Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR281W (GPI12)8.846ON30430416250.0
Smik_13.4948.846ON30430413380.0
Suva_13.4708.846ON30330312431e-173
Skud_13.4538.846ON30030212411e-173
KNAG0J002408.846ON2862976466e-83
ZYRO0G14300g8.846ON2802866003e-76
TDEL0B005208.846ON2682945891e-74
Kpol_1068.48.846ON2912995781e-72
NDAI0K003308.846ON3133135695e-71
NCAS0C003808.846ON2762985588e-70
KAFR0B039608.846ON2783005561e-69
TPHA0I002808.846ON3013045424e-67
CAGL0M03047g8.846ON3042995112e-62
SAKL0D01320g8.846ON2602875045e-62
Kwal_27.102278.846ON2542854732e-57
TBLA0B033008.846ON3193284741e-56
KLTH0C03740g8.846ON2542864681e-56
KLLA0D01430g8.846ON2632444542e-54
ABL120W8.846ON2492844481e-53
Ecym_46178.846ON2492864472e-53
ZYRO0G12562g3.296ON68685770.45
KNAG0L00510singletonON16977730.55
Kpol_467.232.472ON85975703.1
KNAG0E025502.472ON84575684.7
ABL041W2.472ON81880684.8
TBLA0I011902.472ON83575684.9
KLTH0D05412g2.472ON81380685.5
TPHA0G031302.472ON79275676.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR281W
         (304 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   630   0.0  
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   520   0.0  
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   483   e-173
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   482   e-173
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   253   6e-83
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   235   3e-76
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   231   1e-74
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   227   1e-72
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   223   5e-71
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   219   8e-70
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   218   1e-69
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   213   4e-67
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   201   2e-62
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   198   5e-62
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   186   2e-57
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   187   1e-56
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   184   1e-56
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   179   2e-54
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   177   1e-53
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   176   2e-53
ZYRO0G12562g Chr7 complement(992906..994966) [2061 bp, 686 aa] {...    34   0.45 
KNAG0L00510 Chr12 (78828..79337) [510 bp, 169 aa] {ON}                 33   0.55 
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...    32   3.1  
KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.4...    31   4.7  
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...    31   4.8  
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...    31   4.9  
KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} simila...    31   5.5  
TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.4...    30   6.7  

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/304 (100%), Positives = 304/304 (100%)

Query: 1   MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLV 60
           MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLV
Sbjct: 1   MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLV 60

Query: 61  IAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNE 120
           IAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNE
Sbjct: 61  IAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNE 120

Query: 121 RAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCY 180
           RAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCY
Sbjct: 121 RAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCY 180

Query: 181 AAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRR 240
           AAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRR
Sbjct: 181 AAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRR 240

Query: 241 IIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFD 300
           IIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFD
Sbjct: 241 IIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFD 300

Query: 301 VYTY 304
           VYTY
Sbjct: 301 VYTY 304

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/304 (79%), Positives = 273/304 (89%)

Query: 1   MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLV 60
           MKM RR +VNFSKLLYKITKL+IVLTILYIYFTPKI+SRNN SLQH+FP+KY DY+INL+
Sbjct: 1   MKMPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLI 60

Query: 61  IAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNE 120
           IAHPDDEVMFFSP+ISQL+SYFP TVPFNIICLSKGNAEGLG+TRVRELN+SAALLLHNE
Sbjct: 61  IAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNE 120

Query: 121 RAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCY 180
           RAVSVQVMDFQDGM+E+WDIDSITS+LSQ I I N+ LNQIIVTFDSYGVS HINHKSC+
Sbjct: 121 RAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCH 180

Query: 181 AAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRR 240
            AV+KL+ DY +   ++  + P +TALYLRSYKNNIVLKYNSFIWEIL++LY LISPFR+
Sbjct: 181 TAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRK 240

Query: 241 IIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFD 300
             QALP +  AEK+ L LMNTHAQY+LAFA MLNAH+SQVVWFRYGWWI SRFVFVNEFD
Sbjct: 241 TTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFD 300

Query: 301 VYTY 304
           VY Y
Sbjct: 301 VYIY 304

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  483 bits (1243), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 227/303 (74%), Positives = 262/303 (86%), Gaps = 1/303 (0%)

Query: 3   MLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIA 62
           M +R KV FSKLL+KITKLAIVLT+LYIYFTPKI+SRN  SLQH+FPH+  + +INLVIA
Sbjct: 1   MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA 60

Query: 63  HPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERA 122
           HPDDEVMFFSP+ISQL++YFP TVPFNI+CLSKG+AEGLGETR +ELN+SA LLL NER 
Sbjct: 61  HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP 120

Query: 123 VSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAA 182
           VSVQVMDF+DGMDE+WDIDSITS+LSQ ID+ N  ++QIIVTFDSYGVSNHINHKSC+ A
Sbjct: 121 VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA 180

Query: 183 VKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRII 242
           V+K +DDY   KTK   +  H+TALYLRSYKNNI LKYNSFIWEILK+LY  +SPF R I
Sbjct: 181 VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI 240

Query: 243 QAL-PPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDV 301
           Q L  P+T  EK+ L LMNTH+QY+LAFA MLNAH+SQVVWFRYGWWI SRFVFVNEFD+
Sbjct: 241 QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300

Query: 302 YTY 304
           +TY
Sbjct: 301 FTY 303

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  482 bits (1241), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/302 (77%), Positives = 265/302 (87%), Gaps = 2/302 (0%)

Query: 3   MLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIA 62
           M RR KVNFSKL+YKITKLAIVLTILYI+FTPKI+SRN+  LQH+FPHK  D +INLVIA
Sbjct: 1   MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA 60

Query: 63  HPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERA 122
           HPDDEVMFFSP+ISQL+SYFP TVPFNIICLSKGNA+GLGE+RV+ELN SAALLL NER 
Sbjct: 61  HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP 120

Query: 123 VSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAA 182
           VSVQVMDF+DGMDE+WDI+SI S++SQ ID+ N  LNQIIVTFDSYGVS+HINHKSC+ A
Sbjct: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA 180

Query: 183 VKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRII 242
           VK+L+D YA+ K + NE+ PH+TALYL+SYKNNIVLKYNSFIWEILKILY +I PF + I
Sbjct: 181 VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTI 240

Query: 243 QALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVY 302
           Q     T  ++ KL LMNTHAQYVLA+A MLNAH+SQVVWFRYGWWI SRFVFVNEFDVY
Sbjct: 241 QPP--TTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 298

Query: 303 TY 304
           TY
Sbjct: 299 TY 300

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  253 bits (646), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 140/297 (47%), Positives = 192/297 (64%), Gaps = 19/297 (6%)

Query: 8   KVNFSKLLYKITKLAIVLTILYIYF-TPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDD 66
           + NFS+ +YK+TKL+++L ILYIY  T KI S N  +L+ +  H      +NLVIAHPDD
Sbjct: 3   RFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHDIN--SVNLVIAHPDD 60

Query: 67  EVMFFSPIISQLNSYF--PRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVS 124
           EVMFF+P +  LN     P TV FNIIC S G A+GLG  R +EL++S A+LL   R  S
Sbjct: 61  EVMFFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPT-RNTS 118

Query: 125 VQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVK 184
           + V+DF+DGM E WD+  + + L   +    HN   +++TFD  GVS H+NH +CY A  
Sbjct: 119 IVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHN---VLLTFDGKGVSGHLNHIACYRAA- 174

Query: 185 KLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQA 244
             +  Y + K+K+      +T L L+SY  NIV KY+S+IWE++K+LY    P  R+   
Sbjct: 175 --LGYYNEFKSKQK-----LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVP-SRLGNV 226

Query: 245 LPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDV 301
           LP   +    K+++ +T+ QYVL+ A MLNAH++QVVWFRYGWW FSR VFVN+ DV
Sbjct: 227 LPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDV 283

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  235 bits (600), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 179/286 (62%), Gaps = 15/286 (5%)

Query: 17  KITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIIS 76
           K  K+  +L +L+I F+ +I SRN +              ++LV+AHPDDEVMFF+P I 
Sbjct: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTIL 65

Query: 77  QLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHN-ERAVSVQVMDFQDGMD 135
           +L+S  P  V FN++CLSKG A+ LG+TRV+EL ES  LLL N +R   +Q  D+ DG +
Sbjct: 66  ELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHE 125

Query: 136 EIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKT 195
           E WD +S+ S++  K  +     + +++TFD  GVS H+NH +C+ AV  LV D +  K 
Sbjct: 126 ETWDQESVQSTI--KDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVK- 182

Query: 196 KRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDK 255
                     ALYL SY +NIVLKY++F WEI K+  D      R++     N      +
Sbjct: 183 ---------AALYLDSYGDNIVLKYSAFFWEIWKLTRDWF--LHRVLPTSSYNENKPATE 231

Query: 256 LSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDV 301
           ++LM+ ++ Y+L+FA+ML++H+SQ+VWFRYGWW FSRFVFVN+  V
Sbjct: 232 ITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  231 bits (589), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 125/294 (42%), Positives = 175/294 (59%), Gaps = 29/294 (9%)

Query: 9   VNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEV 68
           +N S    K+ KL   L+ILY+  T +I  RN    Q           + L+IAHPDDEV
Sbjct: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60

Query: 69  MFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHN-ERAVSVQV 127
           MFFSP + QL+   P++V FN +CLSKG+A+ LGETR  EL  S  LL  N +R   +  
Sbjct: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120

Query: 128 MDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLV 187
            D+ DG DE W+I+S+ S +  K+ I +   N +++TFD++GVSNH NH +C+ AV +L+
Sbjct: 121 FDYPDGFDEKWEIESVVSIVESKVFIGS-GFN-LLLTFDAHGVSNHPNHVACHNAVARLI 178

Query: 188 DDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPP 247
           +   +             ALYL S+  N+ LKY+ FIWE++++L D +            
Sbjct: 179 EKGHK-------------ALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKL--------- 216

Query: 248 NTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDV 301
               E+  L+ MN+  QY+LAFA M NAHESQ+VWFRYGWW  SRFVFVN+ ++
Sbjct: 217 ----ERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  227 bits (578), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 183/299 (61%), Gaps = 19/299 (6%)

Query: 9   VNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKY-GDYEINLVIAHPDDE 67
           +++   ++K  KL  +L   Y++F   I   N   ++   P  + G   +NLVIAHPDDE
Sbjct: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRG--PGYFSGSSSVNLVIAHPDDE 58

Query: 68  VMFFSPIISQLNSYFPRTVPFNIICLSKG-NAEG--LGETRVRELNESAALLLHNERAVS 124
           VMFFSP + QL+++ P  V  N+IC SKG N +G   GE+R REL +S ++L+ ++R V+
Sbjct: 59  VMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVT 118

Query: 125 VQVMDFQDGMDEIWDIDSITSSLSQKID-IKNHNLNQIIVTFDSYGVSNHINHKSCYAAV 183
           V  +D++DG D+IWD+DS+   L   I+  K++    +++TFD +GVS+H NH +C+ AV
Sbjct: 119 VHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAV 178

Query: 184 KKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQ 243
            +L+           E+ P   A  L S+  N++LKY+ F  EI+K  Y+      +   
Sbjct: 179 HRLI-----------EEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQT 227

Query: 244 ALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVY 302
           +L  N     + + L NTH++Y++A+ATMLNAHESQVVWFRYGWW FSR  + NE  ++
Sbjct: 228 SLNKNMDVPYEYV-LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  223 bits (569), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 193/313 (61%), Gaps = 33/313 (10%)

Query: 11  FSKLLYKITKLAIVLTILYIYFTPKIVSRN-----NASLQHIF--PHKYGDY-----EIN 58
           FSK  YK  KL ++L + Y+  T KI S N     N+ L  I    H + D      +++
Sbjct: 5   FSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLS 64

Query: 59  LVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLL- 117
           LVIAHPDDE+MFF+P + QLN + P ++PFNIIC S G+AEGLG  R +EL++S  LLL 
Sbjct: 65  LVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLS 124

Query: 118 -HNERAVSVQVMDFQDGMDEIWDIDSITSSLSQK--IDIKNHNLNQIIVTFDSYGVSNHI 174
             N R +++ ++DF DGMD++WD   + SSL  +  +++     N I++TFD+ G+SNH 
Sbjct: 125 SSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHP 184

Query: 175 NHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKN------NIVLKYNSFIWEIL 228
           NH +C  AV  L+  Y   K K      ++  L L S  +      N++ KY  F+ +++
Sbjct: 185 NHIACNKAVHDLI-SYDGGKDKE----MNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLV 239

Query: 229 KILYDLISPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWW 288
           K+ ++L +     I    PN+A+   +LS +NT++QY+L++A+MLN H+SQ+VWFRYGWW
Sbjct: 240 KVYWNLATGTFNTI----PNSASL--ELSFINTYSQYILSYASMLNTHKSQMVWFRYGWW 293

Query: 289 IFSRFVFVNEFDV 301
            FSRFVF N+  V
Sbjct: 294 WFSRFVFSNDLLV 306

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  219 bits (558), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 128/298 (42%), Positives = 182/298 (61%), Gaps = 26/298 (8%)

Query: 7   TKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGD-YEINLVIAHPD 65
           +  +FSKL++K+TKL +VL +LY+  + +I   N  +   +    + +   +NLVIAHPD
Sbjct: 4   SNFSFSKLIFKVTKLFLVLWLLYLLSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPD 63

Query: 66  DEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSV 125
           DEVMFF+P + QL++  P ++P N+IC S G+A+GLGE R  EL  S   L+ N+R  +V
Sbjct: 64  DEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNV 123

Query: 126 QVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKK 185
            V+ FQDG D+IWDID +T  L Q       N +Q  +TFDS+GVS H NH +C+ AV  
Sbjct: 124 TVLHFQDGNDQIWDIDQMTQYLPQ-------NDHQAFLTFDSHGVSGHKNHIACHNAVWN 176

Query: 186 LVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQAL 245
           L        T  N     VT L L S  ++++ KY  FI +++K+ ++L        Q  
Sbjct: 177 L------KNTNNN-----VTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKD-----QQQ 220

Query: 246 PPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYT 303
           P       DK++  N ++QY+LA++TMLNAH+SQVVWFRYGWW FSRFVF N   + T
Sbjct: 221 PQ--WESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  218 bits (556), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 174/300 (58%), Gaps = 27/300 (9%)

Query: 9   VNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPH----KYGDYEINLVIAHP 64
           ++ SKL++KITKL ++   LYI  +PKI   N+  L    P     +  D  + LV+AHP
Sbjct: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61

Query: 65  DDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVS 124
           DDEVMFFSP + QL+S+ P    FNII  S G+AEGLG  R  EL  S  +L+   R   
Sbjct: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLI-PRRNKE 120

Query: 125 VQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVK 184
           + + +  DGM+E+WD   +   L Q   I + +   I++TFD +GVSNHINHK+C+    
Sbjct: 121 IFIFNHTDGMNEVWDNKLM---LHQLESILSDSQTNILLTFDQFGVSNHINHKACH---- 173

Query: 185 KLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQA 244
           ++V  Y Q   K N       AL L SY +N++ KY  F W+++         F      
Sbjct: 174 QVVTSYIQSHAKNN------FALLLDSYSSNLLKKYTGFAWQLV---------FLAKNYW 218

Query: 245 LPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY 304
           +   T    D L+L N ++ Y+ A+ATML AH+SQ+VWFRYGWW FSRFV+VN+  +YT+
Sbjct: 219 IHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  213 bits (542), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 182/304 (59%), Gaps = 24/304 (7%)

Query: 14  LLYKITKLAIVLTILYIYFTPKIVSRNNASLQ---HIFPHKYGDYEINLVIAHPDDEVMF 70
           +L+K+ K   +L+ILYI+ TP I   N  S      +   +     +NL+IAHPDDEVMF
Sbjct: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62

Query: 71  FSPIISQLNSYFPRTVPFNIICLSKG---NAEGLGETRVRELNESAALLLHNERA----- 122
           F+P + QL+   P  VPFN+ICLSKG   +   +G+ R  E+ +S  +LL + RA     
Sbjct: 63  FTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNRE 122

Query: 123 VSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNH--NLNQIIVTFDSYGVSNHINHKSCY 180
           V +   +++DGMD+ WDI  + + +   I ++++   L   ++TFD+ GVS H NH +CY
Sbjct: 123 VKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACY 182

Query: 181 AAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRR 240
            A+  L         +++  P     + L SY +NI+LKY+SF+  + K+L ++I+   R
Sbjct: 183 DAMMTL--------KQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFR 234

Query: 241 I--IQALP-PNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVN 297
           I  ++ +P  +   E D++  +NT   Y++A ++MLN+H SQ+VWFRYGWW FSRFVFVN
Sbjct: 235 IFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVN 294

Query: 298 EFDV 301
           +  +
Sbjct: 295 DLHI 298

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  201 bits (511), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/299 (38%), Positives = 172/299 (57%), Gaps = 19/299 (6%)

Query: 11  FSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMF 70
           FSKLL+K+TKL I+  +LYIYFTPK+   N  +L  + P       +NLVIAHPDDE+MF
Sbjct: 18  FSKLLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMF 77

Query: 71  FSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLL--HNERAVSVQVM 128
           FSP I QL  +       N++CLS G+A+GLGE R +EL ++   L    N R VS+ ++
Sbjct: 78  FSPTILQLIDHVQE---LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNIL 134

Query: 129 DFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQ--IIVTFDSYGVSNHINHKSCYAAVKKL 186
           D+ DG +E+W    + + L + I      + Q  II+TFD  G+S H NH +C   V   
Sbjct: 135 DYTDGQNEVW--SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISY 192

Query: 187 VDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALP 246
           +      KT ++     +    L +++  I+ KY+  + ++L+I+Y+ I    +   +  
Sbjct: 193 L------KTIKSNSFVFLELKSLSTWQ--IISKYSGVVPKLLEIIYNKIRASNKTFVSYL 244

Query: 247 PN--TAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYT 303
           PN  + A    +  ++T  QY L+FA M  AH+SQ+VWFRY WW FSR+VFVN+    T
Sbjct: 245 PNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRIT 303

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  198 bits (504), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/287 (38%), Positives = 165/287 (57%), Gaps = 33/287 (11%)

Query: 13  KLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFS 72
           +++ K+ K   +L++LYI  + +I + N    +++FP +     +NL++AHPDDE MFFS
Sbjct: 5   EVVAKLLKAYALLSVLYICVSQRIAAHNRQVFRNVFPSRT-PTSVNLIVAHPDDETMFFS 63

Query: 73  PIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQD 132
           P + QL+  +P +VP  +ICL+ G+A+GLG  R +EL  S  LLL   R  SV V  F+D
Sbjct: 64  PTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLL-PARNTSVIVEGFED 122

Query: 133 GMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQ 192
           GM   WD   + +++++ +     + + +++TFD +GVS H+NH SC  AV  LV+    
Sbjct: 123 GMGVEWDTRQVVATINRHVS----DASPLLLTFDEHGVSGHVNHVSCNTAVSALVE---- 174

Query: 193 PKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAE 252
              +R ++    TALYL S K     KY SF  ++ +I          I    PP     
Sbjct: 175 ---QREQREQRFTALYLNS-KRYFPPKYGSFAVDLARI----------ITGRQPP----- 215

Query: 253 KDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEF 299
                 M+T  QY+L+ A M NAH SQ+VWFR+GWW+ SRFVFVNE 
Sbjct: 216 ----VFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  186 bits (473), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 162/285 (56%), Gaps = 37/285 (12%)

Query: 18  ITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQ 77
           + K++ +L ++YI  + +I   N  +L  +F        INLVIAHPDDEVMFF+P + Q
Sbjct: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLF-RGSAPTSINLVIAHPDDEVMFFAPTLLQ 65

Query: 78  LNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEI 137
           ++ + P ++  N+I L+ G A+GLG+ R +EL +   LLL   +A SV+V+DF DGMD  
Sbjct: 66  IDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLRKRKA-SVEVLDFLDGMDVE 124

Query: 138 WDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKR 197
           WD++    +L ++I     + + + +TFD  G+S H+NH SCY AV+K+   Y++     
Sbjct: 125 WDLERAVKALQERI----LDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSK----- 175

Query: 198 NEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDKLS 257
                  ++ +    K  +  KY+ FI  +          F   I + P          +
Sbjct: 176 -------SSCFKLVSKRYLFEKYSGFIPAL----------FHSFISSSPS---------T 209

Query: 258 LMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVY 302
           L+N+  QY+LA ++M+NAH SQ+VWFRYGWW+FS +V+ NE   +
Sbjct: 210 LINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  187 bits (474), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 179/328 (54%), Gaps = 46/328 (14%)

Query: 9   VNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPH-----KYGDYEIN---LV 60
           +NFS    +  KL ++  ++YI+ +  I   N+ S  +   H          +IN   L+
Sbjct: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI 60

Query: 61  IAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGE----TRVRELNESAALL 116
           IAHPDDE+MFFSP + QLN+Y  + + FN++CLS+G  +  G      RV ELN+S  LL
Sbjct: 61  IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLL 119

Query: 117 L-------HNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYG 169
                   HN     +Q +D+ DGM EIW++D I   L Q ++  ++ +N +++TFD  G
Sbjct: 120 FNRGSNNEHNRNFKLIQ-LDYTDGMKEIWNMDLIVDDLLQNLNFTDNGIN-LLLTFDKSG 177

Query: 170 VSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILK 229
           VSNH NH +C  AV KL+  Y+ P +       ++  ++L S+  N  LKY+ F+ ++  
Sbjct: 178 VSNHKNHLACNEAVTKLLK-YSNPDS-------NLIGIFLNSHSKNFFLKYSFFVSKLFT 229

Query: 230 IL-----------YDLISP---FRRIIQALPPNTAAEKDKLSL--MNTHAQYVLAFATML 273
           I+           Y    P   F +  Q +       K  LS    N  A+Y+L+++TML
Sbjct: 230 IIKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTML 289

Query: 274 NAHESQVVWFRYGWWIFSRFVFVNEFDV 301
           NAHESQ+VWFRY WWIFSRF F+N+  +
Sbjct: 290 NAHESQMVWFRYLWWIFSRFAFINDLTI 317

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  184 bits (468), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 159/286 (55%), Gaps = 37/286 (12%)

Query: 13  KLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFS 72
           ++L  + KL  VL ILY   + +I + N  +   +F        INLVIAHPDDEVMFF+
Sbjct: 2   RILKVVCKLLAVLCILYFASSARIKASNEQAFTTLFS-VLNPTSINLVIAHPDDEVMFFA 60

Query: 73  PIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQD 132
           P + QL+ YF   +P ++  L+ G A+GLG+ R  EL +S  LL    +A  V V++F+D
Sbjct: 61  PTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKA-EVTVLNFED 119

Query: 133 GMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQ 192
           GM   WD+   + +L +++ + +  L    +TFD +GVS+HINH SCY  V+ L    A 
Sbjct: 120 GMKVEWDLQKTSEALRKQV-VGDQPL---FLTFDDHGVSSHINHISCYETVRNL--RAAH 173

Query: 193 PKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAE 252
           P+++           +  + K +I  KY +F+  ++ +L       R   QA+       
Sbjct: 174 PESRS----------FSLTSKRSIFQKYTAFVPSLITVL-------RGSRQAV------- 209

Query: 253 KDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNE 298
                 M+T  QY+LA + M+NAH SQ+VWFRYGWW FS +VF NE
Sbjct: 210 -----FMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANE 250

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  179 bits (454), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 95/244 (38%), Positives = 138/244 (56%), Gaps = 34/244 (13%)

Query: 56  EINLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAAL 115
            + LV+AHPDDEVMFFSP ++Q N   P ++P N++C++ G+A+GLG  R +EL +S  +
Sbjct: 50  SVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRI 109

Query: 116 LLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHIN 175
           + H  R     V+DF+DGMD +WD   +   L   I     + N +++TFD +GVS HIN
Sbjct: 110 MFHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIP----DSNPLVLTFDQFGVSGHIN 164

Query: 176 HKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLI 235
           H SC   V+KL   Y+     R++QP              I +KY++FI  I        
Sbjct: 165 HISCGRLVEKL--PYSHKLHLRSDQP--------------IYVKYSAFIAGI-------- 200

Query: 236 SPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVF 295
             F+  I  + P+    +     ++T  QY+LA + M  AH SQ+VWFR GWW+FSRF F
Sbjct: 201 --FQLGISTVYPDYGKPR---CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCF 255

Query: 296 VNEF 299
           +NE 
Sbjct: 256 INEL 259

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  177 bits (448), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 154/284 (54%), Gaps = 40/284 (14%)

Query: 16  YKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPII 75
           + + KL ++L  +Y +   ++   N    + +         + LVIAHPDDEVMFF+P +
Sbjct: 6   FAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTL 65

Query: 76  SQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMD 135
            QL++  P  +PF ++CL+ G AEGLG+ R  EL ++  LL+  E  V+++V DF DGM 
Sbjct: 66  LQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLV-LEHDVTLEVADFTDGMK 124

Query: 136 EIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKT 195
           E WD+  + + L + +     +   +++TFD  GVS H NH  C  A  +L         
Sbjct: 125 EDWDLAEVRTRLGELVT----DAKPLVLTFDERGVSGHRNHIGCALAAARL--------- 171

Query: 196 KRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDK 255
                  H T L+LRS + N++ KY+ F+ ++ ++++             PP T      
Sbjct: 172 ------GHKT-LFLRS-ERNLLRKYSFFVLDVFRVVF-----------GTPPPTV----- 207

Query: 256 LSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEF 299
              ++T AQY+ A   M+ AH SQ+VWFR+GWW+ SR+V+ NE+
Sbjct: 208 --FVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANEY 249

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  176 bits (447), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 162/286 (56%), Gaps = 42/286 (14%)

Query: 15  LYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDY-EINLVIAHPDDEVMFFSP 73
            + + KL +VL  +Y   + K +  +N+ +       +G+Y  + L+IAHPDDEVMFF+P
Sbjct: 5   FFAVIKLYLVLLAVYCG-SYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAP 63

Query: 74  IISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDG 133
            + QL++   ++VPF ++CL+ G+A+GLGE R REL+++  LL+  ER V +Q+  F+DG
Sbjct: 64  TLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLV-LERDVEIQMGGFKDG 122

Query: 134 MDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQP 193
           MDE W ++ +   L+Q +  +      +++TFD  GVS H NH +C  A  KL       
Sbjct: 123 MDEEWKMEVVREELAQVVTDR----RPLVLTFDERGVSGHRNHIACAHAAAKL------- 171

Query: 194 KTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEK 253
                    H T L+L S  +N++ KY+ F  ++ ++L+    P                
Sbjct: 172 --------GHHT-LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMP---------------- 205

Query: 254 DKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEF 299
                ++T +QY+ +  TML AH+SQ+VWFR+GWW  SR+V+ NEF
Sbjct: 206 --TVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249

>ZYRO0G12562g Chr7 complement(992906..994966) [2061 bp, 686 aa] {ON}
           conserved hypothetical protein
          Length = 686

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 48  FPHKYGDYEINLVIAHPDDEVM--FFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETR 105
           FPH+YG+Y     + +          SP I+ +N+Y+P+ +P            G+G T 
Sbjct: 610 FPHQYGEYAKPETVLNQQSHQSHHMASPQINSVNTYYPQVIP------------GMGSTP 657

Query: 106 VRELNESAALLLHNERAVSVQVMDF 130
            +    +A L+  N  A S Q+  +
Sbjct: 658 YQPSQSNAPLVYQNVLAPSRQMGSY 682

>KNAG0L00510 Chr12 (78828..79337) [510 bp, 169 aa] {ON} 
          Length = 169

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query: 141 DSITSSLSQKIDIKNHNLNQIIVTFDSYGVS--NHINHKSCYAAVKKLVDDYAQPKTKRN 198
           DS+    SQ ID  +HN NQ +++    G    N ++H+S +  +       + P+T   
Sbjct: 86  DSVHVGGSQMIDTLSHNCNQSLISSGRSGCRGMNQLSHRSEHLPIFYTFGGGSHPRT--C 143

Query: 199 EQPPHVTALYLRSYKNN 215
            +PP+ T +Y +    N
Sbjct: 144 YRPPNGTYVYYKQAPTN 160

>Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON}
           (50661..53240) [2580 nt, 860 aa]
          Length = 859

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 100 GLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLN 159
           G+G  RVR+L ++A      E A S+  +D  D + +         + S   D + + LN
Sbjct: 457 GVGAARVRDLFKTA-----KENAPSIVFIDEIDAIGKARQ----KGNFSGANDERENTLN 507

Query: 160 QIIVTFDSYGVSNHI 174
           Q++V  D +  S+HI
Sbjct: 508 QLLVEMDGFTTSDHI 522

>KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.472
           YMR089C
          Length = 845

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 9/75 (12%)

Query: 100 GLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLN 159
           G+G  RVR+L ++A      E A S+  +D  D + +     +I+ +     D + + LN
Sbjct: 444 GVGAARVRDLFKTA-----RENAPSIVFIDEIDAIGKARQKGNISGA----NDERENTLN 494

Query: 160 QIIVTFDSYGVSNHI 174
           Q++V  D +  ++H+
Sbjct: 495 QMLVEMDGFTAADHV 509

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 19/80 (23%)

Query: 100 GLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSS-----LSQKIDIK 154
           G+G +RVR+L ++A      E A ++  +D         +ID+I  S      S   D +
Sbjct: 409 GIGASRVRDLFKTA-----RENAPAIIFID---------EIDAIGKSRQKGNFSGANDER 454

Query: 155 NHNLNQIIVTFDSYGVSNHI 174
            + LNQ++V  D +  S+HI
Sbjct: 455 ENTLNQLLVEMDGFTPSDHI 474

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 9/75 (12%)

Query: 100 GLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLN 159
           G+G +RVR+L ++A      E A S+  +D  D + +         + S   D + + LN
Sbjct: 427 GVGASRVRDLFKTA-----KENAPSIVFIDEIDAIGKARQ----KGNFSGANDERENTLN 477

Query: 160 QIIVTFDSYGVSNHI 174
           Q++V  D +  ++HI
Sbjct: 478 QLLVEMDGFSSTDHI 492

>KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 813

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 19/80 (23%)

Query: 100 GLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSS-----LSQKIDIK 154
           G+G +RVR+L ++A      E A S+  +D         +ID+I  +      S   D +
Sbjct: 418 GVGASRVRDLFKTA-----RENAPSIVFVD---------EIDAIGKARQKGNFSGANDER 463

Query: 155 NHNLNQIIVTFDSYGVSNHI 174
            + LNQ++V  D +  S+H+
Sbjct: 464 ENTLNQLLVEMDGFTPSDHV 483

>TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.472
           YMR089C
          Length = 792

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 100 GLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLN 159
           G+G  RVR+L ++A      E A S+  +D  D + +         + S   D + + LN
Sbjct: 404 GVGAARVRDLFKTA-----KENAPSIVFVDEIDAIGKARQ----KGNFSGANDERENTLN 454

Query: 160 QIIVTFDSYGVSNHI 174
           Q++V  D +  S+H+
Sbjct: 455 QLLVEMDGFTSSDHV 469

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,521,888
Number of extensions: 1450712
Number of successful extensions: 4264
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4357
Number of HSP's successfully gapped: 42
Length of query: 304
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 195
Effective length of database: 40,982,805
Effective search space: 7991646975
Effective search space used: 7991646975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)