Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR279C8.843ON54054025790.0
Smik_13.4928.843ON54354022810.0
Skud_13.4518.843ON53954022490.0
Suva_13.4678.843ON54353821620.0
KNAG0J002608.843ON55048116380.0
CAGL0M03003g8.843ON55848916150.0
NDAI0K004008.843ON55348716120.0
NCAS0A02540singletonON53948216020.0
NCAS0C004008.843ON51749215760.0
YML116W (ATR1)8.843ON54248515680.0
KNAG0G034308.843ON54249415530.0
NDAI0E002808.843ON54953415530.0
Suva_13.278.843ON55353415510.0
Skud_13.258.843ON53753615480.0
Smik_13.188.843ON54548515410.0
KAFR0B03930singletonON55548815420.0
KAFR0B039408.843ON54748915380.0
NCAS0B002908.843ON54253415230.0
SAKL0D01386g8.843ON52148414940.0
TPHA0C047908.843ON55647514750.0
TBLA0D032708.843ON55048814670.0
TDEL0B005508.843ON53748614540.0
KLTH0C03806g8.843ON52552714370.0
KAFR0A028408.843ON52048514220.0
Kpol_541.168.843ON52848614140.0
CAGL0B02343g8.843ON53749314090.0
Kwal_27.102458.843ON51548613970.0
TBLA0D03280singletonON58049113500.0
TBLA0C01160singletonON60048911031e-144
Skud_15.545na 1ON5164798581e-108
Smik_15.560na 1ON5164768291e-104
YOR378Wna 1ON5154798211e-103
Suva_8.435na 1ON5154768111e-101
KLTH0C10560gna 1ON5154747946e-99
KLLA0B00352gna 1ON4984837859e-98
Kwal_23.6547na 1ON5114817781e-96
TDEL0G04950singletonON5124746841e-82
KNAG0D00130na 1ON5654985133e-57
KAFR0C04860na 1ON5344914571e-49
SAKL0C06116gsingletonON1851904059e-46
NCAS0A05720na 1ON5634954161e-43
CAGL0L02519gna 1ON5294703886e-40
NDAI0K02730singletonON6045473421e-33
Suva_10.11singletonON5405001403e-08
Smik_6.24na 2ON5444941351e-07
Skud_6.16na 2ON5495061322e-07
SAKL0F00440gsingletonON5444931143e-05
KLLA0C18931gna 3ON5531251010.001
YPR198W (SGE1)singletonON54369990.002
KLTH0D16962gsingletonON571107930.012
KLLA0F13684g2.473ON57183920.013
KLLA0A04631g8.272ON57987910.017
Skud_16.503singletonON54369910.018
Ecym_73992.473ON563126910.020
KLTH0C10120gsingletonON65185910.021
Kwal_34.15746na 3ON518102890.028
TDEL0A024902.473ON55465890.028
TDEL0D06610singletonON49785880.036
SAKL0A00726gsingletonON59883880.044
Smik_17.11singletonON54469870.048
ZYRO0C01430g8.272ON59089870.062
TDEL0C045902.242ON529148860.082
NDAI0D010202.242ON592179860.084
AGR076C8.272ON686446850.094
Smik_13.2722.473ON56198840.12
TPHA0G031502.473ON60087830.17
Skud_13.2442.473ON56298820.20
SAKL0A08228gsingletonON56985820.23
Kwal_23.48242.242ON55364820.23
KLTH0G09372g2.242ON551143820.25
SAKL0E08756g2.242ON56583810.28
KLTH0H16214gsingletonON551102800.37
YNL065W (AQR1)2.242ON586181800.38
YMR088C (VBA1)2.473ON56298800.40
Kpol_543.448.272ON64360800.45
Skud_14.2672.242ON562130790.53
NCAS0C03460na 4ON630130780.59
KAFR0J009302.242ON56684780.60
Kwal_26.9616singletonON56287780.66
Kpol_1039.192.242ON57396780.67
TBLA0B00840singletonON63735780.73
TDEL0F039908.272ON63186780.76
Smik_14.2622.242ON561148770.76
CAGL0J01375g2.473ON56483770.76
SAKL0E02992g2.473ON57065770.77
KLLA0F03311g2.242ON54283770.79
SAKL0H16808g8.272ON65760770.83
TBLA0G025502.242ON613114770.93
Klac_YGOB_Anc_2.2412.241ON602130770.99
Suva_13.2652.473ON56198770.99
TBLA0F030408.272ON90666761.1
CAGL0B02079gna 4ON624135761.1
ADL258W2.242ON53479751.4
SAKL0C05588gsingletonON67782751.4
TBLA0A03470singletonON57835751.6
TBLA0A03500singletonON57336751.6
YGR224W (AZR1)na 4ON61383751.7
KLTH0C10142gsingletonON57367751.7
Skud_7.560na 4ON64283742.0
NCAS0A078102.473ON56898732.3
NCAS0G029902.242ON58196732.6
SAKL0D04510gna 5ON53156732.8
TBLA0A03460singletonON56835723.0
SAKL0C02178gsingletonON56573723.8
Kpol_467.242.473ON37065713.9
TBLA0A03700singletonON57235723.9
ZYRO0G03234g2.473ON56251714.4
TDEL0G03260singletonON612116714.6
ZYRO0D12628g5.530ON567108714.7
YKR105C (VBA5)singletonON582150705.5
KLTH0G13464g8.272ON593423706.0
NDAI0H022002.473ON57183706.3
TBLA0A03430singletonON56434706.8
KLLA0F17776gna 6ON55351697.7
KLTH0B00594gsingletonON618174698.6
TBLA0A01240singletonON56936689.3
TBLA0A033905.394ON57435689.5
KLLA0B14949gsingletonON180144669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR279C
         (540 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   998   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   883   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   870   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   837   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   635   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   626   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               625   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   621   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      611   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   608   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   602   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      602   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   602   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   600   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   598   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   598   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   597   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      591   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   580   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   572   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   569   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   564   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   558   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   552   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   549   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   547   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   542   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   524   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   429   e-144
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   335   e-108
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   323   e-104
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   320   e-103
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   317   e-101
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   310   6e-99
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   306   9e-98
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   304   1e-96
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   268   1e-82
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   202   3e-57
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     180   1e-49
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   160   9e-46
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            164   1e-43
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   154   6e-40
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   136   1e-33
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    59   3e-08
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    57   1e-07
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    55   2e-07
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    49   3e-05
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    44   0.001
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    43   0.002
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    40   0.012
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    40   0.013
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    40   0.017
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    40   0.018
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    40   0.020
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    40   0.021
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    39   0.028
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    39   0.028
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    39   0.036
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    39   0.044
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    38   0.048
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    38   0.062
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    38   0.082
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    38   0.084
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    37   0.094
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    37   0.12 
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    37   0.17 
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    36   0.20 
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    36   0.23 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    36   0.23 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    36   0.25 
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    36   0.28 
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    35   0.37 
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    35   0.38 
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    35   0.40 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    35   0.45 
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    35   0.53 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    35   0.59 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    35   0.60 
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    35   0.66 
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    35   0.67 
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    35   0.73 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    35   0.76 
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    34   0.76 
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    34   0.76 
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    34   0.77 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    34   0.79 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    34   0.83 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    34   0.93 
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    34   0.99 
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    34   0.99 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    34   1.1  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    34   1.1  
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    33   1.4  
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    33   1.4  
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     33   1.6  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    33   1.6  
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    33   1.7  
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    33   1.7  
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    33   2.0  
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    33   2.3  
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    33   2.6  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    33   2.8  
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     32   3.0  
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    32   3.8  
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    32   3.9  
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               32   3.9  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    32   4.4  
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               32   4.6  
ZYRO0D12628g Chr4 (1069722..1071425) [1704 bp, 567 aa] {ON} simi...    32   4.7  
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    32   5.5  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    32   6.0  
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    32   6.3  
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    32   6.8  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    31   7.7  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    31   8.6  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    31   9.3  
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    31   9.5  
KLLA0B14949g Chr2 complement(1319529..1320071) [543 bp, 180 aa] ...    30   9.7  

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/540 (91%), Positives = 495/540 (91%)

Query: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDP 60
           MFSIFKKKTSVQGTDSEIDEKITVKAKDK                 KSTQVTNDSPWQDP
Sbjct: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDP 60

Query: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120
           TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG
Sbjct: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120

Query: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180
           SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180

Query: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGI 240
           PNIMGLVGHVYKVGSFRKNIVISFIGACAPT           IVTEDPNQWPWVFYAFGI
Sbjct: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGI 240

Query: 241 ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXX 300
           ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPY   
Sbjct: 241 ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIV 300

Query: 301 XXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         YESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ
Sbjct: 301 LLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLEA 540
           MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLEA
Sbjct: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLEA 540

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/540 (80%), Positives = 466/540 (86%)

Query: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDP 60
           M  IFKKK SVQGTD +I +K  +K  DK                 +S QVTNDSPWQDP
Sbjct: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDP 60

Query: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120
            YFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSE+NNQAWLMASFPLAAG
Sbjct: 61  IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG 120

Query: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180
           SFILISGRLGDIYGLKKML++GYVI+I+WSIISGLSKYSNSDAFFIT RAFQG+GIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFIL 180

Query: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGI 240
           PNIMGLVGHVYKVGS RKN+VIS IGACAP            IVTEDP QWPWVFYAF I
Sbjct: 181 PNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSI 240

Query: 241 ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXX 300
           ATF+SLLMAWYSIPNNVPTN+HGLSMDWTGS LA++GLILFNFVWNQAPI GW + Y   
Sbjct: 241 ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIV 300

Query: 301 XXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         YE KYAEVPLLP A+TKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ
Sbjct: 301 LLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFGS+AAFFVAFSIKRLGPA+LLCF+LMAFDAGSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP 420

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLEA 540
           MG TVE QINKSG +LLKGYRAA+YLG+GLASLG++ISVTYMLEN WN+H++SE + LEA
Sbjct: 481 MGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLEA 540

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/540 (79%), Positives = 468/540 (86%), Gaps = 1/540 (0%)

Query: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDP 60
           M   F++K SVQGT S +++KI++K +DK                 KS Q++NDSPWQDP
Sbjct: 1   MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVASSS-KSNQISNDSPWQDP 59

Query: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120
           TYFSSFGKELMFI TCMLAQLLNQAGQTHALCIMNVLSKSF SE+NNQAWLMASFPLAAG
Sbjct: 60  TYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAG 119

Query: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180
           SFILISGRLGDIYGLKKML++GYVI+IVWSIISGLSKYSN+D+FFIT RAFQGVGIAFIL
Sbjct: 120 SFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFIL 179

Query: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGI 240
           PNIMGLVGHVYKVGS RKN+VIS IGAC PT           IVTEDPNQWPWVFYAFGI
Sbjct: 180 PNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGI 239

Query: 241 ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXX 300
           ATF+S+LMAWYSIPNNVPTN+HGLSMDWTGS LA+IGLILFNFVWN+API GWDK Y   
Sbjct: 240 ATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIV 299

Query: 301 XXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         YE KYAEVPLLP A+TKNRHMIMILLAVF+GWGSFGIWTFYYVSFQ
Sbjct: 300 LLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQ 359

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVF IFG++AAFFVAFSIKRLGPALLLCF+LMAFDAGSIMFSVLP
Sbjct: 360 LNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLP 419

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           VEQSYWKLNFAMQA+LCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG
Sbjct: 420 VEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 479

Query: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLEA 540
           MG TVEHQINKSG ++L+GYRAAVYLG+GLASLGV+ISVTYMLE +WN  +K + +SLEA
Sbjct: 480 MGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLEA 539

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/538 (74%), Positives = 446/538 (82%)

Query: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDP 60
           M+ + ++K +VQ  DS + +KI++KA+DK                 KSTQV+NDSPWQDP
Sbjct: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDP 60

Query: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120
           TYFSSFG+ELMFI TCMLAQLLNQAGQTHAL IMNVLSKSFNSE++ QAWLMASFPL AG
Sbjct: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120

Query: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180
           SFILISGRLGDIYGLKKML++GYV +IVWS+I GLSKYSN+DAFFIT RAFQG+GIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180

Query: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGI 240
           PN+MGLVGHVYKVGS RKN+VISFIGACAP            IV ED  QWPWVFYAF I
Sbjct: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAI 240

Query: 241 ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXX 300
           A FL++++AWYSIPNN+PTN+HG SMDWTGS LA+IGLILFNFVWNQAP  GW   Y   
Sbjct: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300

Query: 301 XXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         YE KYA+VPLLP A+TKNRHMIMILLAVFLGWGSFGIWTFYY+SFQ
Sbjct: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFG++AAF VA SIKR+GPA LLCF+L+AFD GSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           V+QS+WKLNF MQAILCFGMDLSFPASSIILSDGLPM+YQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSL 538
           MG TVEHQINK+G DLLKGYR A+YLGVGLASLGV+IS TYMLE  WN  R  +  S+
Sbjct: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSV 538

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/481 (61%), Positives = 369/481 (76%)

Query: 47  KSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEAN 106
           +S    ND+PWQ+PTYF++  +E  FI+TCMLAQLLNQAGQ  A   MN+L+ +FNS A 
Sbjct: 52  ESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAK 111

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
            Q WLMASFPL +GSFIL+SGR+GDIYGLKK LI GY++V++WS+I G + Y+++DAFFI
Sbjct: 112 KQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFI 171

Query: 167 TSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTE 226
             RAFQG+GIAFILPN+MGL+G++YK  + RKN VISF+G CAP            I  E
Sbjct: 172 LCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHE 231

Query: 227 DPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWN 286
           +P QWPW+FYA+ I   ++++MA YSIP+ VPTNIHG  MDWTGSA+ ++G+ILFNFVWN
Sbjct: 232 NPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWN 291

Query: 287 QAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGW 346
           Q PI GW+K Y                 YE K+A+ PLLP  + KNRH+ MILLAVF+GW
Sbjct: 292 QGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGW 351

Query: 347 GSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSL 406
           GSFGIWTFYY +FQLNLRHYS VW GGT+F+FVI+G++AAF VA +IKR+GP++LLCFS+
Sbjct: 352 GSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSM 411

Query: 407 MAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSL 466
             F  G IM SV PV QSYWK+N  MQ IL FGMDLSFPASSIILSD LP QYQGMAGSL
Sbjct: 412 TGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSL 471

Query: 467 VNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENL 526
           VNT++NYS SLCLG+G T E Q+NK+G D LKGYRAA+Y+G+GL + G++++  Y+ E L
Sbjct: 472 VNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVL 531

Query: 527 W 527
           W
Sbjct: 532 W 532

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/489 (63%), Positives = 381/489 (77%), Gaps = 1/489 (0%)

Query: 53  NDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLM 112
           NDSP+Q+P YF +  KE+MFI +CM+AQLLNQAGQT +L  MNVL+  F S ++ Q WLM
Sbjct: 69  NDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLM 128

Query: 113 ASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQ 172
           ASFPL +GSFILISGRLGDIYGLKK L VGY+I+ +WSII GL+KY+NSDAFFI  R+FQ
Sbjct: 129 ASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQ 188

Query: 173 GVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWP 232
           G+GIAFILPNIMGLVG++YKVG+ RKNIVIS IG  AP            IVTED  QWP
Sbjct: 189 GLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWP 248

Query: 233 WVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVG 292
           WVFYAFGIA+F+++L+A YSIPNNVPTN++ L+MDW GS L + GL+L N VWNQAPIVG
Sbjct: 249 WVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVG 308

Query: 293 WDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIW 352
           W + Y                 YE KYA  PLLP ++ +N+ ++MIL A+F GWGSFGIW
Sbjct: 309 WGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIW 368

Query: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAG 412
           T+YY +FQLNLR Y+P+W GGT+F+FVI+G++AAF VA +IK++GPA+LLCFS++AFD G
Sbjct: 369 TYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCG 428

Query: 413 SIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVIN 472
           SIM SV PV Q+YW++N  MQ IL FGMDLSFPASSIILSD LPMQYQGMAGSLVNTV+N
Sbjct: 429 SIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVN 488

Query: 473 YSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLEN-LWNRHR 531
           YS SLCLGMG TVE Q N  G DLLKGYR+A+YL +GLAS GV +S+ +++ + +  RHR
Sbjct: 489 YSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHR 548

Query: 532 KSEDRSLEA 540
           K  +   E+
Sbjct: 549 KRIESECES 557

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/487 (60%), Positives = 375/487 (77%)

Query: 53  NDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLM 112
           N+S WQ+P YFSS  KE +F+ATCM+A LLNQAGQ+  L  MNV+S SF+S    Q WLM
Sbjct: 59  NNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLM 118

Query: 113 ASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQ 172
           ASFPL +GSFILISGRLGDIYGLK+M+I G++ +I+WS+I G + Y++SD FFI +RAFQ
Sbjct: 119 ASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQ 178

Query: 173 GVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWP 232
           G+GI+FILPN+MGLVG++YKVG+ RKN+VIS IG  APT           IVTE+P QWP
Sbjct: 179 GLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWP 238

Query: 233 WVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVG 292
           W+FYA+ +A  + L+M +Y++P+N+PTN++G +MDW GS L +IGLILFNFVWNQ PIVG
Sbjct: 239 WIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVG 298

Query: 293 WDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIW 352
           W+K Y                 YE KYA+VPLLP+A+T+N H++ IL  +FLGWGSFGIW
Sbjct: 299 WEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIW 358

Query: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAG 412
           TFYY +FQLNLR YSPVW+GGT+FVF+IFG++AA  VA +IK++GPA+LL FS + F  G
Sbjct: 359 TFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCG 418

Query: 413 SIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVIN 472
           SI+ SV PV Q+YW+  F MQ IL FGMDL FPASSIILSD LPMQYQGMA SLVNT++N
Sbjct: 419 SIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVN 478

Query: 473 YSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRK 532
           YS SLCLGMG TVE QINKSG+DLLKGYRAA+Y GVG+A LG  I+   +  ++W++   
Sbjct: 479 YSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNA 538

Query: 533 SEDRSLE 539
            + + L+
Sbjct: 539 KDPKDLQ 545

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/482 (60%), Positives = 362/482 (75%)

Query: 51  VTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAW 110
           + +DSPWQ+P YFSS  KE  FI TCM+A LLNQAGQT  L  MNV+S+SF+S++  Q W
Sbjct: 44  LDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTW 103

Query: 111 LMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRA 170
           LMASFPL +GSFILISGR+GDIYGLKK +I GY+ +I+WS++ G + ++++D FFI  RA
Sbjct: 104 LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRA 163

Query: 171 FQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQ 230
           FQG+GI+FILPN+MGL+G++YKVG+ RKNIVIS IG  APT           IVTE+  Q
Sbjct: 164 FQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQ 223

Query: 231 WPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPI 290
           WPW+FYA+ +   ++L+MA YS+PN +PTN+H  +MDW GS + ++GLILFNFVWNQ P+
Sbjct: 224 WPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPV 283

Query: 291 VGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFG 350
            GWDK Y                 YE KY   PLLP  +TKN  ++ IL  +FLGWG+FG
Sbjct: 284 AGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFG 343

Query: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFD 410
           IWTFYY +FQLNLR YSPVW GGTYF+F+I+G++AA  VAF+IK++GPA+LL FS + F 
Sbjct: 344 IWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFT 403

Query: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470
            GS+M SV P+ Q YW++N  MQ ILCFGMDLSFPASSIILSD LPMQYQGMAGSLVNTV
Sbjct: 404 MGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTV 463

Query: 471 INYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRH 530
           INY+ SLCLGMG TVE QINKSG DLLKGYR+A+YL VGL  LG  I+   +   LW + 
Sbjct: 464 INYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKR 523

Query: 531 RK 532
           R 
Sbjct: 524 RD 525

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/492 (58%), Positives = 362/492 (73%), Gaps = 2/492 (0%)

Query: 51  VTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAW 110
           + N +PWQ+  YF S  KE  FI TCM A LLNQAGQT  L  MNV+S+SF+S+   Q W
Sbjct: 22  LENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQTW 81

Query: 111 LMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRA 170
           LMASFPL +GSFILISGR+GDIYGLKK +I GY+ +I+W+++ G + Y++SD FFI  RA
Sbjct: 82  LMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRA 141

Query: 171 FQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQ 230
           FQG+GI+FILPNIMGLVG++YKVG+ RKNIVIS IG  APT           I TE   Q
Sbjct: 142 FQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQ 201

Query: 231 WPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPI 290
           WPW+FYA+ +A F++L+MA YS+P NVPTN+H  +MDW G+ + ++GLILFNFVWNQ P+
Sbjct: 202 WPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQGPV 261

Query: 291 VGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFG 350
            GW KPY                 YE K+   PLLPR +TKN  ++ IL  +FLGWGSFG
Sbjct: 262 NGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSFG 321

Query: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFD 410
           IWTFYY +FQLNLR+YSP+W G T+F+F+I+GS+AAF V F+I R+GPA+LL FS + F 
Sbjct: 322 IWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFT 381

Query: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470
            GS+M SV P+ Q+YW++N  MQ IL FGMDLSFPASSIILSD LPMQYQGMAGSLVNT+
Sbjct: 382 MGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTI 441

Query: 471 INYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRH 530
           INYS SLCLGMG TVE QINK+G +LL+GYR+A+YL VGL  LG  ++   +  +LW + 
Sbjct: 442 INYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLWRKR 501

Query: 531 RKSED--RSLEA 540
           +   D  RSL  
Sbjct: 502 KSRLDDIRSLNT 513

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/485 (59%), Positives = 362/485 (74%)

Query: 47  KSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEAN 106
           +   V ++  WQ+P YF    +E +FI TCM++QLLNQAG T  L IMN+LS SF SE N
Sbjct: 46  EDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 105

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
           +++WLMASFPL +GSFILISGRLGDIYGLKKML+VGYV+VI+WS+I G++KYS SD FFI
Sbjct: 106 SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFI 165

Query: 167 TSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTE 226
            SRAFQG+GIAF+LPN++G++G++Y  G+FRKNIVISF+GA AP            I TE
Sbjct: 166 ISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE 225

Query: 227 DPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWN 286
           DP QWPW FYA+ IA F++ +++ Y+IP+ +PTNIH  SMDW GS L +IGLIL NFVWN
Sbjct: 226 DPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWN 285

Query: 287 QAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGW 346
           QAPI GW++ Y                 YE ++A+ PLLPRA+ K+RHMI I+LA+F GW
Sbjct: 286 QAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGW 345

Query: 347 GSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSL 406
           GSFGI+TFYY  FQLN+R Y+ +W GGTYF+F+I+G +AA  V F+IK + P++ L FS+
Sbjct: 346 GSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSM 405

Query: 407 MAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSL 466
           +AF+ GSIM SV PV ++Y++       IL FGMDLSFPASSII SD LPM+YQGMAGSL
Sbjct: 406 VAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSL 465

Query: 467 VNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENL 526
           VNTV+NYS SLCLGMG TVE Q+N  G  LLKGYR A YLG+GLASL  +IS  YM+E+ 
Sbjct: 466 VNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESF 525

Query: 527 WNRHR 531
               R
Sbjct: 526 IKGRR 530

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/494 (58%), Positives = 365/494 (73%), Gaps = 4/494 (0%)

Query: 48  STQVTNDSP---WQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSE 104
           ST V    P   WQD TYF +  +E +F+ TCM++QLLNQA     L +MN+L+KSF+S 
Sbjct: 44  STHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSN 103

Query: 105 ANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAF 164
           A NQ WLMASFPL +GSFILISGR+GDIYGLK  L+ G +  I+W++ISG + Y++SD F
Sbjct: 104 AKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTF 163

Query: 165 FITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIV 224
           FI SR+FQG+G+AFILPN+MG VG++YK  +FRKNIVIS IGACAP            I 
Sbjct: 164 FIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIG 223

Query: 225 TEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFV 284
           T++P+ WPW FYA  IA+ L+LL A YSIPN++PTN+HG SMDW GS LA++GLIL NFV
Sbjct: 224 TKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFV 283

Query: 285 WNQAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFL 344
           WNQ PI GW K Y                 YE  YA  PLLPR +T+NRHM+MIL+A+FL
Sbjct: 284 WNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFL 343

Query: 345 GWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCF 404
           GWGSFGI++FYY +F LNLRHYS VW GGTYF+F I+G +A+  V  SI+++  +++L F
Sbjct: 344 GWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFF 403

Query: 405 SLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAG 464
           S++AFD G IM SV PV+Q+Y+++N     IL FGMD+SFPA++IILSD LP QYQGMAG
Sbjct: 404 SMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAG 463

Query: 465 SLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLE 524
           SL NT++NYS SLCLGMG TVE QIN++G DLLKGYRAA YLG+G+ASL V++S+ YM E
Sbjct: 464 SLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCE 523

Query: 525 NLW-NRHRKSEDRS 537
            LW +R  + E  S
Sbjct: 524 RLWIDRKERMESTS 537

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/534 (55%), Positives = 378/534 (70%), Gaps = 5/534 (0%)

Query: 6   KKKTSVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDPTYFSS 65
           ++K   Q T S I+E+ +   K++                 +   + + S WQ+P YF +
Sbjct: 15  EEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQ---EDNTIGDHSKWQNPDYFQN 71

Query: 66  FGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILI 125
             +E +FI +CM++QLLNQA     L IMN+++ SF SE   + WL+ASFPL +GSFILI
Sbjct: 72  KWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILI 131

Query: 126 SGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMG 185
           SGR+GDIYGLKK LI GY+  I+WS+ISG + YS++D FFI SRAFQG+GIAFILPN+MG
Sbjct: 132 SGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMG 191

Query: 186 LVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLS 245
           +VG++YK  + RKNIVIS IGA AP            I TE+P QWPW FYAF IA+ ++
Sbjct: 192 IVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAIN 251

Query: 246 LLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXXXXXX 305
           L ++ YSIPNN+PTNIHG +MDW GS +A+IGLIL NFVWNQ PIVGW K Y        
Sbjct: 252 LAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIIS 311

Query: 306 XXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRH 365
                    YE KYA+ P+LP  +TKNRH+IMIL A+FLGWGSFGI++FYY SF LNLRH
Sbjct: 312 IIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRH 371

Query: 366 YSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSY 425
           YS +W G TYF+F I+G++AA  V   IKR+  +++L FS++AF+ G IM SV PV+Q+Y
Sbjct: 372 YSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTY 431

Query: 426 WKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTV 485
           +++N     IL FGMD+SFPA++IILSDGL MQYQGMAGSL NT++NYS SLCLGMG TV
Sbjct: 432 FRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTV 491

Query: 486 EHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLW--NRHRKSEDRS 537
           E QINKSG ++LKGYRAA YLGVGLA LG+VIS  YM E LW   + R S +R 
Sbjct: 492 ERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRD 545

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/534 (54%), Positives = 381/534 (71%), Gaps = 5/534 (0%)

Query: 8   KTSVQGTDS-EIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQV-TNDSPWQDPTYFSS 65
           KT+ +  D  EI+ ++ ++A+D                     +V      WQ+P YF  
Sbjct: 16  KTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKY 75

Query: 66  FGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILI 125
             +E +FI TCM++QLLNQ+G T  L IMN+L+ SF S+AN+++WLMASFPL +GSFILI
Sbjct: 76  PWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILI 135

Query: 126 SGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMG 185
           SGR+GDI+GLK ML++GYV++I+WS+I GL+KYS SD FFI SRAFQG+GIAF+LPN++G
Sbjct: 136 SGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLG 195

Query: 186 LVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLS 245
           ++G+VY  G+FRKNIVISFIGA AP            I T +PNQWPW FYA+ I   ++
Sbjct: 196 IIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVIN 255

Query: 246 LLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXXXXXX 305
           L+++ Y+IPNN+PTN+H  SMDW GS L +IGL+L N VWNQAPI GW++ Y        
Sbjct: 256 LILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIIS 315

Query: 306 XXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRH 365
                    YE  +A+ PLLP+A+ K+RHMI I+L++F GWGSFGI+TFYY  FQLN+RH
Sbjct: 316 VLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRH 375

Query: 366 YSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSY 425
           Y+P+W GG+YF+F+I+G +AA  V FSIKR+ P++ L F+++AF+ GSIM SV PV ++Y
Sbjct: 376 YTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETY 435

Query: 426 WKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTV 485
           +++      IL FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMG TV
Sbjct: 436 FRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 495

Query: 486 EHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRK---SEDR 536
           E Q++  G  +LKGYR A YLG+GLASL  +IS  YM+E     HR    +ED+
Sbjct: 496 EMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDK 549

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/536 (54%), Positives = 370/536 (69%), Gaps = 5/536 (0%)

Query: 6   KKKTSVQGTDSEID----EKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDPT 61
            +K+ V+  +S  D    E  +V A  K                       +   WQ+P 
Sbjct: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPN 61

Query: 62  YFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGS 121
           YF +   E +FI TCM++QLLNQAG T  L IMN+++ SF S  N++ WLMASFPL +GS
Sbjct: 62  YFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGS 121

Query: 122 FILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILP 181
           FILISGRLGDIYGLKKML +GYV++I+WS+I GL+KYS SD FFI SRAFQG+GIAF+LP
Sbjct: 122 FILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLP 181

Query: 182 NIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIA 241
           N++G++G++Y  G+FRKNIVIS +GA AP            I T++P QWPW FYA+ I 
Sbjct: 182 NVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTIT 241

Query: 242 TFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXX 301
           + ++L ++ YSIPNN+PTNI   SMDW GSAL +IGL+L NFVWNQAPI GWD+ Y    
Sbjct: 242 SIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVL 301

Query: 302 XXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361
                        YE+++A+ PLLPRA+ K+RHMI I+LA+F GWGSFGI+TFYY  FQL
Sbjct: 302 LVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQL 361

Query: 362 NLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPV 421
           N+RHYS VW GGTYF+F+I+G +AA  V   IK++ P++ L  S+MAF+ GSIM SV PV
Sbjct: 362 NIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPV 421

Query: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481
            ++Y++       IL FGMD SFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGM
Sbjct: 422 HETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGM 481

Query: 482 GGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHR-KSEDR 536
           G TVE  ++  G  +LKGYR A YLG+GLASL  +IS  YM+E +   H+ K+  R
Sbjct: 482 GATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/485 (59%), Positives = 359/485 (74%)

Query: 47  KSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEAN 106
           +   V  +  WQ+P YF    +E +FI TCM++QLLNQAG T  L IMN+LS SF SE N
Sbjct: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
           +++WLMASFPL +GSFILISGRLGDIYGLKKML+VGYV+VI+WS+I G++ YS SD FFI
Sbjct: 109 SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFI 168

Query: 167 TSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTE 226
             RAFQG+GIAF+LPN++G++G++Y  G+FRKNIVISF+GA AP            I TE
Sbjct: 169 ICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE 228

Query: 227 DPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWN 286
           +PNQWPW FYAF IA+ ++  ++ Y+IPNN+PTNIH  SMDW GS L +IGLIL NFVWN
Sbjct: 229 NPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWN 288

Query: 287 QAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGW 346
           QAPI GW + Y                 YE  +A+ PLLP A+ K+ HMI I+LA+F GW
Sbjct: 289 QAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGW 348

Query: 347 GSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSL 406
           GSFGI+TFYY  FQLN+RHY+ +W GGTYF+F+I+G +AA  V F+IK + P++ L FS+
Sbjct: 349 GSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSM 408

Query: 407 MAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSL 466
           +AF+ GSIM SV PV ++Y++       IL FGMDLSFPASSII SD LPM+YQGMAGSL
Sbjct: 409 VAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSL 468

Query: 467 VNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENL 526
           VNTV+NYS SLCLGMG TVE Q++  G  LLKGYR A YLG+GLASL  +IS  YM+E+ 
Sbjct: 469 VNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESF 528

Query: 527 WNRHR 531
            N H+
Sbjct: 529 INDHK 533

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/488 (59%), Positives = 376/488 (77%), Gaps = 2/488 (0%)

Query: 53  NDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLM 112
           N++PWQ+P+YFSS  KE +FI TCML+ LLNQAGQT A   MNV+  +FN++++++ WLM
Sbjct: 65  NNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLM 124

Query: 113 ASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQ 172
           ASFPL +GSFIL+SGR+GDIYGLK+ +I G +++I+WS+I G + YS+S  FFI  RAFQ
Sbjct: 125 ASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQ 184

Query: 173 GVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWP 232
           G+GIAF+LPN+MGLVG++YKVGS RKNIVIS IG CAPT           I T+   QWP
Sbjct: 185 GLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWP 244

Query: 233 WVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVG 292
           W+FYA+  A  L+L++A YSIP+ VP N+HG SMDWTGS + +IGLILFNFVWN+APIVG
Sbjct: 245 WIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVG 304

Query: 293 WDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIW 352
           W+K Y                 YE K+A+ PLLP+A+T N ++IMIL A+F+GWGSFGIW
Sbjct: 305 WEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIW 364

Query: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAG 412
           TFYY +F LNLR Y+P+  G ++ +F+++G++AAF VAF+IKR+GP++LL  S++AF  G
Sbjct: 365 TFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVG 424

Query: 413 SIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVIN 472
           SIM S+ PV Q+YWK+ F MQ IL FGMDLSFPASSIILSD LPM+YQGMAGSLVNT++N
Sbjct: 425 SIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVN 484

Query: 473 YSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRK 532
           YS SLCLGMG T E Q+NK+G DLLKGYRAA+Y+G+GL  +GV+I+  ++ E+L  R ++
Sbjct: 485 YSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESL--RQKR 542

Query: 533 SEDRSLEA 540
               +L A
Sbjct: 543 GRTAALTA 550

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/489 (57%), Positives = 353/489 (72%)

Query: 49  TQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ 108
           + ++N+S WQDPTYF S  +E  FI TCMLA LLNQAGQT  L  MNVL+ S NS+   +
Sbjct: 53  SSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAK 112

Query: 109 AWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITS 168
            WLMASF LA+GSFIL+SGR+GDIYGLK   I G +I  +WSI+ G+SKY+ +  FFI  
Sbjct: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172

Query: 169 RAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDP 228
           RAFQG+G+AF+LPN+MGLVG++Y VGS RKNIVISFIG  AP            IV  + 
Sbjct: 173 RAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNK 232

Query: 229 NQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQA 288
           +QWPW+F+A  IA F++L+M  YSIPN+VPTNI+ L MDW GS L +IGLIL NFVWNQA
Sbjct: 233 DQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQA 292

Query: 289 PIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGS 348
           PI GW K Y                 YE K AE PLLP  +TKNRH++ I++++FLGWG+
Sbjct: 293 PISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGA 352

Query: 349 FGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMA 408
           FGIWTFYY +F LNLRH+SP+W G T+FVF+IFGS+ A  VAF+I ++GP++L C S + 
Sbjct: 353 FGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIG 412

Query: 409 FDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVN 468
           F  G+I+FSV   +Q+YW+ +  MQ IL  GMDLSFP SSIILSD LPMQYQGM+GSLVN
Sbjct: 413 FTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVN 472

Query: 469 TVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWN 528
           T+ NY+ SLCLGMG T E Q N  G D+LKGYRAA+Y+ +GL +LG   S +YM E+LW 
Sbjct: 473 TITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWI 532

Query: 529 RHRKSEDRS 537
           R+RK     
Sbjct: 533 RYRKRRQNE 541

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/534 (56%), Positives = 372/534 (69%), Gaps = 5/534 (0%)

Query: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVT--NDSPWQ 58
           MF IF +K+       EI E       ++                   T+      S WQ
Sbjct: 1   MFRIFNRKSH---RSEEIMESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQ 57

Query: 59  DPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLA 118
           +P YF +  +E +FI +CM++QLLNQA     L IMN+++ SFNSE   + WL+ASFPL 
Sbjct: 58  NPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLV 117

Query: 119 AGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAF 178
           +GSFILISGR+GDIYGLKK L+ GY+  I+WSIISGL+KYS+SD FFI SRAFQG+ IAF
Sbjct: 118 SGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAF 177

Query: 179 ILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAF 238
           ILPN+MG+VG++YK  S RKNIVIS IGA AP            I TEDP+QWPW FYAF
Sbjct: 178 ILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAF 237

Query: 239 GIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYX 298
            IA+  +L ++ YSIPN+VPTN+HG +MDW GS LA+IGLIL NFVWNQ PIVGW   Y 
Sbjct: 238 AIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYI 297

Query: 299 XXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVS 358
                           YE KYAE PLLP  +TKNRH+IMIL A+FLGWGSFGI++FYY S
Sbjct: 298 IALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFS 357

Query: 359 FQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSV 418
           F LNLRHYS +W G TYF+F I+G++AA  V   IK++  A +L  S++AF+ G IM SV
Sbjct: 358 FLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSV 417

Query: 419 LPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 478
            PV+Q+Y+++N     IL FGMD+SFPA++IILSDGL MQYQGMAGSL NT++NYS SLC
Sbjct: 418 TPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLC 477

Query: 479 LGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRK 532
           LGMG TVE QINKSGNDLLKGYR A YLG+GLA LG++I+  Y+ E LW + ++
Sbjct: 478 LGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQ 531

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/484 (57%), Positives = 357/484 (73%), Gaps = 4/484 (0%)

Query: 53  NDSPW---QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQA 109
           +D  W   QDPTYFS+  KE +FI   M++QLLNQAG T  L ++N+LSK+F+S  + Q 
Sbjct: 34  DDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQT 93

Query: 110 WLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSR 169
           WLMASFPL +GSFIL+SG++GDIYGLKK L+VGYV+ I+WS+I GL+ Y++S  FFI SR
Sbjct: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153

Query: 170 AFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPN 229
           AFQG+GIAFILPNIMG+VG++Y  G+ RKN+VIS IGACAP            I T    
Sbjct: 154 AFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLS-E 212

Query: 230 QWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAP 289
           +W W FYA+ I   +++ ++ + IPN +PTN+ G SMDW GS + ++G+ILFNFVWNQ P
Sbjct: 213 RWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMILFNFVWNQGP 272

Query: 290 IVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSF 349
           IVGWD  Y                 YE+KYA  PL+PR    N  ++M LLAVF GWGSF
Sbjct: 273 IVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSF 332

Query: 350 GIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAF 409
           GIWTFYY  F LNLR Y+P+W GG+YF+F+I+G +AA  V ++IKR+ P+L+L  S++AF
Sbjct: 333 GIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAF 392

Query: 410 DAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNT 469
           D G IM SV PV+Q+Y+++   M  IL FGMDLSFPASSIILSD LPM+ QGMAGSLV+T
Sbjct: 393 DCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVST 452

Query: 470 VINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNR 529
           +INYS S+CLG+ GTVEHQINK+G+DLLKGYRAA+YLG+GLASLGV IS  +MLEN    
Sbjct: 453 MINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRM 512

Query: 530 HRKS 533
            R++
Sbjct: 513 RRRN 516

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 345/475 (72%)

Query: 58  QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPL 117
           Q P YFSS   E  FI TC++ QLLNQAG T ++ IMN++++ F SE + QAWL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIA 177
            +GSFIL+ GR GDIYGLKKML++GY I+ +WSII GL+ Y++SD FFI ++AFQG+G++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 178 FILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYA 237
           FILPNI+GLVG +Y+ GS +KNI ISFIGA AP            +V +D   WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 238 FGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPY 297
           F I +FL  +  ++ +P+NVPTN + L MDW GSA+ ++GL+LF+FVWNQAP+ GWDK Y
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 298 XXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYV 357
                            YE  YAEVPLLP+A+T NRH+IMILLA+F+GWG+FGIW+FYY 
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 358 SFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFS 417
           SF LNLRH+SPVWTGG YF F++ G   A  V F IK + P+++L  S+  F  G+++F+
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 418 VLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 477
           V P +Q+YW+  F M  +L  GMDLSFPASSIILSD LP +YQGMAGSLVNT++NYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 478 CLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRK 532
           CLG+  TVE QIN SG+DLLKGYRAA Y GVG+ +LG+ I+  YM E  W  +++
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKE 540

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/488 (55%), Positives = 349/488 (71%)

Query: 53  NDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLM 112
             S +Q+P YF +  +E  FI + M+ QLL+QAG T  L IMNVL+K  +S ++ QAWLM
Sbjct: 58  ESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLM 117

Query: 113 ASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQ 172
           +SFPLA GSFIL+SGRLGDIYGLKK+L+ GY+I  VWSII GLS Y+++DAFFIT+RAFQ
Sbjct: 118 SSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQ 177

Query: 173 GVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWP 232
           G+G+AF LPN++GL+G +Y+ G FRKN++IS IGA +PT            V  D + WP
Sbjct: 178 GLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWP 237

Query: 233 WVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVG 292
           W FYAFG+ +F++L+++WY IPN++PTNIHGL MDW GS L + GLI+ NFV+NQAPIVG
Sbjct: 238 WSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVG 297

Query: 293 WDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIW 352
           W   Y                 YE KYA+ PL+P+A++ NR M+MIL ++F GWGSFGIW
Sbjct: 298 WQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIW 357

Query: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAG 412
           TFYY SF+LNLRHYSP+W G +YF+FVI GS  A     +IK++ P++L C S+M F  G
Sbjct: 358 TFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGG 417

Query: 413 SIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVIN 472
           +I+F+  PV Q++++       +L  GMD SFPASSIILSD LPMQYQGMAGSLVNTVIN
Sbjct: 418 NIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVIN 477

Query: 473 YSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRK 532
           YS S+CLGM GTVE + N  G DLL GYRAA+Y  +GLA L V +S  YM+E LW     
Sbjct: 478 YSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVL 537

Query: 533 SEDRSLEA 540
           S + + + 
Sbjct: 538 SLEENKQT 545

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/486 (54%), Positives = 353/486 (72%)

Query: 54  DSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMA 113
           +SPWQDP YF     E++F+ +CM+ QLLNQAG T  L  M VL +  +S +   +WLMA
Sbjct: 48  ESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMA 107

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQG 173
           SFPL +GSFILISGRLGDIYGLKKML++GY+ + +WS+I GLS +S++D FFITSRAFQG
Sbjct: 108 SFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQG 167

Query: 174 VGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPW 233
           +GI+F+LPN++G+VG++YK G+ RKNIVIS IG CAP            +V    + WPW
Sbjct: 168 LGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPW 227

Query: 234 VFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGW 293
            FYA+ IA FL+ +++++ IPN++P N++  +MDW GSAL + GL+LFNFVWNQ+ +VGW
Sbjct: 228 AFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGW 287

Query: 294 DKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWT 353
              Y                 +E KYA+VPLLP+ +T++R +IMIL ++  GWGSFGIW 
Sbjct: 288 ATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWI 347

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGS 413
           FYY  F L LR+YSPVW GGT+F+  I G +AA  V FSIKR+GPA+LL FS++AF  GS
Sbjct: 348 FYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGS 407

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           I+ SV PV ++Y++       IL FGMDLSFPA+SIILSD L MQYQGMAGSLVNTV+NY
Sbjct: 408 IILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNY 467

Query: 474 SASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKS 533
           S SL LG+GGT+E QINKSG+ LL+G+RAA+Y  +G+ SLG++IS  ++L+    R +  
Sbjct: 468 SMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSR 527

Query: 534 EDRSLE 539
           ++  LE
Sbjct: 528 KENELE 533

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/527 (51%), Positives = 361/527 (68%), Gaps = 19/527 (3%)

Query: 10  SVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDPTYFSSFGKE 69
           S Q T S+I  K+    +D                      + + S  Q+P YF    KE
Sbjct: 9   SKQRTGSDISRKVVDNHEDSDML------------------LASRSRLQNPDYFDKQWKE 50

Query: 70  LMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRL 129
            +F+ + ML+QLLNQA    A  + ++LS+   ++A+ QAWLMASFPL +GSFIL+SG++
Sbjct: 51  YLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKV 110

Query: 130 GDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGH 189
           GDIYGLKK L+ GY +V++WS+I GLS Y+++  FFI +R+FQG+GIAF+LPN+ G+VG+
Sbjct: 111 GDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGN 170

Query: 190 VYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLSLLMA 249
           +YK  +  KN+V S IGACAP            I TE    W W FYA+ I   L+ L+A
Sbjct: 171 IYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIA 229

Query: 250 WYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXXXXXXXXXX 309
           WY IP+N+PTN+H   MDW GS L + GLI+FNFVWNQAP  GWD  Y            
Sbjct: 230 WYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILL 289

Query: 310 XXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPV 369
                +E+++A+ PLLPRA+  NR ++MIL ++FLGWGSFGIWT+YY++F LNLRHY+P+
Sbjct: 290 LIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPL 349

Query: 370 WTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLN 429
           W GG+YF+F IFG++AAF V  +I + GPA++L  S++AFD G IM SV PV+Q+Y++++
Sbjct: 350 WAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMS 409

Query: 430 FAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQI 489
                IL FGMDLSFPASSIILSD LP QYQGMAGSLVNT+INYS SLCLG+ GT E Q+
Sbjct: 410 LGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQV 469

Query: 490 NKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDR 536
           NK G DLLKGYRAA+Y+G+GLAS+G+ +S  Y +E+ W R R+   R
Sbjct: 470 NKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVR 516

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/485 (56%), Positives = 346/485 (71%)

Query: 51  VTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAW 110
           V   S WQDP YF +  +E +F+ +CM  QLLNQA     L IMNVLS SFNS  +NQ W
Sbjct: 31  VREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTW 90

Query: 111 LMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRA 170
           L+ASFPL AGSFILISGR+GDIYGLKK LI GY+ +I+WS+I G + YS SD F I +RA
Sbjct: 91  LVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARA 150

Query: 171 FQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQ 230
           FQG+GIAF LPN++G +G++Y VGS RKN+VIS I A AP            IVTE P+Q
Sbjct: 151 FQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFAGLIVTESPSQ 210

Query: 231 WPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPI 290
           WPW FYAF IA   +LL++ YSIP+N+PTN++G  MDW GSAL + GLILFNF WNQ PI
Sbjct: 211 WPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPI 270

Query: 291 VGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFG 350
           VGWD  Y                 YE  +A  PL+ R +T +R+MI+ +  +FLGWGS+G
Sbjct: 271 VGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYG 330

Query: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFD 410
           IW+FYY SF LNLRHYSPVW GG+YF+F IFG +A+ FV  SIK++   ++L FS++ F 
Sbjct: 331 IWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFC 390

Query: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470
            G+ + SV PV+QSY+KL  A  AIL  G+D SFPA++IILSDGLPM+YQGMAGSL  T+
Sbjct: 391 VGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTM 450

Query: 471 INYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRH 530
           +NYS SLCLGMG TVE QINK G D+LKGYR+A YLG+GL+ LG++++   +++ L  ++
Sbjct: 451 VNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIGLSGLGLLLACILVIDKLVAKY 510

Query: 531 RKSED 535
           R    
Sbjct: 511 RNKNS 515

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/486 (53%), Positives = 350/486 (72%)

Query: 54  DSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMA 113
           +S  ++P YF+S  +E  FI +CML+QLLN AG T  L IMNVL++  +S  + + WL+A
Sbjct: 39  NSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVA 98

Query: 114 SFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQG 173
           SFPL +GSFIL+SGRLGDIYGLKKMLI+GYVI+++WS+I+GLS YS+S  FFI +RAFQG
Sbjct: 99  SFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQG 158

Query: 174 VGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPW 233
           +GI+ +LPN++GL+G +YK G+ +KN+VIS +GA +P            + TE    WPW
Sbjct: 159 LGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW 218

Query: 234 VFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGW 293
            FYA+ +A F++  +++YSIPNN+PTN++ LSMDW GS   ++GLILFNFVWNQAP  GW
Sbjct: 219 AFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGW 278

Query: 294 DKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWT 353
           +  Y                 YE +YAE PLLP  + +NR +IMIL A+  GWGSFGIWT
Sbjct: 279 NSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWT 338

Query: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGS 413
           FYY SF LNLR+YSP+W GG+YF+FVI G++ A    F +K++ PA+LL FS++ F+ G 
Sbjct: 339 FYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGC 398

Query: 414 IMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINY 473
           I+FSV PV Q+Y++       IL  GMDLSFPASSIILSD LP Q+QGMAGSLVNTVINY
Sbjct: 399 IIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINY 458

Query: 474 SASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKS 533
           S SL LG+ GTVE   NK+G DLL+GYR A+Y G+  + + V+I+  YM+E +++ ++  
Sbjct: 459 SNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 518

Query: 534 EDRSLE 539
           +++  E
Sbjct: 519 KEKDCE 524

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/493 (52%), Positives = 348/493 (70%), Gaps = 1/493 (0%)

Query: 47  KSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEAN 106
            +  +  +  WQ+P YF S  KE +F+ +C ++QLLNQAG      IMN+++ S +S+  
Sbjct: 40  DTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNG 99

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
            QAWLMA+FPL +GSFILISGR+GDIYGLKK L+VGY+ +IVWS+I GL+KY++SD+FFI
Sbjct: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159

Query: 167 TSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTE 226
            SRAFQG+GI+ ILPNI+G+VG +Y  GS RKN+VIS IG  AP            I TE
Sbjct: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219

Query: 227 DPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWN 286
           D NQWPW FY++ I   ++ +++ + IPN +PTN+HG  MDW GS L ++GLI+ NFVWN
Sbjct: 220 DANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWN 279

Query: 287 QAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAE-VPLLPRAMTKNRHMIMILLAVFLG 345
           QAPI GWD  Y                 YE  +    PLLP+ + K+   I++L A+F G
Sbjct: 280 QAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFG 339

Query: 346 WGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFS 405
           WGSFGI++FYY +FQLNLRHY+P+W GGTYF+F+I+G +AA  V F+IK++ P+++L  S
Sbjct: 340 WGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLS 399

Query: 406 LMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGS 465
           ++AF+ GSI+ SV P+ Q+Y++ +  M  IL FGMDLSFPASSI+LSD LP+QYQGMAGS
Sbjct: 400 MVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGS 459

Query: 466 LVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLEN 525
           LVNT++NYS S CLG+ G VE  +N  G D+LKGYR A YLG+GLAS+  +IS   ML  
Sbjct: 460 LVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSE 519

Query: 526 LWNRHRKSEDRSL 538
           +    +  +D ++
Sbjct: 520 IIQGRKNEKDSAV 532

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/486 (53%), Positives = 350/486 (72%), Gaps = 1/486 (0%)

Query: 47  KSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEAN 106
           ++  +   S  Q+P YF    KE +F+ + ML+QLLNQA  T    + +VLSK  N++ +
Sbjct: 28  QTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVS 87

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
            Q WLMASFPL +GSFIL+SG++GDIYGLKK L+ GYV+V++WS+I GLS Y+++  FF+
Sbjct: 88  QQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFV 147

Query: 167 TSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTE 226
            +R+FQG+GIAF+LPN+MG+VG++YK  +  KN+V S IGACAP            ++  
Sbjct: 148 VARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSG-LIGA 206

Query: 227 DPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWN 286
             + W W FYA+ I   L+ L+A + IPNN+PTN++   MDW GSA+ + GLILFNFVWN
Sbjct: 207 RTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWN 266

Query: 287 QAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGW 346
           QAPI GW   Y                 YE ++A+ PLLP ++  NR ++MIL ++F GW
Sbjct: 267 QAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGW 326

Query: 347 GSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSL 406
           GSFGIWTFYY+SF LNLRHYSP+W GGTYF+F I+G +A+  V ++I + GPA++L  S+
Sbjct: 327 GSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSM 386

Query: 407 MAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSL 466
           +AFD G IM +V PV Q+Y+++   +  IL FGMDLSFPA+SIILSD LP QYQGMAGSL
Sbjct: 387 VAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSL 446

Query: 467 VNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENL 526
           V+T+I+YS SLCLG+ GT EHQ+NK+G DLLKGY+AA+Y+G+GLASLGVVIS  +M+E+ 
Sbjct: 447 VSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDW 506

Query: 527 WNRHRK 532
           W   RK
Sbjct: 507 WTSRRK 512

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/491 (50%), Positives = 342/491 (69%)

Query: 47  KSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEAN 106
            S  + +++    P YF +   E +FI +CM++Q ++QAG T AL IMN+L++  N+E +
Sbjct: 76  NSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKS 135

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
            QAWLMASF L+ GSFIL+SGRLGDIYGLKK+L+ GY I+ +WS+I G S YS++DAFFI
Sbjct: 136 RQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFI 195

Query: 167 TSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTE 226
           TSRAFQG+G+AF+LPN +GL+G +Y+ GS +KN++I  +GA +P            I T+
Sbjct: 196 TSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTK 255

Query: 227 DPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWN 286
           DP QWPW FY+FGI +F +++++WYSIPNN+PTNI+ LSMDW G+ L I GL++ NFV+N
Sbjct: 256 DPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFN 315

Query: 287 QAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGW 346
           QAPIVGW   Y                 YE KYA+ PL+P+A++ NR M+MIL A+F GW
Sbjct: 316 QAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGW 375

Query: 347 GSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSL 406
           G+FG WTFYY SF LN+R Y+  W GG+YF+F++ G   A    F +K++ P+++L  S+
Sbjct: 376 GAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISM 435

Query: 407 MAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSL 466
           + F  G +M +V P+ QSY++    +  +L  G+DLSFPA+SIILSD LP+QYQGMAGSL
Sbjct: 436 IGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSL 495

Query: 467 VNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENL 526
           V T+ NYS S+CLGM G+VE   N +G ++LKGYR A+     LA LG+++S  YM+ NL
Sbjct: 496 VYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINL 555

Query: 527 WNRHRKSEDRS 537
                 S+  +
Sbjct: 556 ITIRENSKSTN 566

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  429 bits (1103), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/489 (41%), Positives = 300/489 (61%), Gaps = 1/489 (0%)

Query: 51  VTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAW 110
           +T     + P  F +  +E  F+   ++ Q L+Q G T  L  MN+L++  ++    Q W
Sbjct: 104 ITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPW 163

Query: 111 LMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRA 170
           LMA+FPL  G  ILISGRLGDI+GLKK+L++GY+I  +W++I G S Y++SD  FI SR 
Sbjct: 164 LMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRT 223

Query: 171 FQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQ 230
           FQG+G+A  LPN+  L+G +YK   F+KN++   IGA +P             V  +   
Sbjct: 224 FQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKN 283

Query: 231 WPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPI 290
           WPW FY+F I  FL+ ++AW+ IPN++  N  GL MDW GSAL + GL++ NFV+NQ PI
Sbjct: 284 WPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPI 343

Query: 291 VGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFG 350
            GW   Y                 YE   A  PL+P+ +  N  +I+ILL +F GWG F 
Sbjct: 344 DGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFA 403

Query: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFD 410
           IWTFYY +FQLNLRHYSP+W   + FV +I G++       +++R+ P +LL FS++ F 
Sbjct: 404 IWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFL 463

Query: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470
            G+I+F+V P+ Q++++  F    +   GM  SFP++S++ ++ LP  Y+ MAGSLVN  
Sbjct: 464 GGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVA 523

Query: 471 INYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLW-NR 529
           INY+ S+C+GM G+     N  G DLL G+RAA YL +GL+   V +S  YM+ ++W +R
Sbjct: 524 INYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDR 583

Query: 530 HRKSEDRSL 538
           ++K ++  L
Sbjct: 584 NQKMKENKL 592

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  335 bits (858), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/479 (37%), Positives = 273/479 (56%), Gaps = 19/479 (3%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++ KSF +    Q +W  +++ L  G+FILI+G
Sbjct: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187
           RLGDI+G KK  ++G+    +WS+++G S YSN   FF   RAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLSLL 247
           G  YK G  RKN+V S  GACAP            +       WPW ++  GIA F   +
Sbjct: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAI 218

Query: 248 MAWYSIPNNVPTNIHGLS------MDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXX 301
             ++ IP+    + H  S      +D+ GS   +IGLILFNF WNQ P+VGW  PY    
Sbjct: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 302 XXXXXXXXXXXXXYESKYAEVPLLP-RAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         ES+ A  PLLP  A++ +   ++  +A   GW SFGIW FY   F 
Sbjct: 279 LIVGTVFLAIFAFIESR-AAFPLLPFAALSSDTAFVLSCIAA--GWASFGIWIFYTWQFM 335

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420
            + R  +P+ +   +    + G  AA    + + R  P+ ++ F++ AF AG+I+ +  P
Sbjct: 336 EDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAP 395

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           V Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG
Sbjct: 396 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 455

Query: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539
           + GT+E  +N  G   LKGYR + Y+G+GL+ LG+ ++  Y     W+  +KS+ R+ E
Sbjct: 456 IAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYA----WSTFKKSKKRTSE 510

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/476 (37%), Positives = 267/476 (56%), Gaps = 15/476 (3%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++  SF +    Q +W  +++ L  G+FILI+G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187
           RLGDI+G KK  ++G+    +WS+++G S YSN   FF   RAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLSLL 247
           G  YK G  RKN+V S  GA AP            +       WPW ++  GIA FL  +
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAV 218

Query: 248 MAWYSIPNNVPTNIHGLS------MDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXX 301
             +Y IP+    N    S      +D+ GS   ++GLILFNF WNQ P+VGW  PY    
Sbjct: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278

Query: 302 XXXXXXXXXXXXXYESKYAEVPLLP-RAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         ES+ A  PLLP  A++ +   ++  +A   GW SFGIW FY   F 
Sbjct: 279 LIVGTVFLIIFAFIESR-AAFPLLPFAALSSDTAFVLSCIAA--GWASFGIWIFYTWQFM 335

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420
            + R  +P+ +   +    I G  AA    F +    P+ ++ F++ AF  G+I+ +  P
Sbjct: 336 EDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAP 395

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           V Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG
Sbjct: 396 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 455

Query: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDR 536
           + GT+E  +N  G ++LKGYR + YLG+GL+  G+ ++ TY +       ++  ++
Sbjct: 456 IAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEK 511

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/479 (37%), Positives = 269/479 (56%), Gaps = 19/479 (3%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSF-NSEANNQAWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++  SF  + A   +W  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187
           RLGDI+G KK  ++G+    +WS+++G S YSN   FF   RAFQG+G AF+LPN + ++
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 188 GHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLSLL 247
           G  YK G  RKN+V S  GA AP            +       WPW ++  GIA F+  +
Sbjct: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217

Query: 248 MAWYSIPNNVPTNIHGLS------MDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXX 301
             ++ IP+    +    S      +D+ GS   ++GLILFNF WNQ P+VGW  PY    
Sbjct: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277

Query: 302 XXXXXXXXXXXXXYESKYAEVPLLP-RAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         ES+ A  PLLP  A++ +   ++  +A   GW SFGIW FY   F 
Sbjct: 278 LIVGTFFLVIFAYIESR-AAFPLLPFAALSSDTAFVLSCIAA--GWASFGIWIFYTWQFM 334

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420
            + R  +P+ +   +    I G  AA    F +    P+ ++ F++ AF  G+I+ +  P
Sbjct: 335 EDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAP 394

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           V Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG
Sbjct: 395 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 454

Query: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539
           + GT+E ++N  G   LKGYR + Y+G+GL+ LG+ ++ TY     W+   KS+ R  E
Sbjct: 455 IAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYA----WSTFMKSKKRISE 509

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  317 bits (811), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/476 (36%), Positives = 266/476 (55%), Gaps = 15/476 (3%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   ++  ++++  SF +    Q +W  +S+ L  G+FILI+G
Sbjct: 43  EAAFVGVLCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187
           RLGDI+G +K  I+G+    +WS+++G S YSN   FF   RAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHRKFFILGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLSLL 247
           G  YK G  RKN+V S  GA AP            +       WPW ++  GIA FL  +
Sbjct: 162 GRTYKPGK-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWIMGIACFLLAV 218

Query: 248 MAWYSIPN------NVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXX 301
             ++ IP+      + P+      +D+ GS   +IGLILFNF WNQ P+VGW+ PY    
Sbjct: 219 AGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVL 278

Query: 302 XXXXXXXXXXXXXYESKYAEVPLLP-RAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360
                         ES+ A  PLLP  A++ +   ++  +A   GW SFGIW FY   F 
Sbjct: 279 LIVGTVFLGVFVFIESR-AAYPLLPFAALSSDAAFVLGCIAA--GWSSFGIWIFYTWQFM 335

Query: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420
              R  SP+ +   +    I G  AA    F +     + ++ F++ AF  G I+ +  P
Sbjct: 336 EESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAP 395

Query: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480
           V Q+YW   F    ++ +GMD+SFPA++I+LS+ +P ++QG+A SLVNTV+NYS S+ LG
Sbjct: 396 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLG 455

Query: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDR 536
           + GT+E Q+N  G + LKGYR + Y+G+GL+ LG+ ++  Y         +K+ ++
Sbjct: 456 IAGTIESQVNDGGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEK 511

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  310 bits (794), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 175/474 (36%), Positives = 259/474 (54%), Gaps = 12/474 (2%)

Query: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ-AWLMASFPLAAGSFILISG 127
           E  F+     AQL+ QAG   ++  ++++  SF +    Q +W  A++ L  G+FILI+G
Sbjct: 45  EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAG 104

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187
           RLGD+YG KK  I+G+    +WS+++G S YSN   FF   RAFQG+G A +LPN + ++
Sbjct: 105 RLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGIGPALLLPNAIAIL 163

Query: 188 GHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLSLL 247
           G  Y  G  RK +++S  GA AP             +      WPW ++A GI  F   +
Sbjct: 164 GRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSS--IFGQLTWWPWAYWAMGIVCFFLAV 220

Query: 248 MAWYSIPN----NVPTNIHGLS-MDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXXX 302
                IP      + T++     +D  GS   +IGL+L NF WNQ P+VGW  PY     
Sbjct: 221 AGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLL 280

Query: 303 XXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLN 362
                        ES+ A  PLLP +   +     +L  V  GW SFGIW +Y+  F   
Sbjct: 281 IVSAVFLCVFAFIESR-APHPLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEE 338

Query: 363 LRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVE 422
           LR +SP+ T   +    I G  AA    F I R+  +L++ F++ AF  G I+ +  PV+
Sbjct: 339 LRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVK 398

Query: 423 QSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 482
           Q YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVN V+NYS S+ LG+ 
Sbjct: 399 QVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLA 458

Query: 483 GTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDR 536
           GTVE ++N  G +LLKGYR A Y+G+GL+  G++I+  Y         +   ++
Sbjct: 459 GTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYHTFKKSKKMPSEK 512

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  306 bits (785), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 179/483 (37%), Positives = 275/483 (56%), Gaps = 15/483 (3%)

Query: 58  QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ-AWLMASFP 116
           Q+   ++S  KE   I     AQL+ QAG   ++  + ++  SF  +   Q +W  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 117 LAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGI 176
           L  G+FILI+GRLGD +G KK  ++G++   +WSI++G S YSN   FF   RAFQG+G 
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGP 136

Query: 177 AFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFY 236
           AF LPN + ++   Y+ G  ++N++ S  GACAP+           +   +   WPW ++
Sbjct: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193

Query: 237 AFGIATFLSLLMAWYSIPNNVPTNIHGLS-----MDWTGSALAIIGLILFNFVWNQAPIV 291
             GI  FL  +  +  IP++ P +          +D  GS   ++GLILFNF WNQ P+V
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 292 GWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLP-RAMTKNRHMIMILLAVFLGWGSFG 350
           GW+  Y                  ES+ A+ PLLP R ++ +   +M  +A   GW SFG
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIFVMGCIAA--GWSSFG 310

Query: 351 IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFD 410
           IW +Y      NLR   P+ +   +    I G  AA    F + R  P+ ++  +++AF 
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 411 AGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 470
            GSI+ + +PV Q+YW   F    ++ +GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 471 INYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRH 530
           INYS S+ LG  GT+E QI+   +DLLKGYR A Y+G+GLA LG+ ++++Y + + ++R 
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGVAISYAIFH-YSRL 489

Query: 531 RKS 533
           ++S
Sbjct: 490 KRS 492

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  304 bits (778), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 171/481 (35%), Positives = 262/481 (54%), Gaps = 16/481 (3%)

Query: 65  SFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFN-SEANNQAWLMASFPLAAGSFI 123
           S  +E +F+     AQL+ QAG   ++  + ++  SF  S     +W  A++ L  G+FI
Sbjct: 35  SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFI 94

Query: 124 LISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNI 183
           LI+GRLGD++G KK+ +VG++   +WS+++G S YSN   FF   RA QG+G AF+LPN 
Sbjct: 95  LIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNS 153

Query: 184 MGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATF 243
           + ++G  Y  G  RK +V S  GA AP             +      WPW ++A G A  
Sbjct: 154 IAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSS--IFSQLAWWPWAYWAMGTACL 210

Query: 244 LSLLMAWYSIPNNVPTNIH---GL--SMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYX 298
           +  +     IP   P  I    G+   +D  G+   I+GL L NF WNQ P+VGW  PY 
Sbjct: 211 VLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYT 270

Query: 299 XXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVS 358
                            ES+ A  PLLP A   +  +  +L  +  GW SFGIW FY+  
Sbjct: 271 YALLIVGFVFLLVFSLIESR-ARFPLLPFA-ALSTDLAYVLGCIAAGWSSFGIWIFYFWQ 328

Query: 359 FQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSV 418
           F  + R  SP+ T   +    I G  AA    + +  +    ++  +++AF  G ++ + 
Sbjct: 329 FLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVAT 388

Query: 419 LPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 478
            P+ Q+YW   F    I+ +GMD+SFPA++I++S+ +P ++QG+A SLVNTV+NYS SL 
Sbjct: 389 APINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLA 448

Query: 479 LGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSL 538
           LG  GT+E ++N  G + L+GYR A Y+G+GL+ LGV++++ Y     W+  +K ++  L
Sbjct: 449 LGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYA----WSTLKKFKEEQL 504

Query: 539 E 539
            
Sbjct: 505 S 505

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  268 bits (684), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/474 (34%), Positives = 257/474 (54%), Gaps = 17/474 (3%)

Query: 48  STQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANN 107
           S +  +   W   + F    KE  F+ T ++AQ  NQAG T  L ++NVLS SF+ +   
Sbjct: 29  SKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK--- 85

Query: 108 QAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFIT 167
             +L+ S+P+  GSF+LI GRLG+++G K+ L+ GY+I+I+ S++ GLS+YS S  F++ 
Sbjct: 86  --FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVI 143

Query: 168 SRAFQGVGIAFILPNIMGLVGHVYK--VGSFRKNIVISFIGACAPTXXXXXXXXXXXIVT 225
            RAFQGVG+A ILPN      + Y+    + RK I+ + IG  A T            VT
Sbjct: 144 CRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVT 203

Query: 226 EDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTN----IHGLSMDWTGSALAIIGLILF 281
              + W W +Y + IA  L+L +++YS+P+N+       ++GL      S     GL++ 
Sbjct: 204 RSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNGLGWFSNRSC----GLLML 259

Query: 282 NFVWNQAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLA 341
           N   N A +   +  +                 +E K++E P+  + +  N  + ++L +
Sbjct: 260 NVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLAS 319

Query: 342 VFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALL 401
           +F GWG++GIW+ Y+  F LNLR+YSP+  G TY   VI G +A   ++  +KR GP L 
Sbjct: 320 IFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLF 379

Query: 402 LCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQG 461
           L FS + F    I+ SV P+ QSY++        L  G+D SFP+S+IIL + LP +Y  
Sbjct: 380 LLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHE 439

Query: 462 MAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGV 515
           M   L N + NY+ S   G+  +    +  S  +L+K YR   Y  +GL+++G+
Sbjct: 440 MTAVLTNGIFNYAISFWPGICNSALRSL--SSIELIKYYRYVYYFAIGLSAIGL 491

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  202 bits (513), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 139/498 (27%), Positives = 245/498 (49%), Gaps = 20/498 (4%)

Query: 53  NDSPW--QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFN-SEANNQA 109
           +D P   ++ T   S   E++F+     +Q+L  AG    +  M+V+ + F  +  ++  
Sbjct: 60  HDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSG 119

Query: 110 WLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSR 169
           W    +    GSF+LI+G++GD+ G K M ++GY  + +WS+++G S+Y  S  FF   R
Sbjct: 120 WCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCR 179

Query: 170 AFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPN 229
           A QG+G AF   + + ++G  Y     RKN + SF GAC  +           + T+   
Sbjct: 180 AAQGIGAAFTFTSALSILGKSYPPCK-RKNFIFSFFGACG-SFGVVLGMVFSALFTQLA- 236

Query: 230 QWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLS----MDWTGSALAIIGLILFNFVW 285
            W W +++  IA  + ++++ + IP +V    H  S     D+ G+ L + GL+LF+  W
Sbjct: 237 HWSWAYWSMAIACVVIIILSIFFIPGDV-VEKHETSNVFYFDYLGAFLFVTGLVLFSVAW 295

Query: 286 NQAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLG 345
           NQAP  G+ + Y                  E+K  + PLLP     + + + +LLA+F  
Sbjct: 296 NQAPTYGFGRTYVYVLLIVSVVILALAMYVETKVDD-PLLPWTHI-SANTLKVLLAIFFA 353

Query: 346 WGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIK-RLGPALLLCF 404
           + SF +W  Y   F L  +  + +          + G  AA F A  +   +   + +  
Sbjct: 354 YASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLI 413

Query: 405 SLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAG 464
           SL+AF    I+ + +   Q+YW   F    ++ FG+D+SFP+++++LS+ +P +++G+  
Sbjct: 414 SLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGA 473

Query: 465 SLVNTVINYSASLCLGMGGTV-EHQ----INKSGNDLLKGYRAAVYLGVGLASLGVVISV 519
           SLV  V+NY+ +L      +V  +Q    +   GN   K      Y+G+G A LG ++++
Sbjct: 474 SLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVAI 533

Query: 520 -TYMLENLWNRHRKSEDR 536
              + E      +K EDR
Sbjct: 534 FGVITEYPKVAGKKGEDR 551

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  180 bits (457), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 136/491 (27%), Positives = 235/491 (47%), Gaps = 25/491 (5%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ---AWLMASFPLAAGSFIL 124
           KE++ +      Q ++  G    +  M  ++ +F+   +      W  A++   A +F++
Sbjct: 47  KEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVI 106

Query: 125 ISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDA-FFITSRAFQGVGIAFILPNI 183
           I+G+LGDI G K M I GY  + +WS+++G SKY+ ++A FF   R  QG+G AF+ P  
Sbjct: 107 IAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTG 166

Query: 184 MGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATF 243
           + L+G  Y     RKN V SF GAC P                    W W +++  +   
Sbjct: 167 LALLGKHYPPCK-RKNYVFSFYGACGPFGIVAGSVFSALFT--QLTTWAWTYWSMAVTCL 223

Query: 244 LSLLMAWYSIP-NNVPTNIHG--LSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXX 300
           +  ++++  IP +N P        S D+ G    I G+ILF+ VWNQAP+  +  PY   
Sbjct: 224 IITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYS 283

Query: 301 XXXXXXXXXXXXXXYESKYAEVPLLP-RAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSF 359
                          +S+  + PL+P ++M  N  +I  L+ VF G+  F IW FY   F
Sbjct: 284 LLIVSVVFMTMALIIDSRVKD-PLIPWKSMCSN--VIKALIVVFFGFLGFTIWLFYSWRF 340

Query: 360 QLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPA-LLLCFSLMAFDAGSIMFSV 418
            L  ++ S +     +    I G  AA F    + +  P  L L  ++ AF   +I+ S 
Sbjct: 341 YLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILIST 400

Query: 419 LPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 478
           + ++++YW   F    I+  G+D++FP+++++LS+G+  + QG+A +L  T +NY  +L 
Sbjct: 401 MTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALG 460

Query: 479 LGMGGTV-----EHQINKSGNDLLKGYRAAVYLGVGLASLGVVISV-----TYMLENLWN 528
            G+   +     +  + +S    +     A Y+ +G A + VV+++      Y  E + +
Sbjct: 461 PGVATLIITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDD 520

Query: 529 RHRKSEDRSLE 539
              K    S E
Sbjct: 521 LREKKRPISSE 531

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  160 bits (405), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 83/190 (43%), Positives = 116/190 (61%), Gaps = 34/190 (17%)

Query: 77  MLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           M++QLLNQ G T  L ++NVLS+ F S    Q  L+AS PL +GSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 137 KMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSF 196
             L+ GY  VIVWS I GL++Y+ S  FF+ +RAFQG+G+AF+LPN+MG V +VY  GS 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 197 RKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNN 256
           RKN+V                                  YA+ +A  L++ +  +++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 257 VPTNIHGLSM 266
           +PTN+ G +M
Sbjct: 147 IPTNVRGQAM 156

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 6/43 (13%)

Query: 455 LPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLL 497
           +P   +G A      ++ YS  +CLG+ GTVEH+++K G D L
Sbjct: 147 IPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  164 bits (416), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 135/495 (27%), Positives = 230/495 (46%), Gaps = 29/495 (5%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ---AWLMASFPLAAGSFIL 124
           +E MFI     +Q ++ A  + A+  M+ ++  F   A+      W  A+F +  G+FI+
Sbjct: 70  RECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFII 129

Query: 125 ISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYS--NSDAFFITSRAFQGVGIAFILPN 182
            +G+L D+ G K + I GY    +WS++ G+S+Y+      FF   R  QG+G A + P+
Sbjct: 130 PAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPS 189

Query: 183 IMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIAT 242
            + L+G  Y   S +KNIV S  G C P            I T+  + W W +++  I +
Sbjct: 190 SLALLGKYYP-PSCKKNIVFSLYGFCVP-LGVVVGGVFSAIFTQLAH-WSWNYWSMAIVS 246

Query: 243 -FLSLLMAWYSIPNNVPTN---------IHGLSMDWTGSALAIIGLILFNFVWNQAPIVG 292
            F +L+  +Y  P+ +  +          H    D+ G+ L +  L+LF   WNQA    
Sbjct: 247 AFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFK 306

Query: 293 WDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIW 352
           +                      E  Y + P++P A   +   I  LL VF  + SF IW
Sbjct: 307 FKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIP-ARKIHPQTIKALLVVFFSYLSFTIW 364

Query: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPA-LLLCFSLMAFDA 411
            FY   +   +R+ + +     +    I G +AA F    I    P  + L     +F  
Sbjct: 365 LFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLL 424

Query: 412 GSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVI 471
             I+F  L   +SYW   F    I+  G+D+SFP+++++LS+G+P + +G++ +LV T +
Sbjct: 425 AHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTAL 484

Query: 472 NYSASLCLGMGGT-VEHQINK---SG--NDLLKGYRAAVYLGVGLASLGVVISV-TYMLE 524
           NY   +   +  T + +Q +K   SG  +  +K    A  +G+G + + VV+ +   + E
Sbjct: 485 NYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVVGLYGTVTE 544

Query: 525 NLWNRHRKSEDRSLE 539
             W  H  S+ R +E
Sbjct: 545 YSWETHSYSK-RCVE 558

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  154 bits (388), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 118/470 (25%), Positives = 214/470 (45%), Gaps = 25/470 (5%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQA---WLMASFPLAAGSFIL 124
           +E+  +   + +QL+   G    + I   L + +  E        W  AS+ L +   +L
Sbjct: 37  REIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVL 96

Query: 125 ISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSD-AFFITSRAFQGVGIAFILPNI 183
           I+G+LGD+ G K+M++ G++ + +WS+I+G S Y   + AF+ T+RA QG+G  FI+PN 
Sbjct: 97  IAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNS 156

Query: 184 MGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATF 243
           + ++G  Y     +K I+ S  G    T                  +W W ++A      
Sbjct: 157 LAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLF--AQLTKWAWNYWALACVCV 214

Query: 244 LSLLMAWYSIPNNVPTNI-HGLS-------MDWTGSALAIIGLILFNFVWNQAPIVGWDK 295
           L  + A   IP   P NI H  +        D+ G+   + GL+LF+  + QA  +GW  
Sbjct: 215 LYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSP 271

Query: 296 PYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFY 355
           P+                  + +  + PL+P    +   +++IL+ V+ G+ SF IW  +
Sbjct: 272 PHTYITLIIGVILILIAMFVDWRVDD-PLVPLQHLR-ADVVVILICVYFGFLSFVIWANW 329

Query: 356 YVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIK-RLGPALLLCFSLMAFDAGSI 414
           +  F   + + SP+          I    AA F    ++  +    ++  S++ F   +I
Sbjct: 330 FWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNI 389

Query: 415 MFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYS 474
           + + +    +YW   F    I  F +D++ P ++++ SD +  + QG+A SL+ TVI+Y+
Sbjct: 390 LMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISYA 449

Query: 475 ASLCLGMGGTVEHQINKSGNDLLKG-----YRAAVYLGVGLASLGVVISV 519
            S+       V   +   GND   G       +    G+ L+ +G+V +V
Sbjct: 450 ISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAV 499

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 132/547 (24%), Positives = 235/547 (42%), Gaps = 82/547 (14%)

Query: 47  KSTQVTNDS-----PWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSF 101
           +S +VT+ S       Q PT  +S+  +++FI     +Q +  A  + A+  M+ LS  F
Sbjct: 46  QSHKVTHSSLIRLQKLQSPT--NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWF 103

Query: 102 NSEANNQ---AWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKY 158
                +     W+ ASF +  G+FI+++G+L DI   + + I GYV   +W++I+G + Y
Sbjct: 104 KIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASY 163

Query: 159 SNSDAFFI-TSRAFQGVGIAFILPNIMGLVGHVYKVGSF--------------------- 196
              +  F+   R  QG+G A + P+ + L+   Y V                        
Sbjct: 164 VPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDI 223

Query: 197 -------------------------RKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQW 231
                                     K+I  S  GACAP            I T+    W
Sbjct: 224 EKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAP-LGIVIGGIFSAIFTQLAT-W 281

Query: 232 PWVFYAFGIATFLSLLMAWYSIPNNVP-----TNIHGL----SMDWTGSALAIIGLILFN 282
           PW +++  I T L  +++++ +   +P     +N + L    + D+ G  L I  LILF 
Sbjct: 282 PWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFG 341

Query: 283 FVWNQAPIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRH--MIMILL 340
             W+QA +  +   +                 +E  Y   P++P    +  H   I  LL
Sbjct: 342 VSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWE-YYFNNPIIP---IRQIHPGTIKALL 397

Query: 341 AVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFF-VAFSIKRLGPA 399
            VF  + SF  W FY       ++  SP+     +    + G ++A F +   +KR+   
Sbjct: 398 VVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQ 457

Query: 400 LLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQY 459
           + L     +F    I+     ++ SYW   F     +  G+D+SFP+++++L++G+P + 
Sbjct: 458 IRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEI 517

Query: 460 QGMAGSLVNTVINYSASLCLGMGGT-VEHQINKSGND------LLKGYRAAVYLGVGLAS 512
           QG+  +LV +V+NY  ++   +  T +++Q     +D       LKG   A  +GVG + 
Sbjct: 518 QGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSG 577

Query: 513 LGVVISV 519
           + V+I +
Sbjct: 578 IAVLIGI 584

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 102/500 (20%), Positives = 189/500 (37%), Gaps = 52/500 (10%)

Query: 58  QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPL 117
           Q  TY  +    L+F+       LLN A     + +++ L++ ++      +W + S+ +
Sbjct: 21  QKSTYQLNVNVALIFLGCTF--DLLNVASM---ISLIDDLAQKYDISYTTASWSLTSYAV 75

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIA 177
               FI   GRLGDI G   +  V      + S++  +     + A F   RA QG+  A
Sbjct: 76  TFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMPNFPAFAVF---RAIQGISAA 132

Query: 178 FILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYA 237
            ++P    L+  +      +K   I    +C  +                   +  +FY 
Sbjct: 133 GLVPCAYALIPMLAPEEEVQKYFSIV---SCGFSSTIGLGLIIGGAFAATKIGYKGIFYL 189

Query: 238 FGIATFLSLLMAWY---------SIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQA 288
                FL  ++A++           P          S+D+ GS + + G IL      + 
Sbjct: 190 TFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEG 249

Query: 289 PIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVP-------------------LLPRAM 329
               W++P                  +   YA +                    L+P  +
Sbjct: 250 G-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEKVQLLIPVDV 308

Query: 330 TKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFV 389
              ++ I I+LA  L         +    +       SP++ G      +I   +     
Sbjct: 309 LFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLC 368

Query: 390 AFSIKRLGP--ALLLCFSLMAFDAGSIMFSVLPV--EQSYWKLNFAMQAILCFGMDLSFP 445
           AF   +L P   ++L FSL    AGSI+ + L +  E  +WK+ F+ QA++ FG+ + +P
Sbjct: 369 AFESTKLKPKVGVVLGFSLAL--AGSIILTQLHLIKEDMFWKIFFSSQALVGFGVAIFYP 426

Query: 446 ASSIILSDGLPMQYQGMAGSLVNTV----INYSASLCLGMGGTVEHQINKSG--NDLLKG 499
            +  I   G P + +G+A  +  T     I  + S+   + G ++    KSG       G
Sbjct: 427 YALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRTG 486

Query: 500 YRAAVYLGVGLASLGVVISV 519
           ++   Y  V + +LG ++++
Sbjct: 487 FQNCTYFTVAVGALGFLVTL 506

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 95/494 (19%), Positives = 184/494 (37%), Gaps = 50/494 (10%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKML 139
            LLN A     + +++ L+K +N      +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 140 IVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKN 199
            +      + S++  +     + A F   RA QG+  A ++P    L+  +      +K 
Sbjct: 98  TISCSCFAILSLLCAVMPNFPAFAVF---RAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 200 IVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFY-AFGIATFLSLLMAWYSI----- 253
             I    +C  +                   +  +FY  F + + +S++  +++      
Sbjct: 155 FSIV---SCGFSSTIGLGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENF 211

Query: 254 ---PNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXXXXXXXXXXX 310
              P  +       S+D+ GS + + G IL      +     W++P              
Sbjct: 212 DKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLIIGILLFF 270

Query: 311 XXXXYESKYAEVP-------------------LLPRAMTKNRHMIMILLAVFLGWGSFGI 351
               +   YA++                    L+P  +   ++ I I+LA  L       
Sbjct: 271 GFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFS 330

Query: 352 WTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDA 411
             +    +       SP+  G      +I   +     AF   +L P + +        A
Sbjct: 331 CLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALA 390

Query: 412 GSIMFSVLPV--EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNT 469
           GSI+   L +  +  +WK+ F+ QA++ FG+ + +P +  I   G P Q +G+A  +  T
Sbjct: 391 GSIILIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQT 450

Query: 470 VINYSASLCLGMGGTVEHQIN--KSGNDLLKGYRAAV----YLGVGLASLGVVISVTYML 523
                  +   +  +V   IN  K   D ++ +R       Y  V + +LG +++     
Sbjct: 451 FGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVTAIC-- 508

Query: 524 ENLWNRHRKSEDRS 537
             + + H  ++D S
Sbjct: 509 --IRDIHTPNDDIS 520

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 98/506 (19%), Positives = 187/506 (36%), Gaps = 58/506 (11%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKML 139
            LLN A     + +++ L+K++N      +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 140 IVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKN 199
            +      V S++  +     + A F   RA QG+  A ++P    L+  +      +K 
Sbjct: 98  TISCSCFAVLSLLCAVMPNFPAFAVF---RAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 200 IVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFY-AFGIATFLSLLMAWYSI----- 253
             I    +C  +                   +  +FY  F + T +S++  +++      
Sbjct: 155 FSIV---SCGFSSTIGLGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKL 211

Query: 254 ---PNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXXXXXXXXXXXX 310
              P     +    S+D+ GS + + G IL      +     W++P              
Sbjct: 212 NKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLVIGIILFF 270

Query: 311 XXXXYESKYAEVP-------------------LLPRAMTKNRHMIMILLAVFLGWGSFGI 351
               +   Y ++                    L+P  +   ++ I I+LA  L       
Sbjct: 271 GFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAFALNNACLFS 330

Query: 352 WTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDA 411
             +    +       SP+  G      +I   +     AF   +L P + +        A
Sbjct: 331 CLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALA 390

Query: 412 GSIMFSVLPV--EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNT 469
           GSI+   L +  E  +WK+ F+ QA++ FG+ + +P +  I   G P + +G+A  +  T
Sbjct: 391 GSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQT 450

Query: 470 VINYSASLCLGMGGTVEHQINK---SGNDLLK---GYRAAVYLGVGLASLGVVISVTYM- 522
                  +   +  +V   IN+     N + K   G++   Y  V + +LG +++   + 
Sbjct: 451 FGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVTAICIR 510

Query: 523 -----------LENLWNRHRKSEDRS 537
                      LE+  +R +   DR 
Sbjct: 511 DIPPLNDDMSDLESSVHRTKVEFDRE 536

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 98/493 (19%), Positives = 188/493 (38%), Gaps = 55/493 (11%)

Query: 77  MLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLK 136
           M++   +    T  L     +  ++  E    +W + ++ +    FI   GR+GDI G  
Sbjct: 31  MVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAGFIAFLGRVGDIIGNS 90

Query: 137 KMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHV---YKV 193
            + +       ++SI+S +    N+   F   RA QG+  A I+P+   L+  +   ++V
Sbjct: 91  VLFVSS---CFLFSILSLICAVVNNFGTFAVFRALQGIAAAGIVPSGYALIPTLSDEHEV 147

Query: 194 GSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFY-AFGIATFLSLLMAWYS 252
            SF        I +C  +             T     +  +FY  F +   +S++ +++S
Sbjct: 148 QSFFA------IVSCGFSTSFGIGFIIGGAFTLTRIGYKGIFYLTFAVMLVISII-SYFS 200

Query: 253 I---PNNVPTNIH---------GLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYXXX 300
           I    N  P              LS+D+ GS + I   IL      +     W KP    
Sbjct: 201 IGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGG-ESWKKPSAYV 259

Query: 301 XXXXXXXXXXXXXXYESKY---------AEVP-----------LLPRAMTKNRHMIMILL 340
                         +   Y         A  P           L+P+ +   ++ I I +
Sbjct: 260 TLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNYFRTIQVLIPKDVLMMKNFIPITV 319

Query: 341 AVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGP-- 398
           AVF  +G      +    +   +   SP+         V+   +    +A     + P  
Sbjct: 320 AVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVIAIKSDLISPRK 379

Query: 399 ALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQ 458
           A++L F +M   +  ++   L  +  YWK+ F  Q+++ FG  + FP S  IL    P +
Sbjct: 380 AVVLGFFIMFIGSIILIQLHLITDNLYWKIFFCSQSLIAFGAAIFFPYSLNILIGFAPDE 439

Query: 459 YQGMAGSLVNTVINYSASLCLGMGGTVEHQINK-SGNDLLKG-----YRAAVYLGVGLAS 512
           Y+G+A  ++ T   +   +   +  ++   IN+ SG     G     ++   Y  +  + 
Sbjct: 440 YKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKSGSAGIYKTRFQNCTYFTLASSV 499

Query: 513 LGVVISVTYMLEN 525
           +G++ +  ++ EN
Sbjct: 500 VGLISTAFFVKEN 512

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 4/125 (3%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISG 127
           K L FI   ++A  L+ A     + ++  +   FN       W + S+ +    FI   G
Sbjct: 21  KHLKFICI-LIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFG 79

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187
           R+GDI G   M+ V  VI  ++S++  +    N  AF +  RAFQG+  A I+P    LV
Sbjct: 80  RVGDIVGNGIMMCVFSVIFGIFSLLCAV--VPNFIAFTVF-RAFQGMAGAGIVPCAYALV 136

Query: 188 GHVYK 192
             +++
Sbjct: 137 NKMFQ 141

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
           N  WL+  + L+   F+L+ GRL +I G K+ L++  ++  + S+IS L   SNS A  I
Sbjct: 44  NIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISAL---SNSMATLI 100

Query: 167 TSRAFQGVG 175
           + R   G G
Sbjct: 101 SGRVVAGFG 109

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 52/107 (48%), Gaps = 13/107 (12%)

Query: 91  LCIM--NVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIV 148
           +CI   + + + FN  AN   WLMA + L    F+L+ GR+  + GLK  L+   VI   
Sbjct: 26  ICITLYDTIGQEFNDYAN-VGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEA 84

Query: 149 WSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGS 195
            S+++G    +NS    I +R   G G +       G+   VY VG+
Sbjct: 85  GSLMAG---AANSMGMLIGARVISGFGGS-------GIESLVYGVGT 121

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           IMN +++ F  E++ + W++ SF L   +F  + G+L D+ G K  L+V +   +V  + 
Sbjct: 63  IMNKVAEEFE-ESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCLF 121

Query: 153 SGLSKYSNSDAFFITSRAFQGVG 175
           + LS+  N   F I +RA  G+G
Sbjct: 122 TALSR--NLVEFSI-ARAVCGMG 141

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 71  MFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLG 130
           + I++  L   L     T    +++ ++  FN E ++ +W+  ++ L++ +F  + G++ 
Sbjct: 62  IIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKIS 120

Query: 131 DIYGLKKMLIVGYVIVIVWSIISGLSK 157
           DI+G + ++I+  +  I+  +I GLSK
Sbjct: 121 DIFGRRPLIIISNLFFILGCLICGLSK 147

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
           N  WL+  + L    F+L+ GRL +I G  + L++  +I  V S+IS L   SNS    I
Sbjct: 44  NIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISAL---SNSMGTLI 100

Query: 167 TSRAFQGVG 175
           + R   G G
Sbjct: 101 SGRLIAGFG 109

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 58  QDPTYFSS--FGK------ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQA 109
           QD   F S  FGK       L  + +  +A  L    +T    IMN +++ F  E++   
Sbjct: 27  QDCKIFDSDEFGKLQEVMPRLPMLLSLWMANFLASMDRTIIANIMNSVTEEFK-ESHRIQ 85

Query: 110 WLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSR 169
           W+  SF L +  F  I G+L D+ G + +L++ Y + ++  +++    Y+ +   F   R
Sbjct: 86  WVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFLLGCLVTA---YARNIWEFAFGR 142

Query: 170 AFQGVG 175
           A  G+G
Sbjct: 143 AICGIG 148

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 91  LCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWS 150
           + +   + + FN + N+  WL+  + L++  F L+ GR+  + GLK  L++  +I  + S
Sbjct: 64  VTLYETIGEKFN-DYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGS 122

Query: 151 IISGLSKYSNSDAFFITSRAFQGVG 175
           +I+ +   SNS    I  R   G G
Sbjct: 123 LIAAV---SNSMGMLIAGRVVAGAG 144

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 6/102 (5%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKML 139
            LLN AG    + ++  L +++       +W + S+ +    FI   GRLGDI G   + 
Sbjct: 40  DLLNVAG---VISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLF 96

Query: 140 IVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILP 181
            +   +  ++S++  + +   + A F   RA QG+  A I+P
Sbjct: 97  TISCFLFTLFSLLCAVVRDFPTFAVF---RALQGISAAGIVP 135

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           IMN +++ F SE++ + W+  SF L   +F  + G+L D+ G K  L++ Y  +++  ++
Sbjct: 58  IMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLL 116

Query: 153 SGLSK 157
           + L++
Sbjct: 117 TCLAR 121

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           +++ LS  ++      +W + S+ +    FI   GRLGDI G  ++  V      + S++
Sbjct: 51  LIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLL 110

Query: 153 SGLSKYSNSDAFFITSRAFQGVGIA 177
            GL    N +AF +  RA QG+  A
Sbjct: 111 CGL--MPNFEAFAVM-RALQGIAAA 132

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           I+  +S+ FN E +   WL+  + L      L+ GR   I G K  +++  +I  V S++
Sbjct: 66  IIETVSRDFN-EYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLV 124

Query: 153 SGLSKYSNSDAFFITSRAFQGVG 175
           S L   +NS    I  R   GVG
Sbjct: 125 SAL---ANSMNMLIGGRVISGVG 144

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
           N  WL+  + L+   F+L+ GRL +I G  + L++  VI  + S+IS L   SN+    I
Sbjct: 44  NIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISAL---SNTMGTLI 100

Query: 167 TSRAFQGVG 175
             R   G G
Sbjct: 101 GGRVIAGFG 109

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISG 127
           K L+   +  L   L  A  T    IM  ++  FN E    +W+  ++ L++ +F  + G
Sbjct: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYG 135

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLS 156
           +L DI+G K +L++  ++ +V  ++ GL+
Sbjct: 136 KLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 62/148 (41%), Gaps = 12/148 (8%)

Query: 51  VTNDSPWQD---------PTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSF 101
           +TND P ++         P    S+G++   +A   +    +  G       +  L K F
Sbjct: 35  MTNDKPIENNGTISRNEAPYTLLSYGQKWGMVALLTMCTFWSSLGSPIYYPALRQLEKEF 94

Query: 102 NSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNS 161
           N + +     +  + L  G     SG L DIYG + ++++G +I +  S+  GL+  SNS
Sbjct: 95  NIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAVSV--GLA-CSNS 151

Query: 162 DAFFITSRAFQGVGIAFILPNIMGLVGH 189
               +  R  Q   I+  +    G VG 
Sbjct: 152 YGVLVFLRILQSACISPTIAISSGFVGD 179

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 19/179 (10%)

Query: 94  MNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           +  L K FN + N     +  + L  G    +SG L D++G + +++ G VI +V SI  
Sbjct: 125 LRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASI-- 182

Query: 154 GLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHV---YKVGSFRKNIV-ISFIGACA 209
           GL+  + S       R  Q +GI+  +    G+VG     ++ G+F      +  +G C 
Sbjct: 183 GLA-CAPSYGVICFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGLVLLGQCF 241

Query: 210 PTXXXXXXXXXXXIVTEDPNQWPW--VFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSM 266
            +                  +W W  +F+   I + ++L++A +++P    T +  LS+
Sbjct: 242 GSLIGAVLTA----------RWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 86/446 (19%), Positives = 169/446 (37%), Gaps = 53/446 (11%)

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISG 127
           +  + +A+  L   L     T    +++ ++  FN E    +W+  ++ L++ +F  + G
Sbjct: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYG 196

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVG-------IAFIL 180
           +L DI+G + +L+   ++  + ++I G+   S +    +  R   G+G        +   
Sbjct: 197 KLSDIFGRRPLLVFSNLVFCLGALICGM---SKNLWVLVLGRFVAGIGGGGLTSMCSITT 253

Query: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGI 240
            +I+ L       G    N+      AC              +  +    W   F     
Sbjct: 254 TDIVPLRSRALYQGIC--NVFFGLGTACG--------GLVGGLFADRAVGWRMAFLVQVP 303

Query: 241 ATFLSL--LMAWYSIP-----------NNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQ 287
            T LS   +  + ++P            ++P       +DWTG+   ++ L  F  V + 
Sbjct: 304 LTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS- 362

Query: 288 APIVGWDKPYXXXXXXXXXXXXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLA---VFL 344
             + G D P+                 +E   A  P+LP    +NR ++   L+     +
Sbjct: 363 --LYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMM 420

Query: 345 GWGSFGIWTFYYVSFQLNLRHYSPVWTGGTY---FVFVIFGSMAAFFVAFSIKRLGPA-- 399
           G  + G +   Y +  LN+    P   G      F    FGS+ A    + +KR G    
Sbjct: 421 GMMTTGFYIPVYYASVLNM---GPTDIGKRIVPSFFSTAFGSLGA---GYYMKRTGKYYW 474

Query: 400 LLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQY 459
            LL F L+    G +  S +    S W+  + +  I  FG  +    + + L   +P ++
Sbjct: 475 FLLAFCLVGV-LGQVQISYVTPSISTWR-QYCLYMIPGFGSAVLLTVTLLALIVAVPQRH 532

Query: 460 QGMAGSLVNTVINYSASLCLGMGGTV 485
           Q    S+     +  ++L + +GG +
Sbjct: 533 QAATTSISYAFRSTGSTLGVSIGGAI 558

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F SE++ + W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 138 MLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVG 175
            L+  +    +  +++  ++  N   F I +RA  G+G
Sbjct: 103 ALLTAHFFFGIGCLLTCFAR--NVTEFSI-ARAICGIG 137

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 52  TNDSPWQDP--TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQA 109
           +N+ P  DP   Y  S  K  + + +  L   L+    T    IMN +++ FN+ +N + 
Sbjct: 47  SNNKPKLDPITKYNLSLSKGPI-LTSLWLGSFLSALDATIVAVIMNRVAEDFNA-SNQKQ 104

Query: 110 WLMASFPLAAGSFILISGRLGDIYGLK 136
           W+  S+ L   +F  + GRL DI G K
Sbjct: 105 WIATSYLLTNTAFQPLYGRLSDIIGRK 131

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F SE++ + W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 138 MLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVG 175
            L++      +  +++  ++  N   F I +RA  G+G
Sbjct: 103 ALLIAQFFFGLGCLLTCFAR--NVTEFSI-ARAICGIG 137

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 91  LCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWS 150
           + I+N ++  FN+ +    WL+  + L+   F L+ GR   I+G K  L+V  +I  + S
Sbjct: 41  VTILNTIADKFNAYSK-IGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 151 IISGLSKYSNSDAFFITSRAFQGVG 175
           ++  +   SNS    I  R   G G
Sbjct: 100 LVIAV---SNSMDMIIGGRVIAGCG 121

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 125 ISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIM 184
           ISG L D+YG + ++++G +I +  SI  GL+  SNS    +  R  Q  GI+ I+    
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASI--GLA-CSNSYGVIVFLRCLQSAGISPIIAINS 197

Query: 185 GLVG 188
           G+VG
Sbjct: 198 GVVG 201

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 61/143 (42%), Gaps = 3/143 (2%)

Query: 47  KSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEAN 106
           +S+ V +  P   P    S G++   +A    A   +  G       +  L K FN    
Sbjct: 63  ESSGVNSKLPQGAPFTLLSHGQKWFMVALLTSAGFWSSLGSPIYYPALKQLEKKFNVSEE 122

Query: 107 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFI 166
                +  + +  G    ISG L D+YG + ++++G +I +  SI  GL+  S S    +
Sbjct: 123 MVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGMLIYVCASI--GLA-CSQSYGVIV 179

Query: 167 TSRAFQGVGIAFILPNIMGLVGH 189
             R  Q  GI+ I+    G+VG 
Sbjct: 180 FLRCLQSAGISPIIAINSGVVGD 202

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 8/83 (9%)

Query: 125 ISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIM 184
           ISG L D+YG + +++ G +I +V SI  GL+  SNS    +  R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLA-CSNSYGVIVFLRCVQSAGISPLIAISS 208

Query: 185 GLVGHVYKVGSFRKNIVISFIGA 207
           G+VG  +   S R     SF+GA
Sbjct: 209 GVVGD-FTTKSERG----SFVGA 226

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 80  QLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKML 139
            LLN AG    + ++  L +++  E    +W + S+ +     I   GRLGDI G   + 
Sbjct: 44  DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLF 100

Query: 140 IVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILP 181
            +      ++ ++  +   +N  AF +  RA QG+  A ++P
Sbjct: 101 TISGFFFSLFCLLCAV--VTNFPAFAVL-RALQGIAAAGLVP 139

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/153 (18%), Positives = 67/153 (43%), Gaps = 8/153 (5%)

Query: 395 RLGPALLLCFSLMAFDAGSIMFSVLPV--EQSYWKLNFAMQAILCFGMDLSFPASSIILS 452
           +L P + +    ++   GSI+   L +  E  YWK+ F  Q ++ FG  + +P +  ++ 
Sbjct: 381 KLRPRIGVALGFLSMVCGSIILIQLHLVEENLYWKIMFCSQILVGFGAAIFYPYALKLVV 440

Query: 453 DGLPMQYQGMAGSLVNTV----INYSASLCLGMGGTVEHQINK--SGNDLLKGYRAAVYL 506
              P   +G+A  +  T     I  + S+ + + G +    ++  S      G++   Y 
Sbjct: 441 GDAPSGAKGIASGVTQTFAQLGIEMTFSVMVSVLGNITQVKSRPDSFERFRDGFQKCTYF 500

Query: 507 GVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539
            +   + G+V++  ++    ++     +  +LE
Sbjct: 501 TLASGAFGLVLTTFFVRGPRFSNGSPKDATALE 533

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 76/181 (41%), Gaps = 19/181 (10%)

Query: 8   KTSVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDPTYFSSFG 67
           KT+ +  + ++D + +  + D                   + Q+T ++  + P    S+G
Sbjct: 54  KTTTREIEGDLDSETSSHSSDDKVD--------------PTQQITAET--KAPYTLLSYG 97

Query: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISG 127
           ++   +A   +    +  G       +  L K FN + N     +  + L  G    +SG
Sbjct: 98  QKWGMVAILTMCGFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSG 157

Query: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187
            L D +G + +++ G +I ++ SI  GL+  + S    I  R  Q +GI+  +    G+V
Sbjct: 158 GLADCFGRRPIILAGMLIYVIASI--GLA-CAPSYGVIIFLRCIQSIGISPTIAISSGVV 214

Query: 188 G 188
           G
Sbjct: 215 G 215

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F SE++ + W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 138 MLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVG 175
            L+       +  +++  ++  N   F I +RA  G+G
Sbjct: 103 ALLTAQFFFGLGCLLTCFAR--NVTEFSI-ARAICGIG 137

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 97  LSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLS 156
           ++  FN E    +W+  ++ L++ +F  I G++ DI+G K +LI   +   V S+I GLS
Sbjct: 148 IASEFN-ELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 3/130 (2%)

Query: 60  PTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAA 119
           P    S+G++   +A   +    +  G       +  L K FN + N     +  + L  
Sbjct: 90  PYTLLSYGQKWGMVAILTMCGFWSSLGSPIYYPALRQLEKQFNVDENMINITVVVYLLFQ 149

Query: 120 GSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFI 179
           G    ISG L D +G + +++ G +I +V SI  GL+  + S    I  R  Q +GI+  
Sbjct: 150 GVSPTISGGLADCFGRRPIILAGMLIYVVASI--GLA-CAPSYGVIIFLRCIQSIGISPT 206

Query: 180 LPNIMGLVGH 189
           +    G+VG 
Sbjct: 207 IAISSGVVGD 216

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 16/130 (12%)

Query: 58  QDPTYFSSFGKELM--------FIATCMLAQLLNQAGQTHALCIMNVL----SKSFNSEA 105
           + P + S +GK  M         + TC  +  L        + I++ +    +K F + +
Sbjct: 54  KKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLALAIFLAALDIMIVSTIIEDVAKKFGAYS 113

Query: 106 NNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFF 165
               W+ A + L      L+ GR+  I G K  ++   +I  + S+ISG+   +NS    
Sbjct: 114 KT-GWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGV---ANSMNML 169

Query: 166 ITSRAFQGVG 175
           I  R   GVG
Sbjct: 170 IGGRVIAGVG 179

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 94  MNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           +  L + FN + N     +  + L  G    ISG L D+YG + +++ G +I +V SI  
Sbjct: 114 LKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI-- 171

Query: 154 GLSKYSNSDAFFITSRAFQGVGIA 177
           G++K + S    +  R  Q +GI+
Sbjct: 172 GIAK-APSYGVIVFLRCIQSIGIS 194

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 91  LCIM--NVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIV 148
           +CI   + + K FN  AN   WLM  + L     +L+ GR+  + GLK  L+   VI   
Sbjct: 26  ICITLYDTIGKVFNDYAN-VGWLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEA 84

Query: 149 WSIISGLSKYSNSDAFFITSRAFQGVG 175
            S+++ L   + S    I  R   G G
Sbjct: 85  GSLLAAL---ATSMGMLIGGRVIAGFG 108

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 3/96 (3%)

Query: 94  MNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           +  L K F+ + N     +  + L  G    + G L DIYG + +++ G ++ IV SI  
Sbjct: 126 LRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIAL 185

Query: 154 GLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGH 189
                +NS    I  R  Q  GI+ I+    G VG 
Sbjct: 186 AC---ANSYGVIIFLRCLQSCGISPIIAISSGCVGD 218

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           A GSF L  GRLGDIYG +  LIV  VI I+ ++I
Sbjct: 132 AIGSFFL--GRLGDIYGRRIGLIVASVIFIIGTVI 164

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 6/86 (6%)

Query: 93  IMNVLSKSFNSEANNQA---WLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVW 149
           I++  S    SE N  +   W+  S+ L++ +F  + G++ DI+G K +L+   V  ++ 
Sbjct: 130 IVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIG 189

Query: 150 SIISGLSKYSNSDAFFITSRAFQGVG 175
            ++ GLSK   S  + + +R   GVG
Sbjct: 190 CLMCGLSK---SFWWLVIARFVAGVG 212

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 62/148 (41%), Gaps = 9/148 (6%)

Query: 48  STQVTNDSPWQ------DPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSF 101
           S  V  DS  Q       P    S+G++   +A   +    +  G       +  L K F
Sbjct: 71  SGDVKGDSTQQITTEIGAPYTLLSYGQKWGMVAILTMCGFWSSLGSPIYYPALRQLEKQF 130

Query: 102 NSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNS 161
           N + N     +  + L  G    +SG L D +G + +++ G +I +V SI  GL+  + S
Sbjct: 131 NVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASI--GLA-CAPS 187

Query: 162 DAFFITSRAFQGVGIAFILPNIMGLVGH 189
               I  R  Q +GI+  +    G+VG 
Sbjct: 188 YGVIIFLRCIQSIGISPTIAISSGVVGD 215

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           IMN +++ F  E++ + W+  S+ L   +F  + G+L D+ G K  ++  +    +  + 
Sbjct: 60  IMNRVAEEFQ-ESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCL- 117

Query: 153 SGLSKYSNSDAFFITSRAFQGVG 175
             L+ ++NS   F  +RA  GVG
Sbjct: 118 --LTCFANSVTQFAIARAICGVG 138

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           IMN +++ F  E++ + W+  SF L   +F  + G+L DI G K  L+V +    +  ++
Sbjct: 74  IMNRVAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLL 132

Query: 153 SGLSK 157
           +  ++
Sbjct: 133 TCFAR 137

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 125 ISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIM 184
           ISG L D+YG + ++++G +I ++ SI    SK   +  F    R  Q  GI+ I+    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINS 193

Query: 185 GLVGHVYKVGSFRKNIVISFIGA 207
           G+ G  + V S R     +F+GA
Sbjct: 194 GVAGD-FTVKSERG----TFVGA 211

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 97  LSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLS 156
           ++  FN E  + +W+  ++ L++ +F  + G++ DI+G K +LI   V+  +  +I GLS
Sbjct: 156 IASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 94  MNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           +  L K FN + N     +  + +  G    +SG L DIYG + +++ G ++ +V SI  
Sbjct: 122 LKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRPVILFGMLVYVVASI-- 179

Query: 154 GLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGA 207
           G++   NS    I  R  Q  GI+ ++    G VG  + V + R     +F+GA
Sbjct: 180 GIAA-CNSYGVIIFLRCLQSTGISPLIAISSGAVGD-FTVKAERG----TFVGA 227

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 4/130 (3%)

Query: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120
           T FS   K L  +  C L+   +   QT     ++++ K FN   +     +  + L  G
Sbjct: 76  TRFSKHDK-LFLVVICALSGFYSTIAQTIYFPALSIIEKEFNVSVSLVNVTVVVYSLCQG 134

Query: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180
            F +I G L D  G + + +  + I++ +    G++    +    I  R  QG GI+ I+
Sbjct: 135 IFPVIMGGLADRLGRRPVAM--FCIMVYFCACIGIA-CCRTFGEMIFLRCLQGGGISPII 191

Query: 181 PNIMGLVGHV 190
               GL+G +
Sbjct: 192 AINNGLMGDI 201

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F SE++ + W+  SF L   +F  + G+L DI G + 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRP 102

Query: 138 MLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVG 175
            L+       +  +++  ++  N   F I +RA  G+G
Sbjct: 103 ALLTAQFFFGLGCLMTCFAR--NVTEFSI-ARAVCGIG 137

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 110 WLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSR 169
           W+  S+ L++  F  + G+L DI+G K +LI   +I     II G+   SNS    +  R
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGM---SNSLNMLVWGR 492

Query: 170 AFQGVG 175
              G+G
Sbjct: 493 FVAGIG 498

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 56/135 (41%), Gaps = 11/135 (8%)

Query: 48  STQVTNDSPWQDPTYFSSFGKELMF-------IATCMLAQLLNQAGQTHALCIMNVLSKS 100
           ++ V+  S  ++P   ++FG+           + + +L   L          I+  +S+ 
Sbjct: 14  ASSVSTGSVKEEPVRTNAFGQRFPTGVELWAPLGSLVLCLFLAALDVMTVSTIIEEVSQK 73

Query: 101 FNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSN 160
           F  + +   WL   + L     +LI GR+  + G K   +   VI  V S++S L   +N
Sbjct: 74  FG-DYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSAL---AN 129

Query: 161 SDAFFITSRAFQGVG 175
           S    I  R   G+G
Sbjct: 130 SMDMLIGGRVIAGIG 144

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 129 LGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVG 188
           L D YG + ++++G +I IV SI  G++  SNS A  I  R  Q  GI+ I+    G+VG
Sbjct: 128 LADTYGRRPVILMGMLIFIVSSI--GIA-CSNSFALVIALRCIQSSGISPIIAINSGVVG 184

Query: 189 HVYKVGSFRKNIVISFIGA 207
             + + S R     +FIGA
Sbjct: 185 D-FTLKSERG----TFIGA 198

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 4/82 (4%)

Query: 94  MNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           + V+++ F  + +   W+++ + L      L+ GR   I G K  L+V  +I    S+IS
Sbjct: 142 IEVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 154 GLSKYSNSDAFFITSRAFQGVG 175
            +   SNS    I  R   G+G
Sbjct: 201 AI---SNSMNMLIGGRVVAGIG 219

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           A GSF L  GRLGDIYG +  LIV  VI I  +II
Sbjct: 135 AIGSFFL--GRLGDIYGRRIGLIVASVIFIAGTII 167

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           A G F L  GRLGDIYG +  LIV  VI I+ S+I 
Sbjct: 130 AIGCFFL--GRLGDIYGRRIGLIVASVIFIIGSVIQ 163

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           I+  ++K F S +    WL   + L      LI GR+    G K+ ++   VI  + S+I
Sbjct: 90  IIEEVAKQFGSYSE-IGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLI 148

Query: 153 SGLSKYSNSDAFFITSRAFQGVG 175
           S L   +NS +  I  R   GVG
Sbjct: 149 SAL---ANSMSMLIGGRVIAGVG 168

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 3/67 (4%)

Query: 109 AWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITS 168
            WL+  + L    F L+ GRL  I GLK  L    VI  + S+I  +   SNS    I  
Sbjct: 45  GWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAV---SNSMGMIIGG 101

Query: 169 RAFQGVG 175
           R   G G
Sbjct: 102 RVVAGCG 108

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           I+  ++K F S +    WL   + L      LI GR+    G K+ ++   VI  V S+I
Sbjct: 99  IIEEVAKQFGSYSE-IGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLI 157

Query: 153 SGLSKYSNSDAFFITSRAFQGVG 175
           S L   +NS    I  R   GVG
Sbjct: 158 SAL---ANSMNVLIGGRVIAGVG 177

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F  E++ + W+  SF L   +F  + G+L DI G K 
Sbjct: 48  LGSFLSSLDSTIVANIMNKVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 106

Query: 138 MLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVG 175
            ++  +     + +   L+ ++ +   F  +RA  G+G
Sbjct: 107 AVLTSH---FFFGLGCFLTCFAQNITQFSIARAICGIG 141

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 94  MNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           +  L K F  + N     +  + L  G    ISG L D++G + ++++G +I +V SI  
Sbjct: 114 LRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASI-- 171

Query: 154 GLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGH 189
           GL+  + S    +  R  Q +GI+  +    G+VG 
Sbjct: 172 GLA-CAPSYGVIVFLRIIQSIGISPTIAISSGVVGD 206

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 127 GRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPN 182
           G +GD YG K   I+    ++V  II+G  K++    +F+ +RAF GV +  I  N
Sbjct: 131 GYIGDRYGRKVSFIINLFFMMVLEIITGFIKHNFK--YFLIARAFFGVVLGGIFGN 184

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           A GSF L  GRLGDIYG +  LIV   I IV ++I
Sbjct: 125 AIGSFFL--GRLGDIYGRRIGLIVASFIFIVGTVI 157

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 104 EANNQ-AWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSD 162
           +A++Q +W+  ++ L+  +F  + G+L DI+G K +LI+  +   +   I G S ++N+ 
Sbjct: 73  DASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNV 131

Query: 163 AFFITSRAFQGVG 175
               T R   G+G
Sbjct: 132 WVLSTGRFVAGIG 144

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 78  LAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F  E+  + W+  SF L   +F  + G+L DI G K 
Sbjct: 42  LGSFLSSIDSTIVANIMNKVAEEFQ-ESQEKQWIATSFLLTNTAFQPLYGKLSDITGRKF 100

Query: 138 MLIVG 142
            L+  
Sbjct: 101 ALLTA 105

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           A G F L  GRLGD+YG +  LIV  VI IV +II
Sbjct: 128 AIGCFFL--GRLGDMYGRRIGLIVAAVIFIVGNII 160

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGY 143
           IMN +++ F  E++ + W+  SF L   +F  + G+L DI G +  L+  +
Sbjct: 56  IMNRVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAH 105

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 8/116 (6%)

Query: 60  PTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAA 119
           PT F+ +   +  I +  LA L      T    I+  +++ F  + +   W+ A + L +
Sbjct: 49  PTGFTLYACVISLILSIFLAALDIMIVST----IIENVAREFG-DYSKTGWIYAGYSLPS 103

Query: 120 GSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVG 175
               LI GR+  + G K  ++   +I  V S+++ L   +NS    I  R   G+G
Sbjct: 104 ALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAAL---ANSMDMLIGGRVIAGLG 156

>ZYRO0D12628g Chr4 (1069722..1071425) [1704 bp, 567 aa] {ON} similar
           to gnl|GLV|CAGL0A01243g Candida glabrata CAGL0A01243g
           and weakly similar to uniprot|P25346 YCR098C
           Saccharomyces cerevisiae GIT1 Plasma membrane permease
           mediates uptake of the phosphatidylinositol metabolite
          Length = 567

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 5/108 (4%)

Query: 47  KSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEAN 106
           K  ++ +  P +    F  +G  L   A       +N +  T + C+  V    +   AN
Sbjct: 57  KEEELVDGQPRKKKRNFRKYGAILTTGAGLFSDGYINTSISTVSACLKRVYKDEY---AN 113

Query: 107 NQAWLMASFPLAAGSFI--LISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           + A    S    AG+ I  L  G   D Y  K  +++G  I+IV+SI+
Sbjct: 114 SSAMQNVSSIAFAGTVIGQLFFGWFADYYNRKVSMVIGTSIIIVFSIL 161

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 60/150 (40%), Gaps = 20/150 (13%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           I++V+++ F + +    WL+  + L      LI GR   I G +  LI+  +I    S+I
Sbjct: 60  IIDVVAEQFGNYSKT-GWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLI 118

Query: 153 SGLSKYSNSDAFFITSRAFQGVG------IAFILPNIMGLVGHVYKVGSFRKNIVISFIG 206
           + L+   N     I  R   GVG      + F++   M        VG   + +VIS + 
Sbjct: 119 AALASSMN---MLIFGRVVAGVGGSGLQTLCFVIGCTM--------VGERSRPLVISIL- 166

Query: 207 ACAPTXXXXXXXXXXXIVTEDPNQWPWVFY 236
           +CA               T     W W FY
Sbjct: 167 SCAFAVAAIVGPIIGGAFTTHVT-WRWCFY 195

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 80/423 (18%), Positives = 153/423 (36%), Gaps = 62/423 (14%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           ++  +   FNS  +  +W+  S+ L++ +   + G+L D  G K +L+    +  +  +I
Sbjct: 109 LLTHIGSEFNS-LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167

Query: 153 SGLSKYSNSDAFFITSRAFQGVG-------IAFILPNIM---------GLVGHVYKVGSF 196
            GL   SNS    +  R   G+G          I+ +++         GL   V+ +G+ 
Sbjct: 168 CGL---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTA 224

Query: 197 RKNIVISFIGACAPTXXXXXXXXXXXIVTEDPNQWPWVFYAFGIATFLS--LLMAWYSIP 254
              +V ++                          W   F      + LS  L++ +  +P
Sbjct: 225 SGGLVGAYF-----------------------RDWRLAFILQCPISVLSGILIVVYLELP 261

Query: 255 NNVPTNIHGL------SMDWTGSALAIIGLILFNFVWNQ-APIVGWDKPYXXXXXXXXXX 307
                +           +DW G+   I  L LF    +     V +              
Sbjct: 262 PRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLV 321

Query: 308 XXXXXXXYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFY---YVSFQLNLR 364
                   E + A  P+LP    ++R ++   LA +    S     FY   Y S  L ++
Sbjct: 322 FGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMK 381

Query: 365 HYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGP--ALLLCFSLMAFDAGSIMFSVLPVE 422
                      F  V FGS+ A      +KR G     LL F ++A  AG +   ++  +
Sbjct: 382 ATDVGKRAMPSFFSVAFGSLGA---GLYMKRTGKYYYFLLAFCVLAI-AGQVQIVLITPQ 437

Query: 423 QSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 482
              W+  + +Q +  FG+ +    + + +   +P ++     S+     +  A+L + +G
Sbjct: 438 MPVWR-QYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVG 496

Query: 483 GTV 485
             V
Sbjct: 497 AAV 499

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 93  IMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           IMN +++ F +E++ + W+  SF L   +F  + G+L DI G K  ++  +    +  + 
Sbjct: 66  IMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCL- 123

Query: 153 SGLSKYSNSDAFFITSRAFQGVG 175
             L+ ++ +   F  +RA  G+G
Sbjct: 124 --LTCFAQNVTQFSIARAICGMG 144

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 120 GSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           GSF L  GRLGD+YG +  LI+   I IV +II 
Sbjct: 123 GSFFL--GRLGDMYGRRIGLIIATTIFIVGTIIQ 154

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 93  IMNVLSKSFNSE---ANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLI 140
           I+  L  +  SE   +N  +W+  S+ L+  +F  + G+L D++G K +LI
Sbjct: 51  IVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLI 101

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 66/174 (37%), Gaps = 13/174 (7%)

Query: 5   FKKKTSVQGTDSEIDEKITVKAKDKXXXXXXXXXXXXXXXXXKSTQVTNDSPWQDPTYFS 64
              +  V+GT  +I EK+T    +K                 K ++    +P +  T  S
Sbjct: 13  LSDREVVEGTKEDIHEKVTGGILEKADSANSGANSVA-----KDSENGQAAPSEPETAIS 67

Query: 65  SFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANN---QAWLMASFPLAAGS 121
                  ++  C  +  L+       + I+  + ++  ++ N      WL+  + L    
Sbjct: 68  PLTGLRFYV--CFASLALSLFLAALDILIVGTIMETVAAKFNGYSMTGWLVTGYNLPNAL 125

Query: 122 FILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVG 175
             L+ GR G + G K  +++  VI  V S+I+     + S    I  R   G+G
Sbjct: 126 LSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAA---ATSMTMLIGGRVISGIG 176

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153
           A G F L  GRLGD+YG +  +IV  +I IV ++I 
Sbjct: 126 AIGCFFL--GRLGDMYGRRIAIIVASIIFIVGTVIQ 159

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSII 152
           A G F L  GRLGD+YG +  +I+  +I +V +II
Sbjct: 131 AIGCFFL--GRLGDMYGRRMAIIIASIIFVVGTII 163

>KLLA0B14949g Chr2 complement(1319529..1320071) [543 bp, 180 aa]
           {ON} no similarity
          Length = 180

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 58/144 (40%), Gaps = 14/144 (9%)

Query: 371 TGGTYFVFVIFGSM-AAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLN 429
           +  ++F+FV F S    FF+        P +LLCF   A  A  I     PV  S +   
Sbjct: 17  SATSFFMFVSFYSCDVTFFLH------SPCILLCFFPPAIPASCISCIPFPVTVSMFDTR 70

Query: 430 FAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQI 489
           F  Q  LC  +   +P  SI+ +D         + S   T++   A L + +  T  +  
Sbjct: 71  FFSQLPLCATVS-DYPLWSIVPTDS---SVTRTSHSYTFTILTNLAPLAIKLHPT--YTC 124

Query: 490 NKSGNDLLKGYRAAVYLGVGLASL 513
           N   + +L G  +  YL   +  L
Sbjct: 125 NPHFH-VLPGCHSLPYLSTPITCL 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,403,399
Number of extensions: 1865812
Number of successful extensions: 5822
Number of sequences better than 10.0: 169
Number of HSP's gapped: 5840
Number of HSP's successfully gapped: 181
Length of query: 540
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 426
Effective length of database: 40,409,475
Effective search space: 17214436350
Effective search space used: 17214436350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)