 286 IRLSSTYKAMDHQTLLKIADLALQEKKLLNSE--DLLSTLIQSFGHLGQTQILERCIEHI 343
             L+ +YK ++ + LL + D  ++++        DL + +I S G++GQ  +LER I+H 
Sbjct: 261 SNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKHT 320

Query: 344 WQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLD 403
           W +S     S  V   +  YP+S +L+SI VS Y    +LH+ L I+DSF+  +P ++L+
Sbjct: 321 WGVSVSSNTSTEVEVPKNLYPTSNLLISI-VSCYAMKGNLHQALQIIDSFLSKFPQIELE 379

Query: 404 ALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKK 463
            LFWRRLFQ S   W    D K      CW +MKQW+  ++    +D   L + Y ++K+
Sbjct: 380 PLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKR 439

Query: 464 TGNFPLGIDVLRSFKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSY 523
           T NF   + +      G+   R     +V ++I K+QK I+K++  RG +    ++I  +
Sbjct: 440 TNNFTEALRIHDEALAGLYMKRNLIDPEV-DVIKKFQKLILKKMAGRGYYHKPLKYISEW 498

Query: 524 GFDRKMTKDLNIFCANRMFLRSXXXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
             +++   ++  +       R                 ++ +FD +E+D M++G LW
Sbjct: 499 CLNKRNELEMREYFDRH---RKAYITRIEQRKQKQETAQV-TFDAEEEDDMLLGRLW 551

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  186 bits (473), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/421 (29%), Positives = 210/421 (49%), Gaps = 33/421 (7%)

Query: 166 YSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSF 225
           ++E  F L+ +Y   V      +      L   ++ D N  IK FI+  QL KAQ+ L F
Sbjct: 157 HTEIIFNLYQIYCTYV------IKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQF 210

Query: 226 ILDRNP--DILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKN 283
           ++D+    +IL S    D+ TI  FLQLRCGAL  +W++  NS +          LG  +
Sbjct: 211 LIDKQGLHNILQS---GDVETITQFLQLRCGALQKFWRVDSNSTKV---------LGEDS 258

Query: 284 TSIRLSSTYKAMDHQTLLKIADLALQEK--KLLNSEDLLSTLIQSFGHLGQTQILERCIE 341
              +   +Y  +  Q  L+I +  L++K  +L +S  + S ++ S  +LGQT+++++ I+
Sbjct: 259 KHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQ 318

Query: 342 HIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVK 401
             W IS      HV +K+    P  ++L++I+ ++   + D  +GL ILD F+K YP  +
Sbjct: 319 LKWGISE---DGHVAVKNEAV-PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374

Query: 402 LDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIM 461
           L+ LFWRRL QLS   W    DKKA     CW++MKQW+  K +  + D  TLR LY + 
Sbjct: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434

Query: 462 KKTGNFPLGIDVLRS-FKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFI 520
           K T N     +V+R+ F     +   + +    ++++ +QK  +K +  +GR++   + I
Sbjct: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLI 494

Query: 521 DSYGFDRKMTKDLNIFCANRMFLRSXXXX-XXXXXXXXXXXVRLDSFDDDEDDGMIIGSL 579
             +  D+     +N       F+R                  +   +D+ E++ M++G L
Sbjct: 495 KEWNVDK-----INQHYLLDYFMRHRRKYDLTRDKARAKQQQQQAQYDNMEEEDMLLGRL 549

Query: 580 W 580
           W
Sbjct: 550 W 550

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  175 bits (444), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 129/454 (28%), Positives = 213/454 (46%), Gaps = 40/454 (8%)

Query: 136 LSLEDLSFLLSKLYTQRFQIRRICRDI-NAKYSEFWFKLFSLYAEKVDAKRNQVNLRNTK 194
           LS+ + S  +  L +    + ++   + N   +E  F L+ LY + V             
Sbjct: 129 LSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTP---------GP 179

Query: 195 LDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRCG 254
           L   ++ D N  I+ FI   QL KAQ +L  IL  N + L      D +T  H+LQLRCG
Sbjct: 180 LSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQL----PCDSATATHYLQLRCG 235

Query: 255 ALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRL-SSTYKAMDHQTLLKIADLALQEKKL 313
           AL   WK+ D +      L +  RLGA+    +L S +YKA+DH+++L    L    K +
Sbjct: 236 ALPRNWKVLDEN------LGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSV 289

Query: 314 L---NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHRGCYPSSKILV 370
                S  L S ++ S G +GQ ++LE  +   W IS QE   + V       PSS++LV
Sbjct: 290 WFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEH--NQVTDASFTSPSSEVLV 347

Query: 371 SILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATSVV 430
           ++L S Y ++ ++   L ++D F+  YP ++LD +FWRRLFQ S   W+   D +     
Sbjct: 348 AVLTS-YASNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSR 406

Query: 431 RCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLR----SFKPGIERTRA 486
            CW +M++W+A++  +   D   L + + ++ +T N+   I+V+     SF      +R 
Sbjct: 407 GCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRH 466

Query: 487 ENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANRMFLRSX 546
           E       +  K+ K I+K + + G +    +FI  +  ++ +   L  +        S 
Sbjct: 467 EAV-----LFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSA 521

Query: 547 XXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
                              FDD+E+D M++G LW
Sbjct: 522 RKQRRTEAAQKAQ----KRFDDEEEDSMLLGRLW 551

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  174 bits (440), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 128/462 (27%), Positives = 222/462 (48%), Gaps = 52/462 (11%)

Query: 134 DVLSLEDLSFLLSKLYTQRFQIRRICRDI-NAKYSEFWFKLFSLYAEKVDAKRNQVNLRN 192
           ++L+  + S LL+ L T+R    ++   + + + +E  F L+  Y   + A         
Sbjct: 122 NLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAG-------- 173

Query: 193 TKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLR 252
             L+  ++ D N  ++ FIE  QLGKAQ +L  IL  N D L      D +T +H+LQLR
Sbjct: 174 -SLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQL----PCDTTTGIHYLQLR 228

Query: 253 CGALAPYWKIPDNSEQKQGFLRKMVRLGA-KNTSIRLSSTYKAMDHQTLLKIADLALQEK 311
           CGAL   WK+ D+       +    RLG+ +N S  +S TYKA+D  ++L+  ++   E 
Sbjct: 229 CGALPRNWKVFDSR------VGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDEN 282

Query: 312 KLL---NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHRGCYPSSKI 368
                  S  L + +I S G +GQ  +L+  I   W I+  E  + +  +     PS ++
Sbjct: 283 SEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGIT--ELGASLATEVNEVPPSPEV 340

Query: 369 LVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATS 428
           L++I  SF  +  ++  GL ++D+FI  Y ++ LD +FWRRLFQ ++  W    D +   
Sbjct: 341 LIAIFTSFA-SHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDL 399

Query: 429 VVRCWHLMKQWY--ASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRA 486
              CW +M +W+   SK+L+P  D   L + Y ++ +T N+   + V+    P +   + 
Sbjct: 400 SRGCWRVMTEWHEKGSKKLQP--DTTLLNERYFVLAQTNNYKEALTVISQSFPQLYE-KP 456

Query: 487 ENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNI--------FCA 538
             + K   I+ KY K ++K +   G +     FI  +  ++ +   L +        F  
Sbjct: 457 TLSSKEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTK 516

Query: 539 NRMFLRSXXXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
            +  LR                 + +++DD+E+D M++G LW
Sbjct: 517 RKERLREESRR------------KQNTYDDEEEDNMLLGRLW 546

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  165 bits (418), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 114/386 (29%), Positives = 197/386 (51%), Gaps = 27/386 (6%)

Query: 163 NAKYSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKI 222
           N K+SE  FKLF LY   + +          KL    + D NL I+ FI  G LG+A+ +
Sbjct: 153 NGKHSEMVFKLFQLYGNAIGS---------DKLSLLSLRDMNLFIEFFINEGHLGRAEIV 203

Query: 223 LSFILDRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQ---KQGFLRKM--- 276
           L+F+L++   IL      D+ T+ H+LQLRCGAL  YW   + S +   K  F  ++   
Sbjct: 204 LTFVLNKTRSIL---DLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKY 260

Query: 277 -VRLGAKNTSIRLSSTYKAMDHQTLLKIADLALQEKKLL--NSEDLLSTLIQSFGHLGQT 333
             RLG KN +++L++ YK +D   +LKIA+  + + K    +S  L +T++ S  + GQ 
Sbjct: 261 KTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQL 320

Query: 334 QILERCIEHIWQ--ISPQEFPSHV--VIKHRGCYP-SSKILVSILVSFYFNDHDLHRGLS 388
             +   I   W   IS  +  S V   I +    P  S+++ +IL S+ ++D  + R ++
Sbjct: 321 SNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAIN 380

Query: 389 ILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPS 448
           I+D  +  YP+++L+  FWRRL Q S   W    D+K + V  C+  +K+++  + +R +
Sbjct: 381 IIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRIN 440

Query: 449 VDYETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRA-ENAGKVNNIIIKYQKCIIKEL 507
            D   L++LY ++  T N  +  +V+  F P     R+ E       ++  +QK  I  +
Sbjct: 441 FDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGM 500

Query: 508 VNRGRFSAVREFIDSYGFDRKMTKDL 533
           + +  +     FI+ +  D +  ++L
Sbjct: 501 LGKKDYFTASNFIEKWSMDNQNKEEL 526

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  129 bits (324), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 111/445 (24%), Positives = 206/445 (46%), Gaps = 46/445 (10%)

Query: 168 EFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFIL 227
           E  F LF++  ++     NQ+N          ++D N  IK F+  GQL KAQ +L +I+
Sbjct: 194 EVIFSLFNICKDEYCNNTNQLN-------PLMVYDLNQFIKYFLREGQLKKAQLVLDYII 246

Query: 228 DRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIR 287
           DR   I    K+ D++T+ + L+L+ GA+   WK P    +   FL+  + L  K+ + +
Sbjct: 247 DRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWK-PLTDSESNTFLQYRLSLEDKSHNFK 305

Query: 288 LSSTYKAMDHQTLLKIADLALQEKK-LLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQI 346
               YK +D  +LLKI D+ L +K   LN   L  +++ S G L Q + +E  I+ IW +
Sbjct: 306 GFKNYKFLDGWSLLKIIDMVLTDKTHCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDV 363

Query: 347 SPQ---EFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKL- 402
            P    E  +H + K+    P +  L++IL S+      + R   +LD  I+ YP+    
Sbjct: 364 HPDDAVEERNHQLDKY-NLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKS 422

Query: 403 ---DALFWRRLFQLS-HFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSV-------DY 451
              D  FW ++ Q     A    N+   T++  C  +M++W+   + + ++       DY
Sbjct: 423 RLNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDY 482

Query: 452 ET--LRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRAENAGK-----VNNIIIKYQKCII 504
            +  +  L++IMK+  N  +G+  + +F   +++ +  +  K     + +++   QKCI 
Sbjct: 483 GSILINLLHNIMKERKNVDIGLKAIENF---VQKLKLGSVNKYYERNLTHVLYGLQKCIF 539

Query: 505 KELVNRGRFSAVREFIDSYGFDRK-----MTKDLNIFCANRMFLRSXXXXXXXXXXXXXX 559
           +++   G ++     ID+  + +      M ++  I     +  +               
Sbjct: 540 RKIAESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDRE 599

Query: 560 XVRLD----SFDDDEDDGMIIGSLW 580
               +     +D+ E++GMIIG LW
Sbjct: 600 QDEFEKLQQKYDEIEEEGMIIGKLW 624

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  122 bits (306), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 94/367 (25%), Positives = 167/367 (45%), Gaps = 47/367 (12%)

Query: 185 RNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADIST 244
           +  + L++ KL   ++ D NLM   FI   QL KAQ I+ F+L ++          D+  
Sbjct: 123 KGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-------DVFM 175

Query: 245 IVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIA 304
           I ++ +LRCG+          S  KQ    K                YK  D  T+ ++ 
Sbjct: 176 IKNYTKLRCGS----------SFGKQTLNNK---------------AYKVFDQNTVFQLI 210

Query: 305 DLALQEKKLL--NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPS-HVVIKH-- 359
                ++K    N+E     ++ S G+     ++E  I  +W+IS  +  + ++ I H  
Sbjct: 211 GKVEADRKFAFWNNE-----IVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQ 265

Query: 360 --RGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFA 417
                YPSSK+L +I+ S+  +D  + R + I++ F K YP + L+  FW  L      A
Sbjct: 266 QGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNC---A 322

Query: 418 WTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSF 477
                 K  +  + CW+LMK+W+  +          L  +   M++T N    +D+L+ +
Sbjct: 323 IKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYW 382

Query: 478 KPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFC 537
              +   R        +++IKYQK I+++LV++ +++    FID +  D    +DL  F 
Sbjct: 383 LGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFY 442

Query: 538 ANRMFLR 544
            +R+ +R
Sbjct: 443 ESRVDVR 449

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  122 bits (306), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 117/506 (23%), Positives = 205/506 (40%), Gaps = 76/506 (15%)

Query: 77  RSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKSISYLFAKTVDPEPKDVL 136
           R +  NN S    FE   I + + T K +       ++E  + I+ + A T+D       
Sbjct: 43  RQESYNNKSLCMPFEVPKIELRIKTPKEL-------DAEIQEIITSMHA-TID------- 87

Query: 137 SLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEKVDAKRNQVNLRNTKLD 196
            L   + L++   ++++ I+RI      +  E  F+LF  Y + + +        + +L 
Sbjct: 88  -LNRFARLINIALSEKYNIQRI----KERRPEIIFQLFETYVKLISS--------HEELT 134

Query: 197 ACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRCGAL 256
             ++ D N  I  F+E  QL KAQ ++ +++ ++P +L   +  D+ST  ++L+L CGA 
Sbjct: 135 ILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVL---EKYDVSTTRNYLKLNCGAC 191

Query: 257 APYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMD--HQTLLKIADLALQEKKLL 314
              W                             + YK  D  + TL K+   +L  K  +
Sbjct: 192 HELW----------------------------YTNYKIFDFNNTTLDKLVKYSLDNK--I 221

Query: 315 NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHRGCYPSSKILVSILV 374
              D+   +I S G+ G+ + LE  I   W IS         +      P S++L +I+ 
Sbjct: 222 GYWDV--EIIHSLGYSGRIRSLEDYILKKWGIS---LCDRAQVNTTNEAPESEVLEAIIN 276

Query: 375 SFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATSVVRCWH 434
            F++ D  + R + IL+ F+  YPD+ L   FW+         W    D+K   +V  W 
Sbjct: 277 GFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVDQKGVVIVEYWE 336

Query: 435 LMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRAENAGKVNN 494
            MK+WY     R   +   L+ +    KK  N  L  D+ ++                 N
Sbjct: 337 TMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFYFCATRMNDSELN 396

Query: 495 IIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANRMFLRSXXXXXXXXX 554
           +I +YQ  I+  L+ +  FS    FI+ + F  +  + L  +   R   +          
Sbjct: 397 VIKEYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQLMNYYHGRKEHKLKKMTRNENL 456

Query: 555 XXXXXXVRLDSFDDDEDDGMIIGSLW 580
                     ++DD  ++  IIG LW
Sbjct: 457 E--------KTYDDMVEEDFIIGKLW 474

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/351 (27%), Positives = 169/351 (48%), Gaps = 21/351 (5%)

Query: 191 RNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQ 250
           + T+    E+ D N     F+   +L  A+K+L  IL +     L P+  D  T+V + Q
Sbjct: 147 KKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQL-PR--DHQTLVTYFQ 203

Query: 251 LRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLALQE 310
           L  G+LA  W  P   + +     K+VR   +   +  +S  + + +  L K+  L   +
Sbjct: 204 LYLGSLASLWPTP---KVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKL--LENDD 258

Query: 311 KKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQI--SPQEFPSHVVIK-HRGCYPSSK 367
            K L S +L + ++ S  H  +  + E  +E  W I   P++    V +    G YP S+
Sbjct: 259 WKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSE 318

Query: 368 ILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKAT 427
           +L++I+ SF + + DL + + ++D+F+  YP + L   FW +LF  +   +    D   +
Sbjct: 319 VLIAIVTSFSYRN-DLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGS 377

Query: 428 SVVRCWHLMKQWYASKRLRPSVDYETLRQ--LYDIMKKTGNFPLGIDVLRSFKPGIERTR 485
               CW  M  WY S+    SV Y +      Y+I+K+T N+    D +  F   +    
Sbjct: 378 LQKACWLRMLSWYKSR--GESVPYSSYLASCRYEILKQTSNYK---DAMAMFPDYMSAVY 432

Query: 486 AENAGKVNNIII--KYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLN 534
           A++A   +N+ +  KYQK +I+EL  RG+  A  +FI+ + F+ +  K+L 
Sbjct: 433 AKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQ 483

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  119 bits (299), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 124/499 (24%), Positives = 225/499 (45%), Gaps = 89/499 (17%)

Query: 107 SSSGMDESEFSK--------SISYLFAKTVDP--EPKDVLSLEDLSFLLSKLYTQRFQIR 156
           SS+ + ++EF+K         I  L +  ++P     +  +LE+ S  L K+ + +    
Sbjct: 61  SSTLLKKNEFNKYEHFLRGGRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMK---- 116

Query: 157 RICRDINAKYSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQL 216
               D+N       F+LF +YA     +          L+A +I+D N +IK FI+  QL
Sbjct: 117 --DSDVNVNVV---FQLFEIYARMYCGE--------GSLNALQIYDLNKLIKYFIKRDQL 163

Query: 217 GKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNS----EQKQGF 272
            + Q +L FI+ +   I     + D+ ++ + L+L+ G+L   WK    +    + +QG 
Sbjct: 164 KQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGR 223

Query: 273 LRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLALQEKKLLNSEDLLS-TLIQSFGHLG 331
           L                  YK +D  +LLKIADL L +   +  +++L+ ++I S GHL 
Sbjct: 224 L-----------------NYKFLDGWSLLKIADLVLNDP--MKCQNVLTNSIIYSLGHLR 264

Query: 332 QTQILERCIEHIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILD 391
           Q ++L+  I+ +W    +  P + ++     YP +  +++I+ S+ +N  ++ +   +LD
Sbjct: 265 QVELLDHFIDQMWMQETR--PRNGLL-----YPDTNNIIAIITSYCYNYGNMDKSFDVLD 317

Query: 392 SFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDY 451
             ++ Y  +K D  FWRRLFQ      T  N  K   + +CW LM+     K+ +   D 
Sbjct: 318 RILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQCWSLME-----KQEKVEFDG 370

Query: 452 ETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRG 511
             L  L + + K  + PL + VL+     +++    N   +  +++KYQK +  +L    
Sbjct: 371 VLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDM-ELLLKYQKFVFSKLGEIN 429

Query: 512 RFSAVREFI--DSYGFDRKMTKDLNIFCANRMFLRSXXXXXXXXXXXXXXXVRLDSFDD- 568
           +     E +  D Y  +++          N+ F+R+                  + +DD 
Sbjct: 430 KTVKAMELLSCDDYTINKE----------NKAFMRAYYFENKREKRKKNKRS--NQYDDL 477

Query: 569 -------DEDDGMIIGSLW 580
                  DE+D MIIG LW
Sbjct: 478 QRKYDEMDEED-MIIGKLW 495

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  111 bits (277), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 111/412 (26%), Positives = 178/412 (43%), Gaps = 51/412 (12%)

Query: 195 LDACEIFDANLMIKNFIELGQLGKAQKILSFILD----RNPDILLSPKNADISTIVHFLQ 250
           +DA    D N  IK FIE  QL +AQ  L F+LD    R  D LL P   D  TI HFL 
Sbjct: 162 VDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED-LLGPY-GDKQTIAHFLM 219

Query: 251 LRCGALAPYWKI--PDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLAL 308
           LR GAL   WKI   + + +KQ F     ++   + +++  STY  +D   L +I    L
Sbjct: 220 LRSGALQDLWKIDVSNGNNKKQAF----YKINGSHRNVK--STYNVLDSVKLFEIVRYIL 273

Query: 309 Q-------EKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHRG 361
           +        + +   E +L  +I   G++GQT ++E  I  IW++     P    I    
Sbjct: 274 RYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNIT--- 330

Query: 362 CYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPA 421
              +S +L +I+ ++      +  GL I D F    P++ +   FW  L +     W   
Sbjct: 331 --VTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQK-----WNII 383

Query: 422 NDKKATSVV----RCWHLMKQWYASKRLRP--SVDYETLRQLYDIMK----KTGNFPLGI 471
              K  S +    R W LMK W  S       + + E L  +Y ++     K  +     
Sbjct: 384 LPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIY 443

Query: 472 DVLRSFKPGIERTRAENAGKVNNI--IIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKM 529
           D+   F+  +    ++N+  V+ I  + K+Q   IK++V  G +S   +FI  + +D   
Sbjct: 444 DI---FQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAAN 500

Query: 530 TKDL-NIFCANRMFLRSXXXXXXXXXXXXXXXVRLDSFDDDEDDGMIIGSLW 580
            + L N+F      LR+                    +D++E + M++G LW
Sbjct: 501 KQQLTNLFVV----LRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 171/370 (46%), Gaps = 28/370 (7%)

Query: 167 SEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFI 226
           +E W  L+ +Y   V    N V+  N    A  ++D N  ++ FI L  L  A+ +   I
Sbjct: 123 TEVWKSLYHIYRVFV---VNAVDDGN----AMVLYDLNQFVRMFINLNDLPLARNVFQLI 175

Query: 227 L--DRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRL--GAK 282
           L   +N +I   PK  D+ TI  +L+L CGAL+  W     ++  + F + ++    G+ 
Sbjct: 176 LKNSKNGEI---PK--DVQTICMYLRLYCGALSELW----TTQTSRNFYQDLIGSLSGSN 226

Query: 283 NTSIRLSS-----TYKAMDHQTLLKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILE 337
            +SIR+ S     T      Q LL+      +  KL N+E + S +IQ+ GH  +   L+
Sbjct: 227 ASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNTE-MDSLIIQALGHYKEVPFLK 285

Query: 338 RCIEHIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHY 397
           + I   + I      +      +   P S++L S+ +S Y +++++  G++++ SF++ Y
Sbjct: 286 QYISIFYGIDENVTITETHPGIKKLTPDSQLLKSV-ISAYGHNNNITSGMTVIGSFMEKY 344

Query: 398 PDVKLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQL 457
           P++ LD  FWR     S   W    D K +   + W+LM  WYA+       D + +   
Sbjct: 345 PEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYR 404

Query: 458 YDIMKKTGNFPLGI-DVLRSFKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAV 516
              +K   +    I DV + FK    +T          ++  YQ+ IIK LVN+   +  
Sbjct: 405 LSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKC 464

Query: 517 REFIDSYGFD 526
            +FI+ +  D
Sbjct: 465 VDFINEWRID 474

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 113/447 (25%), Positives = 206/447 (46%), Gaps = 48/447 (10%)

Query: 122 YLFAKTVDPEPKDVLSLEDLSFLLSKLYT-QRFQIRRICRDINAKYSEFWFKLFSLYAEK 180
           YL AK ++      L+  +LS +++ L     FQ +   R     +SE  FK++ +Y E+
Sbjct: 137 YLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFKSHSELIFKVYQIYIER 196

Query: 181 VD----AKRNQVNLRN------TKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDR- 229
           ++       N  ++++      T L+  +++D N +I  FI+ GQL KA   L +IL R 
Sbjct: 197 IEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRY 256

Query: 230 NPDILLSPKNADISTIVHFLQLRCGALAPYWKI-PDNSEQKQGFLRKMVRLGAKNTSIRL 288
           N +I   P   D  TI++FL+L CG L   W+I P N    +   ++  +LG  ++  RL
Sbjct: 257 NAEIFQIP---DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRL 313

Query: 289 SSTYKAMDHQTLLKIA--------DLALQEK--KLLNSEDLLSTLIQSFGHLGQTQILER 338
            S+YKA+  +  ++I         D+ L  K    + + +  STLI S   LG+  + E+
Sbjct: 314 PSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQ 373

Query: 339 CIEHIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSF-YFNDHDLHRGLSILDSFIKHY 397
             +  W     +              +S I+++I  S+ Y N +++ +   ++   IK Y
Sbjct: 374 YFKDNWLSDSCD----------DVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRY 423

Query: 398 PDVKLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPS------VDY 451
           PD+ L+   W R+ + +   W    D         ++ M  +Y++   R S      + Y
Sbjct: 424 PDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPY 483

Query: 452 ET--LRQLYDIMKKTGNFPLGIDVL-RSFKPGIERTRAENAGKVNNIIIKYQKCIIKELV 508
               L  LY +     +    + ++   FK  + +T ++   K   I++KYQK I+K L+
Sbjct: 484 NKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLI 543

Query: 509 NRGRFSAVR--EFIDSYGFDRKMTKDL 533
           N  + ++ +  +FI+ Y  D    + L
Sbjct: 544 NDRKLTSNKPLDFIEKYSLDTNNKEQL 570

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/354 (20%), Positives = 143/354 (40%), Gaps = 30/354 (8%)

Query: 200 IFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRCGALAPY 259
           + DAN   + F+   +L  A+ + + ++    ++   P+  D  TI+  LQL  GA   +
Sbjct: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPR--DTETIITLLQLHLGAKHIF 244

Query: 260 WKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLALQEK--KLLNSE 317
           W+ P NS  + G L     +        + + Y ++  +TLL++  L   +   K + S 
Sbjct: 245 WRDPGNSVGRGGQLFTPAHMA-------VVTAYNSLGEETLLRLLRLLQSDPQWKSVCSP 297

Query: 318 DLLSTLIQSFGHLGQTQILERCIEHIWQISP--QEFPSHVVIKHRGCYPSSKILVSILVS 375
           DL   +I +     +  ++       +  +      PS  ++      P   ++ +++ +
Sbjct: 298 DLDRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPSTPLL------PDGALVGAVVTA 351

Query: 376 FYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWT----PANDKKATSVVR 431
           F F  H L +GL+I   F+  +  +  +   W+ +     F W     P   + A     
Sbjct: 352 FAFK-HQLAQGLAIAYQFLDRFTHLPNEHELWKII-----FTWLARRHPTGSQGAALYDE 405

Query: 432 CWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRAENAGK 491
            W  M+  YA        DY   R  Y I+++  +      +L  +   + +  A  A +
Sbjct: 406 AWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAV-APR 464

Query: 492 VNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANRMFLRS 545
              +++K Q  I+  LV   R SA  +F+D +  D +    L    A R   R+
Sbjct: 465 DRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLEHIAARASSRT 518

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 80/172 (46%), Gaps = 10/172 (5%)

Query: 172 KLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKA-----QKILSFI 226
           K+  L   +     NQV ++NTKL  C  F+ N++ +  I      +      +K++  +
Sbjct: 626 KVLDLKISQAKEIHNQVTIQNTKLRTC--FEDNVVKREVINFENRCEVLNHQNEKLVKKM 683

Query: 227 LDRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSI 286
            ++N ++L S K++    +  FL L+  ++ P+ K   N  +K   L+KM  +   N   
Sbjct: 684 QEQNSELLTSLKDSSCH-LEEFLILQSNSVQPHQKGRKNGVEKDEPLKKMDNI--INEMH 740

Query: 287 RLSSTYKAMDHQTLLKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILER 338
            +  T K M  +T     + A+ + KLL +++ L  L +      ++ IL +
Sbjct: 741 EIKRTKKGMQFETQKLNDEKAVLQTKLLANDNKLEALRKMLDRSSKSMILTK 792

>TBLA0F01790 Chr6 complement(442568..445861) [3294 bp, 1097 aa] {ON}
           Anc_3.408 YPR097W
          Length = 1097

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 129 DPEPKDVLSLEDLSFLLSKLYTQ-RFQIRRICRDINAKYSEFWFKLFSLYAEKVDAK--- 184
           D + KD L  E++S  L K+ T  R+ +R I +DI+  +SE  F+ F+     +D +   
Sbjct: 387 DSKFKDALDSENVSLPLEKMRTSLRYFLREIVKDIDIAHSELVFQFFNTNV-LIDPRNFT 445

Query: 185 ---RNQVNLRN 192
              + Q+NLRN
Sbjct: 446 QEIKKQINLRN 456

>CAGL0J02244g Chr10 complement(220448..221737) [1290 bp, 429 aa]
           {ON} highly similar to uniprot|P29952 Saccharomyces
           cerevisiae YER003c PMI40
          Length = 429

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 401 KLDALF----WRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQ 456
           +LDA +    W ++   S  A   A+   +  +       + W  +    PSV++ET   
Sbjct: 8   RLDAGYQQYDWGKIGSSSAVAKFAAHSDPSVKIDETKPYAELWMGTHSKLPSVNHETKAT 67

Query: 457 LYDIMKKTGNFPLGIDVLRSFK 478
           L DI+ K     +G DV+  FK
Sbjct: 68  LNDILAKNSQELIGEDVINKFK 89

>KLLA0C13101g Chr3 (1115573..1117699) [2127 bp, 708 aa] {ON} weakly
           similar to uniprot|Q08818 Saccharomyces cerevisiae
           YOR354C MSC6 Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           mitochondria msc6 mutants are defective in directing
           meiotic recombination events to homologous chromatids
          Length = 708

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 87/204 (42%), Gaps = 34/204 (16%)

Query: 338 RCIEHIWQISPQEFPSHVV---IKHRGCYPSSK--ILVS---ILVSFYFNDHDLHRGLSI 389
             +  +  I+P + P   +   IK  G   ++K  +L S   +L+ ++  D D     + 
Sbjct: 214 NVLTQLLNITPSKVPFLAIEQEIKSLGLTATTKDELLKSFDDLLLQWFTADKD-----AF 268

Query: 390 LDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDK-------------KATSVVRCWHLM 436
           ++ F+K+  D+KL    W++  +L+   +T +N +             ++   V+    +
Sbjct: 269 INEFLKNSNDLKLITYLWKQYLKLATKDFTTSNQEIPGAFMIKLAQLDRSLDAVKIMTQL 328

Query: 437 KQWYASKRLRPSVD-YETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRAENAGKVNNI 495
           K+  AS   +PSV  Y +L Q    +   G     I + R     I  +  +++G   NI
Sbjct: 329 KE--ASADFKPSVSLYNSLLQTVAYIPAFGKEAQSIKLNRI--QAIWNSYIKSSG---NI 381

Query: 496 IIKYQKCIIKELVNRGRFSAVREF 519
            +   K +++ L+  G F  V  F
Sbjct: 382 TVASYKAMLEALIIAGHFKTVESF 405

>ZYRO0B03564g Chr2 complement(292045..296415) [4371 bp, 1456 aa] {ON}
            similar to uniprot|P38181 Saccharomyces cerevisiae
            YBL079W NUP170 Abundant subunit of the nuclear pore
            complex (NPC), required for proper localization of
            specific nucleoporins within the NPC, involved in nuclear
            envelope permeability and in chromosome segregation
          Length = 1456

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 77/186 (41%), Gaps = 35/186 (18%)

Query: 300  LLKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIK- 358
            + K++D   +E+ +    +L  +L Q     G+   +E  +  I       F S+VVIK 
Sbjct: 1285 IFKVSDFRNEEEIIAKWNELFGSLKQELNPTGK---MEDSLNFI------NFLSNVVIKI 1335

Query: 359  ----HRGCYPSSKILVSILVSFYFND---HDLHRGLSILDSFIKHYPDVKLDALFWRRLF 411
                H   +     L+  ++S  F D   HD  +  S+   FI           F + L 
Sbjct: 1336 GRQVHTSEFVFPVALLFPIISNLFYDALPHDHLKPGSVASIFISAGLTYGKLYYFLKDLI 1395

Query: 412  QLSHFAWTPANDKKATSVVRCWHLMKQWYASKR-LRPSVDYETLRQLYD----------I 460
            + S    T   D+        W L+K+WY S R LR  ++YE++ QL D           
Sbjct: 1396 ETSDSPKTIFRDE------MTW-LIKEWYKSDRKLRDIINYESVAQLDDYTLDKDPIEIY 1448

Query: 461  MKKTGN 466
            MK+TGN
Sbjct: 1449 MKETGN 1454

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,765,970
Number of extensions: 2667940
Number of successful extensions: 9781
Number of sequences better than 10.0: 33
Number of HSP's gapped: 9938
Number of HSP's successfully gapped: 34
Length of query: 580
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 465
Effective length of database: 40,294,809
Effective search space: 18737086185
Effective search space used: 18737086185
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 69 (31.2 bits)