Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR278W (PGM3)8.840ON62262233670.0
Smik_13.4918.840ON62261730030.0
Suva_13.4668.840ON62262229620.0
Skud_13.4508.840ON62262228710.0
SAKL0D01474g8.840ON62462321700.0
TDEL0B005708.840ON63061821700.0
ZYRO0G14190g8.840ON61061621340.0
NCAS0C004108.840ON62562121140.0
Kpol_1068.88.840ON63262521110.0
KNAG0J002708.840ON62561921060.0
TPHA0I002508.840ON62962320840.0
TBLA0B032508.840ON64364120390.0
NDAI0K004108.840ON62661920310.0
CAGL0M02981g8.840ON61761620260.0
KAFR0B039208.840ON62462219660.0
Kwal_27.102588.840ON62063019370.0
KLTH0C03872g8.840ON62162319120.0
KLLA0D01573g8.840ON60763018370.0
ABL126W8.840ON62462918340.0
Ecym_46118.840ON63062818230.0
KNAG0E023902.445ON5695781101e-04
NCAS0F014702.445ON5693981064e-04
Smik_13.2912.445ON569601990.003
TDEL0E00210singletonON570296980.003
Suva_13.2822.445ON569247960.005
YMR105C (PGM2)2.445ON569569960.006
CAGL0B03597g6.11ON54030940.009
Skud_13.2632.445ON569569940.010
NDAI0H023502.445ON569247930.013
NCAS0F002006.11ON54954930.014
KAFR0L003406.11ON54052910.021
KLTH0D04796g2.445ON570596910.023
TDEL0G046006.11ON52828900.027
ZYRO0G02508g2.445ON569596900.029
TBLA0G009806.11ON55828900.032
NDAI0K028906.11ON56130890.037
CAGL0K07480g2.445ON567568880.047
Kpol_1032.26.11ON53928880.047
KLLA0B12694g2.445ON568595870.064
KAFR0D030102.445ON569296870.065
CAGL0K03421g2.445ON568296860.077
YEL058W (PCM1)6.11ON55728860.078
Smik_5.296.11ON55528860.079
TPHA0M002106.11ON54580860.082
Skud_5.316.11ON55728860.087
Suva_5.106.11ON55328860.087
TBLA0B090102.445ON569143860.089
TBLA0I013802.445ON571294860.10
ZYRO0F00506g6.11ON55024840.14
Kpol_1033.542.445ON570143840.17
TPHA0G029002.445ON569296830.19
KNAG0E009406.11ON53821830.21
Smik_11.1122.445ON570295820.25
SAKL0E00902g6.11ON54419820.27
KLLA0D00858g6.11ON54119820.28
Kwal_56.223556.11ON54120810.31
KLTH0C11506g6.11ON54420810.33
Kwal_26.76282.445ON57087800.50
Smik_5.2267.368ON575149790.54
ACR015W6.11ON55251790.64
Kpol_1031.311.229ON376133770.97
KNAG0A062802.445ON57082771.0
SAKL0E03630g2.445ON571130761.2
TDEL0A022102.445ON572250761.2
Ecym_30146.11ON55119761.6
CAGL0I10054g3.508ON743241733.0
Suva_11.982.445ON570141733.3
Smik_14.3341.426ON31763723.7
Ecym_13958.469ON56567723.9
KAFR0A042008.740ON26059714.3
NCAS0A043502.445ON569592724.4
AAR162C6.115ON117163715.9
Smik_4.7525.609ON87742707.0
Suva_14.3561.426ON317102697.1
Skud_2.237.413ON982113708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR278W
         (622 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...  1301   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...  1161   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...  1145   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...  1110   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   840   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   840   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   826   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   818   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   817   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   815   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   807   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   790   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   786   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   785   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   761   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   750   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   741   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   712   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   711   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   706   0.0  
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    47   1e-04
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    45   4e-04
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    43   0.003
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    42   0.003
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    42   0.005
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    42   0.006
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    41   0.009
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    41   0.010
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    40   0.013
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    40   0.014
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    40   0.021
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    40   0.023
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.027
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    39   0.029
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    39   0.032
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.037
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    39   0.047
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.047
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    38   0.064
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    38   0.065
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    38   0.077
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    38   0.078
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    38   0.079
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    38   0.082
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    38   0.087
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    38   0.087
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    38   0.089
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    38   0.10 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    37   0.14 
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    37   0.17 
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               37   0.19 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.21 
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    36   0.25 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    36   0.27 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.28 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.31 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    36   0.33 
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    35   0.50 
Smik_5.226 Chr5 (339164..340891) [1728 bp, 575 aa] {ON} YER087W ...    35   0.54 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    35   0.64 
Kpol_1031.31 s1031 (72969..74099) [1131 bp, 376 aa] {ON} (72969....    34   0.97 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               34   1.0  
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    34   1.2  
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    34   1.2  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    34   1.6  
CAGL0I10054g Chr9 complement(955545..957776) [2232 bp, 743 aa] {...    33   3.0  
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    33   3.3  
Smik_14.334 Chr14 complement(592266..593219) [954 bp, 317 aa] {O...    32   3.7  
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...    32   3.9  
KAFR0A04200 Chr1 complement(842429..843211) [783 bp, 260 aa] {ON...    32   4.3  
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    32   4.4  
AAR162C Chr1 complement(634067..637582) [3516 bp, 1171 aa] {ON} ...    32   5.9  
Smik_4.752 Chr4 complement(1328812..1331445) [2634 bp, 877 aa] {...    32   7.0  
Suva_14.356 Chr14 complement(615577..616530) [954 bp, 317 aa] {O...    31   7.1  
Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)    32   8.7  

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 1301 bits (3367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/622 (100%), Positives = 622/622 (100%)

Query: 1   MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL 60
           MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL
Sbjct: 1   MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL 60

Query: 61  RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL 120
           RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL
Sbjct: 61  RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL 240
           HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL
Sbjct: 181 HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL 240

Query: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
           KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360
           EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY
Sbjct: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360

Query: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420
           QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG
Sbjct: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480

Query: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540
           KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH
Sbjct: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540

Query: 541 KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK 600
           KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK
Sbjct: 541 KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK 600

Query: 601 LTWNVLRREWFRPDEMNIVTKF 622
           LTWNVLRREWFRPDEMNIVTKF
Sbjct: 601 LTWNVLRREWFRPDEMNIVTKF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/617 (87%), Positives = 590/617 (95%)

Query: 6   LETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQ 65
           LE VPS+LK+ ISLWF+QD+NP+TIEEVTALCKKSDWNELH+RFDSRIQFGTAGLRSQMQ
Sbjct: 6   LEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQ 65

Query: 66  AGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKV 125
           AGF+RMNTLV+IQASQGLATY +QQFP+NLVAVVGHDHRFHSKEFARATA AFLLKGFKV
Sbjct: 66  AGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKV 125

Query: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAI 185
           HYLNPDHEFVHTPLVPFAVDKLKASVGVM+TASHNPKMDNGYKVYYSNGCQIIPPHDHAI
Sbjct: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAI 185

Query: 186 SDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEVK 245
           SDSID NLEPWANVW+FDDVLNK LKQGKLMYSREE+LKLYL EVSKNLV  +PLK EVK
Sbjct: 186 SDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEVK 245

Query: 246 AKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGA 305
           AKPWFVYTPMHGVGFDIFSTIVKKT+ LVEGKDYLCVPEQQ PDPSFPTV FPNPEEKGA
Sbjct: 246 AKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGA 305

Query: 306 LDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYKS 365
           LD+GINLAE H I+LL+ANDPDADRFSVA+KD++SGEWRQLTGNEIGFLFA +E+QK+KS
Sbjct: 306 LDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKS 365

Query: 366 MDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPF 425
           M+K+FQH HPLAML+STVSSQMIKKMAE+EGFHYE+TLTGFKWIGNRAILLEK+GYYVPF
Sbjct: 366 MEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPF 425

Query: 426 GFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYNG 485
           GFEEAIGYMFPAMEHDKDG+SASIVFLQAYC+WKIDHNLDP+++LE+GFKKYGVFKEYNG
Sbjct: 426 GFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNG 485

Query: 486 YYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLP 545
           YY+V +P VT +IFDYIRN YTP+G SYPSSIG+EIEVL YRDLT GYQSDT NHKPTLP
Sbjct: 486 YYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLP 545

Query: 546 VDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNV 605
           +DP+SQMITVSA+PS+G+E EHIRFTIRGSGTEPK+KVYIEACA+EEQRA+FLAKLTWNV
Sbjct: 546 IDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNV 605

Query: 606 LRREWFRPDEMNIVTKF 622
           L+REWFRP++M+IVT F
Sbjct: 606 LKREWFRPEKMDIVTHF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/622 (85%), Positives = 582/622 (93%)

Query: 1   MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL 60
           M Q +LETVPSDLK PISLWF QDRNP+TIEEVT LCK SDW+ELHKRFD+RIQFGTAGL
Sbjct: 1   MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL 60

Query: 61  RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL 120
           RS+MQAGFSRMNTLV+IQA+QGLATY++QQFPDNLV VVGHDHRFHSKEFARATA AFLL
Sbjct: 61  RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL 240
           HDHAISDSID NLEPWANVW F DVLNKALKQGKLMYSREEML LY +EVSK LVE NPL
Sbjct: 181 HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL 240

Query: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
           KLE+KAKPWFVYTPMHGVGF+IFSTIVKKT+ LVEG+DYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360
           EEKGALDIG+ LAE+HDI+LLVANDPDADRFS+AVKD QS +WRQLTGNEIGFLFAF+E+
Sbjct: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360

Query: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420
           Q+YK+ D+EFQ  HPLAML+STVSSQMIKKMAE+EGF YEDTLTGFKWIGNRAI+LEK+G
Sbjct: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISA++V LQAYCKWKID NLDP+++LENGF+KYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480

Query: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540
           KEYNGYYVVP+P VT +IF+YIRNVYTP G  YP SIGEEIEV+YYRDLTTGYQSDT +H
Sbjct: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540

Query: 541 KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK 600
           KP LPVDPTSQMIT+S +PS+G+ NEHIRFTIRGSGTEPKLKVYIEACA+ E+RAS+LAK
Sbjct: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600

Query: 601 LTWNVLRREWFRPDEMNIVTKF 622
           LTW+VLRR WFRP+ MNI T F
Sbjct: 601 LTWDVLRRGWFRPEIMNITTDF 622

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1110 bits (2871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/622 (84%), Positives = 580/622 (93%)

Query: 1   MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL 60
           M Q  L T+PSDLK PISLWF QDR+P+TIEEVTALCKKSDW+ELHKRFD+RIQFGTAGL
Sbjct: 1   MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL 60

Query: 61  RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL 120
           RSQMQAGFSRMN LV+IQASQGLATY+RQQFP+NLVAVVGHDHRFHSK+FARATA AFLL
Sbjct: 61  RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNP  EFVHTPLVPFAVD+L ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL 240
           HD AIS++ID NLEPWAN W+FDD+L+K LKQGKLMYSREEMLKLYLE++S NLVE  PL
Sbjct: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240

Query: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
           KLEV++KPWFVYTPMHGVGFDIFSTIVKK++CLVEGKDYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360
           EEKGAL+IG+ LAEKHDI LL+ANDPDADRFSVA+KDMQSG W+QLTGNEIGFLFAF+E+
Sbjct: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEF 360

Query: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420
           +K+KSMD++FQ  HPLAML+STVSSQMIK+MAE+EGFHYEDTLTGFKWIGNRAI+LEK+G
Sbjct: 361 EKFKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISAS+VFLQAYCKWK+ +NLDP+NVLENGFKKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480

Query: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540
           KEYNGYY+VPNP VTK+IF YIR+VYTP    YP  IGEEI VL YRDLTTGYQSDT++H
Sbjct: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540

Query: 541 KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK 600
           KPTLPVDPTSQMITV ARP++ + NEHIRFTIRGSGTEPKLKVYIE  ANEE+RASFLAK
Sbjct: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600

Query: 601 LTWNVLRREWFRPDEMNIVTKF 622
           LTW+VLRREWFRP++ NI T F
Sbjct: 601 LTWDVLRREWFRPEKTNITTNF 622

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/623 (63%), Positives = 478/623 (76%), Gaps = 13/623 (2%)

Query: 8   TVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAG 67
           TVP DLK+ ++LW   D+NP+T  E+  L +   W ELH R D RI FGTAGLRS+M+AG
Sbjct: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66

Query: 68  FSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHY 127
           FSRMNTL V+QASQGLA+Y++ QFP+NL  +VGHDHR+HS EFAR T  AFL  GFKV+Y
Sbjct: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126

Query: 128 LN-----PDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           LN         FVHTP+VPF +++L AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 183 HAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKL 242
             IS++ID NL PW   WD D+V+  A++ G L   +E++   Y++ VS  LV +  L  
Sbjct: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246

Query: 243 EVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302
           +   KPWFVYTPMHGVGF+IF  I    L L EGK Y+CVPEQ+ PDP+FPTV FPNPEE
Sbjct: 247 D---KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303

Query: 303 KGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQK 362
           KGALD+ I LAE+ DI L++ANDPDADRFSVAVK+     W QLTGNEIGFLFA+Y++Q 
Sbjct: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361

Query: 363 YKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYY 422
           Y+ + + F+  HPLAM+NSTVSSQMIK +AE E FHYEDTLTGFKW+GNRA  LE +GYY
Sbjct: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421

Query: 423 VPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKE 482
           VPF +EEAIGYMFP +EHDKDGISA++VFLQ YC+W     + PL VL+ GF KYGVFKE
Sbjct: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481

Query: 483 YNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKP 542
           YNGYY+VP  ++TK++FDYIR  YTP G +YP +IG E  V+ +RDLTTGYQSDTI++ P
Sbjct: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541

Query: 543 TLPVDPTSQMITVSARPSNGSEN---EHIRFTIRGSGTEPKLKVYIEACANEEQRASFLA 599
            LPVD +SQMIT + RPSNG E+   E +RFTIRGSGTEPKLKVYIEA + +E+RA  LA
Sbjct: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601

Query: 600 KLTWNVLRREWFRPDEMNIVTKF 622
           + TW VLRREWFRP+   + TKF
Sbjct: 602 RETWQVLRREWFRPERTGLETKF 624

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/618 (63%), Positives = 483/618 (78%)

Query: 5   ILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQM 64
           ++ +VP+DL   ++ W  QD N +T  E+  LCK  DW ELHKR D+RI FGTAGLRS+M
Sbjct: 13  VINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRM 72

Query: 65  QAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFK 124
           +AGFSRMNTLVV+QA+QGLA ++++QFPD L AVVGHDHRF+S+EFA AT A FL  GFK
Sbjct: 73  EAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFK 132

Query: 125 VHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHA 184
           V +LN   +FVHTP+VPF V+++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD  
Sbjct: 133 VIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSE 192

Query: 185 ISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEV 244
           I+ SI+ NL  W   W +D++L + L    L+Y+ EEM++ Y +++ ++LV+   +  E 
Sbjct: 193 IAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEK 252

Query: 245 KAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKG 304
           + KPWFVYTP+HGVG+DIF  I ++T+ L+ G+DYLCV EQQ PDPSFPTV FPNPEEKG
Sbjct: 253 EGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKG 312

Query: 305 ALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYK 364
           ALD+ I++A+K+ I L++ANDPDADRFS AVKD ++G WRQLTGNEIG LFAFYE+QKY+
Sbjct: 313 ALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKYQ 372

Query: 365 SMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVP 424
             ++E++  HPLAMLNSTVSSQ+I KMAEIE FHY DTLTGFKWIGNR + LE   YYVP
Sbjct: 373 KKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVP 432

Query: 425 FGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYN 484
           FGFEEAIGYMFP MEHDKDGISA+ VFLQ Y KW +      L VLE+ F+KYGVFKEYN
Sbjct: 433 FGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYN 492

Query: 485 GYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTL 544
           GYY V +P V K++FD+IRN Y+     YPS IGEE++V  +RDLT GYQSDT+N +P L
Sbjct: 493 GYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDL 552

Query: 545 PVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWN 604
           PVDP SQMIT   + +     E +RFTIRGSGTEPKLKVYIEAC+  E+RAS LA+LTW 
Sbjct: 553 PVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWR 612

Query: 605 VLRREWFRPDEMNIVTKF 622
           VL+REWFRPD   + T F
Sbjct: 613 VLKREWFRPDVTGLTTTF 630

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/616 (63%), Positives = 480/616 (77%), Gaps = 12/616 (1%)

Query: 9   VPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAGF 68
           +P +LK PISLW  QDRN KT +E+  LC   +W+ELH+R +SR+QFGTAGLR++M+AGF
Sbjct: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64

Query: 69  SRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYL 128
           SRMNTLVVIQA+QGLA Y+++QFPD+LVAVVGHDHRF+S +FA+ATA   L  GF+VHYL
Sbjct: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124

Query: 129 NPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188
           N    +VHTP+VPF VD++KASVGVMITASHNPK+DNGYKVYY+NGCQIIPPHD AI+ S
Sbjct: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184

Query: 189 IDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLV-EINPLKLEVKAK 247
           I++NLEP   VWD+D  + +A  +GKL+Y R++ML+ Y+  V  + V E++ L    K K
Sbjct: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLP---KGK 241

Query: 248 PWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALD 307
           PWFVYTPMHGVG+ +F  I  K L L   +D+L V EQ NPDP FPTV FPNPEEKGALD
Sbjct: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301

Query: 308 IGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMD 367
           + I LAE H I L++A+DPDADRFSVA K      W+QL+GN+IGFLFA+YE QKY+  D
Sbjct: 302 LAIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRGFD 359

Query: 368 KEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGF 427
            E+Q  HPLAMLNSTVSSQMI  MA +EGFH+EDTLTGFKWIGNRA+ LE +GYYVPFGF
Sbjct: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419

Query: 428 EEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYNGYY 487
           EEAIGYMFPA EHDKDGISA++VFLQAY  W I     PL++L+    KYGVF+EYNGYY
Sbjct: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYY 478

Query: 488 VVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVD 547
           +V  P++T   F YIR  YTP+G +YP +IG +++V  +RDLTTGYQSDT N+ P L VD
Sbjct: 479 LVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVD 537

Query: 548 PTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNVLR 607
           P+SQMIT+ A+P  G   EH+RFT+RGSGTEPKLKVYIEA A  + RA  LA+ TW++LR
Sbjct: 538 PSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILR 597

Query: 608 REWF-RPDEMNIVTKF 622
            EWF RP    + TKF
Sbjct: 598 EEWFNRP---GLTTKF 610

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/621 (60%), Positives = 480/621 (77%), Gaps = 1/621 (0%)

Query: 3   QGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRS 62
           Q  L   P +L++PI+LW + D+N +T +EV  LC+  +W ELH+RFD+RI FGTAGLRS
Sbjct: 5   QSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRS 64

Query: 63  QMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKG 122
           +M+AGFSRMN+L+++Q++QGLA Y+++QFP+NL AVVGHDHRFHSKEFA  TA+ FL  G
Sbjct: 65  RMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAG 124

Query: 123 FKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           FKV YL PD +FVHTPLVPF+V  LKASVGVMITASHNPKMDNGYKVYY N CQIIPPHD
Sbjct: 125 FKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHD 184

Query: 183 HAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKL 242
             I++ I  NLEPW+  WD+D    K L+  KL++ ++ M + YL ++ + L+  + L L
Sbjct: 185 KNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSL 244

Query: 243 EVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302
           +    P+FVYTPMHGVG +IF+ +  + L L E  DYL V EQ+ PDPSFPTV FPNPEE
Sbjct: 245 KDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEE 304

Query: 303 KGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQK 362
           KGAL + I LA+++ + L++ANDPDADRFS AV + ++G+WRQLTGNEIGFL  +YE+Q 
Sbjct: 305 KGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQL 364

Query: 363 YKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYY 422
           Y+  D  F+  HPLAM+NSTVSSQMIK+MA++ GFHYEDTLTGFKWIGN+AI L ++GYY
Sbjct: 365 YEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYY 424

Query: 423 VPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKE 482
           VPFGFEEAIGYMFP ME DKDGISA+ VFLQAYC W   + + P +++E GF K+GVFKE
Sbjct: 425 VPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKE 484

Query: 483 YNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKP 542
           YNGYY++ + ++TK +FD+IR+ Y      YPS IG E+ V  +RDLT GYQS+T ++ P
Sbjct: 485 YNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIP 544

Query: 543 TLPVDPTSQMITVSARPSNGSENE-HIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKL 601
            LPVDPTSQMITV A+PS  S  E  +R T+RGSGTEPKLKVYIEAC+  E+ A+ LA+ 
Sbjct: 545 NLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARS 604

Query: 602 TWNVLRREWFRPDEMNIVTKF 622
           TW++L+REWFRP+   + T F
Sbjct: 605 TWDILKREWFRPEVTGLTTSF 625

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/625 (61%), Positives = 480/625 (76%), Gaps = 4/625 (0%)

Query: 2   LQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLR 61
              +LET+P DL+D +  W  QD+NP+TI EV  LCK +  NELHKRFD+RI FGTAGLR
Sbjct: 8   FDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLR 67

Query: 62  SQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLK 121
           S+M+AGFSRMNTLVV+QA+QGLATY++QQFP NL AV+GHDHR+HSKEFA    + FL  
Sbjct: 68  SKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSA 127

Query: 122 GFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181
           GF V+ LNP   FVHTPLVPF VD++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 
Sbjct: 128 GFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPV 187

Query: 182 DHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLK 241
           D +I+  ID NLEPW+N WD    +   L   KL+Y R EML  Y ++V  N+++   ++
Sbjct: 188 DASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIR 247

Query: 242 -LEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
             +   KPWFVYTPMHGVG++IF+++V + + L E +DYL V EQ  PDP+FPT+ FPNP
Sbjct: 248 EFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNP 307

Query: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360
           EEKGALD+ I LA+++DI L++ANDPDADRFS A+ +  SGEW+QLTGNEIGFLF +Y +
Sbjct: 308 EEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLF 367

Query: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420
            KY +MD EF+  HPLAMLNSTVSS+M+K MA+ E F + DTLTGFKWIGN+AI L+K+G
Sbjct: 368 NKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEG 427

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480
           Y+V FG+EEAIGYMFPAMEHDKDGI+AS+VFLQAY +W     +  +++LE G +KYG F
Sbjct: 428 YHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAF 487

Query: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540
           KEYNGYYVV NP VT DIF YIRN Y   G  YP  IG  +EV  +RDLTTG+QSDT+++
Sbjct: 488 KEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDN 547

Query: 541 KPTLPVDPTSQMITVSARPSNGS---ENEHIRFTIRGSGTEPKLKVYIEACANEEQRASF 597
            P+LPVDP+SQMIT++A+  +      +  +RFT+RGSGTEPKLK+YIE  + +   AS 
Sbjct: 548 IPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASK 607

Query: 598 LAKLTWNVLRREWFRPDEMNIVTKF 622
           +AKLTW+VL++EW RP+   + T +
Sbjct: 608 IAKLTWDVLKKEWIRPEVTGVTTSY 632

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/619 (62%), Positives = 473/619 (76%), Gaps = 2/619 (0%)

Query: 5   ILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQM 64
           IL+  P  L+  I  W + D+N +T  EV  LC++ DW+EL+ RF  RI FGTAGLRS+M
Sbjct: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67

Query: 65  QAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFK 124
           +AG +R+N+LV++QA+QGLA Y+  QFP N VAVVGHDHRFHSKEFA  TAA FL  GFK
Sbjct: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127

Query: 125 VHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHA 184
           V YLNP    VHTPLVPF VD L ASVGVMITASHNPKMDNGYKVY++NGCQIIPPHD  
Sbjct: 128 VLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187

Query: 185 ISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEV 244
           I+ SID NLEPW   WD+  V+  A K+ +++Y +++M +LY +     L+    +    
Sbjct: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNP 247

Query: 245 KAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKG 304
            + PWFVYTPMHGVG +IFS I +  L + E +DYLCVPEQ++PDPSFPTV FPNPEEKG
Sbjct: 248 GSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKG 307

Query: 305 ALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYK 364
           ALD  I LA ++ I+L++ANDPDADRFS+AV D ++  WRQLTGNEIGFLFA+ +++ YK
Sbjct: 308 ALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYK 367

Query: 365 SMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVP 424
           +MD  FQ  HPL +LNSTVSSQMIKKMAE+EGFHYEDTLTGFKWIGNRA  LEKKG++ P
Sbjct: 368 AMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAP 427

Query: 425 FGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYN 484
           FG+EEAIGYMF  MEHDKDGISAS++FL +Y  W  D +  PL++LE+G+KKYGVFKEYN
Sbjct: 428 FGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYN 487

Query: 485 GYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTL 544
           GYY+V NP + K+ FDYIRN   P G  YP +IG E +V+ +RDLT G+QSDT +H PTL
Sbjct: 488 GYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTL 546

Query: 545 PVDPTSQMITVSARPSNGS-ENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTW 603
           PVDP SQMITV A+P++ + E +H+RFTIRGSGTEPKLKVYIEAC+  E  A  LAK  W
Sbjct: 547 PVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMW 606

Query: 604 NVLRREWFRPDEMNIVTKF 622
           + L+  WFRP    +VT F
Sbjct: 607 DTLQEVWFRPQTTGLVTDF 625

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/623 (61%), Positives = 490/623 (78%), Gaps = 3/623 (0%)

Query: 2   LQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLR 61
           ++ +L ++P DLK+ I +WF+ D N +T++EV  LC     +ELHKRFD RI FGTAGLR
Sbjct: 8   IENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLR 67

Query: 62  SQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLK 121
           S+M+AGF+RMN L V+Q++QGLA+Y++ QFP NL AVVGHDHR+HSKEFA+ TAA FL  
Sbjct: 68  SRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNA 127

Query: 122 GFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181
           GFKV+YLNP+ EFVHTP+VPF ++   AS+GVMITASHNP+MDNGYKVYY+NGCQIIPPH
Sbjct: 128 GFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPH 187

Query: 182 DHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEIN-PL 240
           D  I++ I+ NLEP ++ W+ + V++KA++  KL+YS+E++L+ Y+  + K ++  N  L
Sbjct: 188 DKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISL 247

Query: 241 KLEVKAK-PWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPN 299
              +K K PWFVYTPMHGVG+ IF  I    L LVE  DY+CV EQ  PDPSFPTV FPN
Sbjct: 248 GTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPN 307

Query: 300 PEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYE 359
           PEEKGALD+GI  A+KH+IDL+VANDPDADRFSVAV++  + E++QLTGNEIGFLFA++ 
Sbjct: 308 PEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFL 367

Query: 360 YQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKK 419
           +++Y  +  +F+   PLAM+NSTVSSQMIKKMAE+EGF+YEDTLTGFKWIGN+A  LEK+
Sbjct: 368 WEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKE 427

Query: 420 GYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGV 479
           GYYVPFGFEEAIGYMFP ME DKDGI+A++VFLQAY  W +++     +++E GFKKYGV
Sbjct: 428 GYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGV 487

Query: 480 FKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTIN 539
           FKEYNGYY+V + ++TK IFD IR     +   Y S IG E +V+ +RDLT GYQSDTI 
Sbjct: 488 FKEYNGYYIVNDLSLTKIIFDNIRE-NKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIG 546

Query: 540 HKPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLA 599
           + PTLPVDP+SQMIT++  P++  EN  +RFTIRGSGTEPKLKVYIEA A  E  A+ LA
Sbjct: 547 NVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLA 606

Query: 600 KLTWNVLRREWFRPDEMNIVTKF 622
           KLTW+VL+REWF  ++  + T F
Sbjct: 607 KLTWDVLKREWFSSEKTGLTTNF 629

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/641 (59%), Positives = 480/641 (74%), Gaps = 24/641 (3%)

Query: 2   LQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLR 61
              +++  P DL+  + LW +QD++  T +E+  LCK ++  ELH+RFDSRI FGTAGLR
Sbjct: 7   FNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLR 66

Query: 62  SQMQAGFSRMNTLVVIQASQGLATYVRQQFPDN---LVAVVGHDHRFHSKEFARATAAAF 118
           S M+AGFSRMNTL V+QASQGLATY++    +    L+AV+GHDHR+HSKEFA+  A  F
Sbjct: 67  STMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVF 126

Query: 119 LLKGFKVHYLNPD-------HEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYY 171
           L+ GFKV+YLN D       ++FVHTP+VPF V  LKASVGVM+TASHNPKMDNGYKVYY
Sbjct: 127 LIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYY 186

Query: 172 SNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEV- 230
           SNGCQIIPPHD  IS  IDANLEPW N W++ +++  A  +G L+Y R+ ML  Y+ ++ 
Sbjct: 187 SNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLE 246

Query: 231 ----SKNLVEINPLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQ 286
               SK+++ ++  K++VK+KPWFVYTPMHGVG++IF+ I  + L + EG+D++ V EQ+
Sbjct: 247 EKLTSKDIIHLSK-KIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQK 305

Query: 287 NPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQS-GEWRQ 345
           +PDP FPTV FPNPEEKGA+D+GI LAE + I L++ANDPDADRFS+AVK   S G W Q
Sbjct: 306 HPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQ 365

Query: 346 LTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTG 405
            TGNEIG+LFA++E+QKYK      Q +H L M+NSTVSSQMIKKMAEIEGF+YE+TLTG
Sbjct: 366 FTGNEIGYLFAYFEFQKYKISK---QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTG 422

Query: 406 FKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLD 465
           FKWIGNRAI L  KG  VPFG+EEAIGYMFP ME DKDGI+A+++F+QA+  W     +D
Sbjct: 423 FKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMD 482

Query: 466 PLNVLENGFKKYGVFKEYNGYYVVPNPTVTKDIFDYIRNVY---TPEG-ASYPSSIGEEI 521
           P  +++ GFKKYGVF EYNGYY   +  +TK IFDY+R  Y     EG   YP  IGEE 
Sbjct: 483 PYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEF 542

Query: 522 EVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKL 581
           +++ YRDLTTGYQSDT ++KP LPVDP+SQMITV   P++   +  IR TIRGSGTEPKL
Sbjct: 543 KIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKL 602

Query: 582 KVYIEACANEEQRASFLAKLTWNVLRREWFRPDEMNIVTKF 622
           KVYIEAC+     ASFLAK  WNVL+REW RP++  I T F
Sbjct: 603 KVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/619 (61%), Positives = 471/619 (76%), Gaps = 1/619 (0%)

Query: 5   ILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQM 64
           I +  P++L++ I LW +QD+  +T  EV  LCK S+W ELHKRFDSRI FGTAGLRS+M
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 65  QAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFK 124
           +AGFSRMN LV++QASQGLA Y++ QFP NL AVVGHDHRFHSK+FA  TA+ FL  GFK
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127

Query: 125 VHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHA 184
           V+YLNP+  FVHTPLVPF+V+ L AS+GVMITASHNPKMDNGYKVYYSNGCQIIPPHD  
Sbjct: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187

Query: 185 ISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEV 244
           I+ +ID NLEPW++ W++D    K LK+ KL+Y REEM   YL+ +   LV  +  +   
Sbjct: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247

Query: 245 KAK-PWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303
             K PWFVYTPMHGVG++IF+ I K  L   E  DY  V EQ  PDP+FPTV FPNPEEK
Sbjct: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307

Query: 304 GALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKY 363
           GAL +   LAE+++I L++ANDPDADRFSVA K+ ++G+W+QL+GNEIGFLFA +E +KY
Sbjct: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367

Query: 364 KSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYV 423
            S D E++  HPLAM+NSTVSSQMIKKMA++E FHYEDTLTGFKWIGNRA+ L+ +GYYV
Sbjct: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427

Query: 424 PFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEY 483
           PFGFEEAIGYMFP M  DKDG+SA++VFL AY  W  +    P ++LE GFKK+G FKEY
Sbjct: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEY 487

Query: 484 NGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPT 543
           NGYY+  +P  TK IFD++R  Y   G  YP +IG+E ++  +RDLTTGYQS+TI++ P 
Sbjct: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547

Query: 544 LPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTW 603
           LPVDP S+MIT+ A P        +RFT+RGSGTEPKLK+YIEA A+ E+ A  LA   W
Sbjct: 548 LPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMW 607

Query: 604 NVLRREWFRPDEMNIVTKF 622
           NVL++EW RPD   + T F
Sbjct: 608 NVLKKEWIRPDVTGLTTTF 626

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/616 (60%), Positives = 468/616 (75%), Gaps = 6/616 (0%)

Query: 9   VPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAGF 68
           +P +L+  I  W + D+N +T  EV  LC   +W+ELHKRFDSRI FGTAGLR++M+AG 
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65

Query: 69  SRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYL 128
           +R+N LV++QASQGLATY++ +FP NL AVVGHDHR+HS+EFA+ TAA F+  GFKV+YL
Sbjct: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125

Query: 129 NPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188
           NP  EFVHTP+VP++VD L ASVGVMITASHNPKMDNGYKVYY+NGCQIIPPHDH I+++
Sbjct: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185

Query: 189 IDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEVKAKP 248
           I+ NLEPW+  W+F  +L+ A   GK+ Y R+ ML  YL  V   L++ +    +   KP
Sbjct: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD--EKP 243

Query: 249 WFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDI 308
           WFVYTPMHGVG  IFSTI+ ++L L +  DY+ VPEQ++PDPSF TV FPNPEEKGAL++
Sbjct: 244 WFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNL 303

Query: 309 GINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKY-KSMD 367
            I LAE + I L++ANDP+ADRFSVAV+D    EW+QLTGNEIG LFAFYE++ Y K+ D
Sbjct: 304 AITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAAD 363

Query: 368 KEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGF 427
           K  ++  PLAMLNSTVS+Q+IK+MAE EGF Y+DTLTGFKWIGN A  LE+KGY+VPFG+
Sbjct: 364 KGIKN-KPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGY 422

Query: 428 EEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYNGYY 487
           EEAIGYMFPAMEHDKDG+SA+IVFLQAY  W +  + +P++++   + KYGV  EYNGYY
Sbjct: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYY 481

Query: 488 VVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVD 547
           +V +P+ T  +F+ IR+ YT  G S+P SIGE   V  +RDLT G+ S T + KP LPVD
Sbjct: 482 IVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVD 541

Query: 548 PTSQMITVSARPSNGSEN-EHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNVL 606
             SQMIT++A PS  S   E +RFTIRGSGTEPKLKVYIE  ++ E RA  LAK  W  L
Sbjct: 542 KNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETL 601

Query: 607 RREWFRPDEMNIVTKF 622
           + EWF+P    + T F
Sbjct: 602 KHEWFKPSSNGLSTDF 617

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/622 (58%), Positives = 455/622 (73%), Gaps = 4/622 (0%)

Query: 1   MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL 60
           +L  I E VP  LK     W + D+N +T  E+  +  + DW EL  R + RI FGTAGL
Sbjct: 7   ILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGL 66

Query: 61  RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL 120
           R +M+AGF+RMN+LV++Q SQGLA Y+ ++FP NL  VVGHDHR+HSKEFA  T A FL 
Sbjct: 67  RGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLN 126

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
            GFKV YLN ++EFVHTPLVP++VDKL+++ GVMITASHNPK DNGYKVYYSNGCQIIPP
Sbjct: 127 AGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPP 186

Query: 181 HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL 240
           HD  I+ +I+ NL PW+  W++ D+ +   + G L ++  +M   Y++++++  V  N  
Sbjct: 187 HDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITR-YVFTNGS 245

Query: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
            +    KPWFVYTPMHGVG  IF  I K+ L L E  DY  VPEQ  PDPSFPTV FPNP
Sbjct: 246 PMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNP 305

Query: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360
           EEKGALD+ I LAE+  + L++ANDPDADRFS AVKD +S EWRQL+GNEIG LFA ++ 
Sbjct: 306 EEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKL 365

Query: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420
           Q++K   ++     PLAMLNSTVSSQM+KKMA++EGFHYE+TLTGFKWIGNRA+ LE++G
Sbjct: 366 QEHK---EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQG 422

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480
           Y V FG+EEAIGYMFP MEHDKDGI AS+VFL  Y KW     L PL+VL+  F+KYGVF
Sbjct: 423 YDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVF 482

Query: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540
            EYNGYY V  P + + +F YIR+ Y P+   YP  +G E  +  +RDLT GYQSDTI+ 
Sbjct: 483 SEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDF 542

Query: 541 KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK 600
           KPTLPVD +SQMIT + +P     +E IRFTIRGSGTEPKLKVYIE+ A  ++ A+ LA 
Sbjct: 543 KPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAH 602

Query: 601 LTWNVLRREWFRPDEMNIVTKF 622
           LTWNVLRREWFRP+   + T F
Sbjct: 603 LTWNVLRREWFRPEITGLKTSF 624

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/630 (57%), Positives = 460/630 (73%), Gaps = 19/630 (3%)

Query: 2   LQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLR 61
           ++ I   +P+DLK  +  WF+ D+N +T  E+  L  + +WNELHKR D RI FGTAGLR
Sbjct: 1   MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR 60

Query: 62  SQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLK 121
           S+M+AGFSRMNTL V+QASQGLA Y+ ++FP+N    VGHDHRF+S++FA  T+ AFL  
Sbjct: 61  SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL 120

Query: 122 GFKVHYL--NPD---HEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQ 176
            FKV+ L  N D     FVHTP+VPFA+D+L AS GVMITASHNPKMDNGYKVYYSNGCQ
Sbjct: 121 RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ 180

Query: 177 IIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVE 236
           IIPPHD  I+ SI  NL PW   WD   V+ +A ++G  +  ++ M+  Y++E+S  LV 
Sbjct: 181 IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS 240

Query: 237 INPLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVG 296
            +   +  ++KPWFVYTP+HGVGF+IF  I  + L LVEG+DY CV E + PDP+FPTV 
Sbjct: 241 SD---IGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVS 297

Query: 297 FPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFA 356
           FPNPEE GALD+ I LA+K+ I  ++ NDPDADRFS AVK    G+WRQLTGNEIGFLFA
Sbjct: 298 FPNPEEAGALDLAIALADKNGISFVLGNDPDADRFSAAVK--HQGKWRQLTGNEIGFLFA 355

Query: 357 FYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILL 416
            + ++KY+    EF+  +PLA++NSTVSSQMIKK+A +E FHYEDTLTGFKW+GNRA  L
Sbjct: 356 QFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQL 415

Query: 417 EKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKK 476
           E  GYYVPF +EEAIG+MF  + HDKDG+SA++VFLQ    WK    L P++VL++ F K
Sbjct: 416 ESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWK-KQALSPIDVLQSAFGK 474

Query: 477 YGVFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSD 536
           YGVFKEYNGYY VP+ ++T  IF  IR+ Y     SYP  IG + +V+ + DLT G+QSD
Sbjct: 475 YGVFKEYNGYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSD 530

Query: 537 TINHKPTLPVDPTSQMITVSARPS----NGSENEHIRFTIRGSGTEPKLKVYIEACANEE 592
           T ++ P LPVDP+SQMI  +  PS    +G+  E +RFT RGSGTEPKLKVYIEA + EE
Sbjct: 531 TADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEE 590

Query: 593 QRASFLAKLTWNVLRREWFRPDEMNIVTKF 622
            RAS LA+ TWNVLR EWF+P E  + TKF
Sbjct: 591 TRASDLARTTWNVLRDEWFKPKETGLSTKF 620

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/623 (57%), Positives = 454/623 (72%), Gaps = 19/623 (3%)

Query: 9   VPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAGF 68
           VP DLK  +  W K D+N +T +++  L +   W EL  R + RI FGTAGLRS+M+AGF
Sbjct: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68

Query: 69  SRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYL 128
           +RMNTL V+QASQGLA Y+   FPDNL  VVGHDHRF+SK+FA  T  AFL  GFKV+ L
Sbjct: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128

Query: 129 NPDHE-----FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDH 183
               +      VHTP+VPF +D L+AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188

Query: 184 AISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLE 243
            IS SI ANLEPW   WD   V  +A++   L+ +++ ++  Y++ V ++LV  N   + 
Sbjct: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN---VN 245

Query: 244 VKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303
               PWFVYTP+HGVGF+IF  I+     L +G+DYLCV EQ+ PDP+FPTV FPNPEEK
Sbjct: 246 HTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEK 305

Query: 304 GALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKY 363
           GALD  I LAEKHDI  ++ NDPDADRFSVA K   +G+WRQLTGNEIGFLFA Y+++ Y
Sbjct: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAK--HNGQWRQLTGNEIGFLFAQYKWETY 363

Query: 364 KSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYV 423
           +    +F+  +PLAM+NSTVSSQMIKKMAE+EGFHYEDTLTGFKW+GNRA  LE  GY+V
Sbjct: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423

Query: 424 PFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEY 483
           PF +EEAIGYMF  + HDKDGISA++VFLQ    WK    L P +VL+  ++KYGVFKEY
Sbjct: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKA-QALTPFDVLQRAYQKYGVFKEY 482

Query: 484 NGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPT 543
           NGYY+VP+ ++T  +F  IR+ ++ +    P+ IG+E  V  Y DLTTGYQS+T + +P 
Sbjct: 483 NGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPR 538

Query: 544 LPVDPTSQMITVSARPSNGSE----NEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLA 599
           LPVDP+SQMIT +  P++ +     +E +RFT RGSGTEPKLKVYIEA ++ E+ AS LA
Sbjct: 539 LPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALA 598

Query: 600 KLTWNVLRREWFRPDEMNIVTKF 622
           K  W+VLRREWF+P++  + T F
Sbjct: 599 KKAWDVLRREWFKPEQTGLATNF 621

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/630 (56%), Positives = 452/630 (71%), Gaps = 41/630 (6%)

Query: 5   ILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQM 64
           ++E++PSDL+  +  W K D+  +T  E+  LC K D  ELHKR D+ I FGTAGLR +M
Sbjct: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65

Query: 65  QAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFK 124
           +AGF+RMN L V QASQGLA Y+++QFP+NL  VVGHDHR +S+ F + T   FL  GFK
Sbjct: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125

Query: 125 VHYLNPDHE--FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           V +LN ++E   VHTPLVPF V+   ASVG+MITASHNPKMDNGYKVYY+NGCQIIPPHD
Sbjct: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185

Query: 183 HAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVE--INPL 240
             I++SI  NLEP++           + + G ++  +E+M K Y++ +   L++  +N  
Sbjct: 186 KLIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKK 234

Query: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
             E    PWFVYTPMHGVGF+IF +I K+ L L EGKDYL V EQ+ PD  FPTV FPNP
Sbjct: 235 TNE----PWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNP 290

Query: 301 EEKGALDIGINLAEKHD-IDLLVANDPDADRFSVAVKDMQ---SGEWRQLTGNEIGFLFA 356
           EEKGALD+ +    K+D +DL++ANDPDADRFSVAV+D     +  WRQLTGNEIGFLFA
Sbjct: 291 EEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFA 350

Query: 357 FYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILL 416
           +YE+++YK    +     PLAMLNSTVSSQMIK+MAEIEGFHYEDTLTGFKW+GNRA+ L
Sbjct: 351 YYEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALEL 406

Query: 417 EKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKK 476
           E++GYY PF +EEAIGYMF ++ HDKDGISA+IVFLQAY KW+       L++L     K
Sbjct: 407 EQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQT-VLDILATASLK 465

Query: 477 YGVFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSD 536
           YG FKE+NGYY+VP+  +TK +FD IR++ +P    YP  +G   E++ +RDLT GYQSD
Sbjct: 466 YGHFKEFNGYYIVPDLAITKQVFDAIRSIESP----YPKKLGSSFEIIKFRDLTNGYQSD 521

Query: 537 TINHKPTLPVDPTSQMITVSA----RPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEE 592
           T +H P L  DP+SQMIT       +P++      +RFTIRGSGTEPKLKVYIEA  N E
Sbjct: 522 TPDHIPELASDPSSQMITCEMLLVEQPTS-----RVRFTIRGSGTEPKLKVYIEARTNTE 576

Query: 593 QRASFLAKLTWNVLRREWFRPDEMNIVTKF 622
             +  LAK TW+VLR+EWF+P+   ++T F
Sbjct: 577 PNSIALAKFTWDVLRQEWFKPELTGLLTPF 606

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/629 (56%), Positives = 438/629 (69%), Gaps = 23/629 (3%)

Query: 7   ETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQA 66
           + VPS LKD +  W   D+N +T  E+  L     W+EL KR   RI FGTAGLR++M+A
Sbjct: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65

Query: 67  GFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVH 126
           GFSRMNTL VIQASQGLA Y++ QFPD+L  V+GHDHRFHS+EFA AT AAFL   + ++
Sbjct: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125

Query: 127 YLN------PDHEFVHTPLVPFAVDKLKA---SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           YLN       +  FVHTP+VPFA++ ++    S GVMITASHNPKMDNGYKVYY+NGCQI
Sbjct: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185

Query: 178 IPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEI 237
           IPPHD  I   IDANLEPW   WD   ++ +A+K GKL   R+EML+ Y + +   LV+ 
Sbjct: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245

Query: 238 NPLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGF 297
           + LK      PWFVYTPMHGVG++ F   V   L + E KDY+ VPEQ+ PDP FPTV F
Sbjct: 246 SNLKF--AGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSF 303

Query: 298 PNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAF 357
           PNPEE+GALD+ + +A+ + I +++ANDPDADRFSVAVK    GEW QLTGN+IG LFA 
Sbjct: 304 PNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILFAQ 361

Query: 358 YEYQKY---KSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAI 414
            E Q Y     +D++      LAML S VSSQ+++KMAE EGF   +TLTGFKW+GNRA 
Sbjct: 362 AEMQSYFKEPKLDRK-----QLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAR 416

Query: 415 LLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGF 474
            LE +GYYVPF +EEAIGYMF  + HDKDGI+A+ VFLQ   +WK         VL+  +
Sbjct: 417 ELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVLQECY 475

Query: 475 KKYGVFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQ 534
           +KYG F +YNGYY+   P VTK++FDY RN YTP G  YPS IG E EV Y RDLT GYQ
Sbjct: 476 EKYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQ 535

Query: 535 SDTINHKPTLPVDPTSQMITVSARPSN-GSENEHIRFTIRGSGTEPKLKVYIEACANEEQ 593
           SDT  + P LPVD  SQMIT   +P    ++ E +RFT RGSGTEPKLKVYIE+CA   Q
Sbjct: 536 SDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQ 595

Query: 594 RASFLAKLTWNVLRREWFRPDEMNIVTKF 622
           RAS L+ L W+VL+REWFRP E  + T F
Sbjct: 596 RASHLSHLAWDVLKREWFRPTETGLQTNF 624

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/628 (55%), Positives = 446/628 (71%), Gaps = 20/628 (3%)

Query: 7   ETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQA 66
           E +P DL+D I  WFK D+NP+T  E+ +L    +WNEL  R   RI FGTAGLR++M+A
Sbjct: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70

Query: 67  GFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVH 126
           GF+RMNTL VIQASQGLATY++ QFP+NL  VVGHDHR++SK FA    AAFL  GF+V+
Sbjct: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130

Query: 127 YLN--PDHE----FVHTPLVPFAVDKLK--ASVGVMITASHNPKMDNGYKVYYSNGCQII 178
           YLN  P ++    +VHTP+VPF V  ++  AS G+MITASHNPKMDNGYKVYYSNGCQI 
Sbjct: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190

Query: 179 PPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEIN 238
           PPHD  I+  IDANL PW   WD   ++  A    +L   ++E++K Y++ +  +LV  N
Sbjct: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN 250

Query: 239 PLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFP 298
              L    K WFVYTPMHGVG++IF+ IV  TL L E + YL V  Q+ PDP F TV FP
Sbjct: 251 --SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308

Query: 299 NPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFY 358
           NPEE+GAL++ I LA +   +L++ANDPDADRFS AVKD    +W+QLTGN++G+LFA  
Sbjct: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVG 366

Query: 359 EYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEK 418
           + +K+ + +   ++  PLAML STVSSQMI KMA++EGF + +TLTGFKW+ NRAI LE 
Sbjct: 367 QLEKFSNQN---ENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEN 423

Query: 419 KGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYG 478
            G+YVPF +EEAIGYMF ++ HDKDG+SA+  FLQ   +WK +    PL+VL  G++KYG
Sbjct: 424 DGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGYEKYG 482

Query: 479 VFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTI 538
            F EYNGYY V + ++  D+F YIRN        YPS+IG E  V  +RDLT GYQSDT 
Sbjct: 483 NFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTG 542

Query: 539 NHKPTLPVDPTSQMITVSARP----SNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQR 594
           NH P LPV P S MIT   +P    +  + ++++RFTIRGSGTEPKLKVYIE+ A +++ 
Sbjct: 543 NHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEY 602

Query: 595 ASFLAKLTWNVLRREWFRPDEMNIVTKF 622
           A+ LAKLTW+VL+REWFRP+   + TKF
Sbjct: 603 ATKLAKLTWDVLKREWFRPEVTGLQTKF 630

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 133/578 (23%), Positives = 234/578 (40%), Gaps = 89/578 (15%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDNL---VAVVGHDHRFHSKEFA 111
           GT+GLR +     +  + T   IQA       V +  P+       VVG D R+++    
Sbjct: 19  GTSGLRKKTAVFTNEPHYTENFIQA-------VMEAIPEGCKGATLVVGGDGRYYNDVIL 71

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMITASHN---PKMDNG 166
              AA     G +   +   +  + TP     +   K K + G+++TASHN   PK D G
Sbjct: 72  HKIAAIGAANGVRKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFD----DVLNKALKQGKLMYSREEM 222
            K   SNG     P  + I + +   L+ +  + D      D L + ++ G L+    + 
Sbjct: 131 IKYNLSNGGPAPEPVTNKIWE-VSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVDT 189

Query: 223 LKLYLEEVSKNLVEINPLKL----EVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVEGK 277
            + Y+E + K + +   +K     +   K W  ++  M+GV       I      L   +
Sbjct: 190 TRDYVEFL-KEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVTGPYGKAIFVDEFELPAEE 248

Query: 278 DYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKD 337
               V +  +P P F  +  P+P    A  + ++  ++ +I+   A+D D DR  +    
Sbjct: 249 ----VLQNWHPQPDFGGI-HPDPNLTYARSL-VDRVDRENIEFGAASDGDGDRNMI---- 298

Query: 338 MQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGF 397
             +G      G+ +  +  +     Y +     Q ++ LA    T S+  I ++AE  G 
Sbjct: 299 YGAGPAFVSPGDSVAIIAEYAAEIPYFAK----QGIYGLARSFPTASA--IDRVAEKHGL 352

Query: 398 HYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQ---A 454
              +  TG+K+    A+   KK   +    EE+ G     +  +KDG+ A I +L     
Sbjct: 353 KCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIIAWLNLLAI 406

Query: 455 YCKWKIDHNLDPLNVLENGFKKYG--VFKEYNGYYVVPNPTVTKDIFDYIRNVYTPE--- 509
           Y +   D ++    + E  +KKYG   F  Y+  +V  N    K + D +R+ YT +   
Sbjct: 407 YNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSNS--AKKVIDNLRS-YTEKPGV 463

Query: 510 -GASYPSSIG---EEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSEN 565
            G+ +P+       E     Y+DL                    S+   +  R SNG+  
Sbjct: 464 VGSKFPTDTTLTVTESGDFSYKDLDGS----------------VSEHQGLYVRLSNGA-- 505

Query: 566 EHIRFTIRGSGTEPK---LKVYIEACANEEQRASFLAK 600
              RF +R SGT      +++Y+E   ++E +    A+
Sbjct: 506 ---RFVVRLSGTGSSGATIRLYLEKYCDDESKYGLTAE 540

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 98/398 (24%), Positives = 165/398 (41%), Gaps = 42/398 (10%)

Query: 98  VVGHDHRFHSKEFARATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMI 155
           VVG D R+++       AA     G K   +      + TP     +     K   G+++
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGVKKLVIG-QRGLLSTPAASHIMRTYEEKTQGGIIL 116

Query: 156 TASHNP---KMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNK 208
           TASHNP   K D G K   SNG     P  + I + I   +  +  + DF ++    L K
Sbjct: 117 TASHNPGGIKNDMGIKFNLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPELELETLGK 175

Query: 209 ALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEV----KAKPW-FVYTPMHGVGFDIF 263
             K G L+    +  K Y+E V K + + + +K  V      K W  ++  M+GV     
Sbjct: 176 NKKYGPLLVDVIDTTKAYVEFV-KQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYG 234

Query: 264 STIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVA 323
             I    L L   +    V +Q +P P F  V  P+P    A  + ++  ++ +I+   A
Sbjct: 235 KAIFVDELGLPADE----VLQQWHPSPDFGGV-HPDPNLTYAKAL-VDRVDRENIEFGAA 288

Query: 324 NDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTV 383
           +D D DR  +      +G      G+ +  +  +     Y +     Q ++ LA   S  
Sbjct: 289 SDGDGDRNMI----YGAGPAFVSPGDSVAIIAEYAAEIPYFAK----QGIYGLA--RSFP 338

Query: 384 SSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKD 443
           +S  I ++A+  G +  +  TG+K+    A+   KK   +    EE+ G     +  +KD
Sbjct: 339 TSSAIDRVAKAHGLNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKD 392

Query: 444 GISASIVFLQ---AYCKWKIDHNLDPLNVLENGFKKYG 478
           GI A + +L     Y K   D ++    + +  + KYG
Sbjct: 393 GIWAILAWLNLLAIYNKHHPDRDVSIKIIQDEFWNKYG 430

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 138/601 (22%), Positives = 239/601 (39%), Gaps = 100/601 (16%)

Query: 56  GTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDN---LVAVVGHDHRFHSKEFAR 112
           GT+GLR + +    + N       ++     + +  P+       VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 113 ATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNGY 167
             AA     G K   +   H  + TP     +     K + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGVKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNKALKQGKLMYSREEML 223
           K   SNG        + I D I   L  +  + DF ++    + K  K G L+    ++ 
Sbjct: 132 KYNLSNGGPAPESVTNVIWD-ISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDIIDIT 190

Query: 224 KLYLEEVSKNLVEINPLKL-------EVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVE 275
           K Y++     L EI   KL       +   K W  ++  M+GV       I      L  
Sbjct: 191 KDYVD----FLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPA 246

Query: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAV 335
            +    V +  +P P F  +  P+P    A  + +   ++  I+   A+D D DR     
Sbjct: 247 DE----VLQNWHPSPDFGGM-HPDPNLTYASTL-VKRVDREKIEFGAASDGDGDR----- 295

Query: 336 KDMQSGEWRQLT--GNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAE 393
            +M  G        G+ +  +  +     Y +     Q ++ LA   S  +S  I ++A+
Sbjct: 296 -NMIYGYGPSFVSPGDSVAIIAEYAAEIPYFAK----QGIYGLA--RSFPTSAAIDRVAK 348

Query: 394 IEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQ 453
             G +  +  TG+K+    A+   KK   +    EE+ G     +  +KDG+ A + +L 
Sbjct: 349 AHGLNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIMAWLN 402

Query: 454 AYCKWKIDH--NLDPLNVLENGF-KKYG--VFKEYNGYYVVPNPTVTKDIFDYIRNVYTP 508
               +   H  N   +  ++N F  KYG   F  Y+ +  V +    K I D ++   T 
Sbjct: 403 ILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYD-FEKVESQKANK-IVDQLKAYVTK 460

Query: 509 EG---ASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSEN 565
            G   +++P+   E ++V    D +      +++    L V           + SNG+  
Sbjct: 461 SGVVSSAFPAD--ESLKVTDCGDFSYTDLDGSVSDHQGLYV-----------KLSNGA-- 505

Query: 566 EHIRFTIRGSGTEPK---LKVYIEA-CANEEQRASFLAKLTWNVLRREWFRPDEMNIVTK 621
              RF +R SGT      +++YIE  C +E Q         ++    E+ +P  +N V K
Sbjct: 506 ---RFVLRLSGTGSSGATIRLYIEKYCDDESQ---------YHKTAEEYLKP-IINSVIK 552

Query: 622 F 622
           F
Sbjct: 553 F 553

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 125/296 (42%), Gaps = 37/296 (12%)

Query: 56  GTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFAR 112
           GT+GLR +       MN    +  ++     +    P+   + + VVG D R+++ +  +
Sbjct: 17  GTSGLRKKTAV---FMNN---VHYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 113 ATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAV------DKLKASVGVMITASHN---PKM 163
             AA     G +   +   H  + TP     +      D  K + G+++TASHN   P+ 
Sbjct: 71  IIAAISAANGVRKLVIG-QHGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEN 129

Query: 164 DNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQ----GKLMYSR 219
           D G K   SNG        +AI D I   L  +  V  F ++ N ++K     G L+   
Sbjct: 130 DIGIKYNLSNGGPAPESVTNAIWD-ISKKLTHYKIVKGFPEI-NLSVKGEKSYGSLVIDV 187

Query: 220 EEMLKLYLEEVSKNLVEINPLK----LEVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLV 274
            +  + Y++ + K + + + +K     +   K W  ++  ++GV       I    L L 
Sbjct: 188 VDTTQEYVDFL-KGIFDFDLIKKFVDTQRSTKNWKLLFDGLNGVTGPYGRAIFVDELGLP 246

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADR 330
           E +    V +  +P P F  +  P+P    A  + ++  +K  I+   A+D D DR
Sbjct: 247 ENE----VLQNCHPKPDFGGI-HPDPNLTYARTL-VDRVDKEKIEFGAASDGDGDR 296

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 103/247 (41%), Gaps = 23/247 (9%)

Query: 98  VVGHDHRFHSKEFARATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMI 155
           VVG D R+++       AA     G K   +   H  + TP     +     K + G+++
Sbjct: 58  VVGGDGRYYNDVILHKIAAISAANGVKKLVIG-QHGLLSTPAASHIMRTYEDKCTGGIIL 116

Query: 156 TASHN---PKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNK 208
           TASHN   P+ D G K   SNG        +AI + I   L  +  V DF ++    + K
Sbjct: 117 TASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIVKDFPELDLQTIGK 175

Query: 209 ALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKL----EVKAKPW-FVYTPMHGVGFDIF 263
             K G L+    ++ K Y+ E+ + + + N +K     +   K W  ++  M+GV     
Sbjct: 176 DRKYGPLLIDIIDVTKAYV-ELMEEIFDFNLIKKFIDNQRSTKNWKLLFDSMNGVTGPYG 234

Query: 264 STIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVA 323
             I      L   +    V +  +P P F  +  P+P    A  + +   ++  I+   A
Sbjct: 235 KAIFVDKFGLPAEE----VLQNWHPSPDFGGM-HPDPNLTYASSL-VKRVDREQIEFGAA 288

Query: 324 NDPDADR 330
           +D D DR
Sbjct: 289 SDGDGDR 295

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 129/569 (22%), Positives = 228/569 (40%), Gaps = 84/569 (14%)

Query: 56  GTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDN---LVAVVGHDHRFHSKEFAR 112
           GT+GLR + +      N       ++     + +  P+       VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDEPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 113 ATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNGY 167
             AA     G K   +   H  + TP     +     K + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGIKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNKALKQGKLMYSREEML 223
           K   SNG        +AI + I   L  +  + DF ++    + K  K G L+    ++ 
Sbjct: 132 KYNLSNGGPAPESVTNAIWE-ISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDIIDIT 190

Query: 224 KLYLEEVSKNLVEINPLKL----EVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVEGKD 278
           K Y+  + K + + + +K     +   K W  ++  M+GV       I      L   + 
Sbjct: 191 KDYVNFL-KEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE- 248

Query: 279 YLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDM 338
              V +  +P P F  +  P+P    A  + +   ++  I+   A+D D DR      +M
Sbjct: 249 ---VLQNWHPSPDFGGM-HPDPNLTYASSL-VKRVDREKIEFGAASDGDGDR------NM 297

Query: 339 QSGEWRQLT--GNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEG 396
             G        G+ +  +  +     Y +     Q ++ LA   S  +S  I ++A+  G
Sbjct: 298 IYGYGPSFVSPGDSVAIIAEYAAEIPYFAK----QGIYGLA--RSFPTSGAIDRVAKAHG 351

Query: 397 FHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYC 456
            +  +  TG+K+    A+   KK   +    EE+ G     +  +KDG+ A + +L    
Sbjct: 352 LNCYEVPTGWKFF--CALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIMAWLNILA 405

Query: 457 KWKIDH--NLDPLNVLENGF-KKYG--VFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEG- 510
            +   H  N   +  ++N F  KYG   F  Y+ +  V      K I D +R   T  G 
Sbjct: 406 IYNKHHPENEASIKTIQNEFWAKYGRTFFTRYD-FEKVETEKANK-IVDQLRAYVTKSGV 463

Query: 511 --ASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEHI 568
             +++P+   E ++V    D +      +++    L V           + SNG+     
Sbjct: 464 VNSAFPAD--ESLKVTDCGDFSYTDLDGSVSDHQGLYV-----------KLSNGA----- 505

Query: 569 RFTIRGSGTEPK---LKVYIEA-CANEEQ 593
           RF +R SGT      +++YIE  C ++ Q
Sbjct: 506 RFVLRLSGTGSSGATIRLYIEKYCDDKSQ 534

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178
           A VGVMITASHNP  DNG K+  S+G  ++
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 128/569 (22%), Positives = 231/569 (40%), Gaps = 84/569 (14%)

Query: 56  GTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDN---LVAVVGHDHRFHSKEFAR 112
           GT+GLR + +    + N       ++     + +  P+       VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 113 ATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLK--ASVGVMITASHN---PKMDNGY 167
             AA     G K   +   +  + TP     +   +   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGSANGIKKLVIG-QYGLLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNKALKQGKLMYSREEML 223
           K   SNG        +AI D I   L  +  V DF ++    + K  K G L+    ++ 
Sbjct: 132 KYNLSNGGPAPESVTNAIWD-ISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDVIDIT 190

Query: 224 KLYLEEVSKNLVEINPLKL----EVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVEGKD 278
           K Y++ + K + + + +K     +   K W  ++  M+GV       I      L   + 
Sbjct: 191 KAYVDFL-KKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPAEE- 248

Query: 279 YLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDM 338
              V +  +P P F  +  P+P    A  + +   ++  I+   A+D D DR      +M
Sbjct: 249 ---VLQNWHPSPDFGGM-HPDPNLTYASSL-VKRVDREKIEFGAASDGDGDR------NM 297

Query: 339 QSGEWRQLT--GNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEG 396
             G        G+ +  +  +     Y +     Q ++ LA   S  +S  I ++A+  G
Sbjct: 298 IYGYGPSFVSPGDSVAIIAEYAAEIPYFAK----QGIYGLA--RSFPTSAAIDRVAKAHG 351

Query: 397 FHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYC 456
            +  +  TG+K+    A+   KK   +    EE+ G     +  +KDG+ A + +L    
Sbjct: 352 LNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAVMAWLNILA 405

Query: 457 KWKIDH--NLDPLNVLENGF-KKYG--VFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEG- 510
            +   H  N   +  ++N F  KYG   F  Y+ +  V +    K I D +R   T  G 
Sbjct: 406 IYNKHHPENEASIKTIQNEFWAKYGRTFFTRYD-FEKVESEKANK-IVDQLRAYVTKSGV 463

Query: 511 --ASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEHI 568
             +++P+   E ++V    D +      +++    L V           + SNG+     
Sbjct: 464 INSAFPAD--ESLKVTDCGDFSYTDLDGSVSDHQGLYV-----------KLSNGA----- 505

Query: 569 RFTIRGSGTEPK---LKVYIEA-CANEEQ 593
           RF +R SGT      +++Y+E  C ++ Q
Sbjct: 506 RFVLRLSGTGSSGATIRLYVEKYCDDKSQ 534

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 104/247 (42%), Gaps = 23/247 (9%)

Query: 98  VVGHDHRFHSKEFARATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMI 155
           VVG D R+++       AA     G K   +   H  + TP     +     K + G+++
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGVKKLVVG-QHGLLSTPAASHIMRTYEEKTTGGIIL 116

Query: 156 TASHNP---KMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNK 208
           TASHNP   + D G K   SNG     P  + I + I   +  +  + DF ++    L K
Sbjct: 117 TASHNPGGLENDMGIKYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPELELETLGK 175

Query: 209 ALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKL----EVKAKPW-FVYTPMHGVGFDIF 263
             K G L+    ++ K Y++ + K + +   +K     + + K W  ++  M+GV     
Sbjct: 176 NKKYGPLLVDVIDITKAYVDFL-KEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYG 234

Query: 264 STIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVA 323
             I      L   +    V +Q +P P F  V  P+P    A  + ++   +  I+   A
Sbjct: 235 KAIFVDEFGLPADE----VLQQWHPQPDFGGV-HPDPNLTYAKAL-VDRVNREKIEFGAA 288

Query: 324 NDPDADR 330
           +D D DR
Sbjct: 289 SDGDGDR 295

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISD--SIDANLEPWANVWDF 202
           VGVM+TASHNP +DNG KV    G  +I   +   +   +I AN E +  V+DF
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAAN-ESFEKVYDF 112

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDF 202
           +GVMITASHNP  DNG K+   +G  +I   +   +D   AN+    N   F
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDL--ANIASHGNFTAF 108

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 131/596 (21%), Positives = 240/596 (40%), Gaps = 89/596 (14%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFA 111
           GT+GLR + +   +  + T   IQA       + +  P+   + V VVG D R+++ E  
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQA-------IMEAIPEGSQDAVLVVGGDGRYYNNEVL 71

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166
           +         G K   +   +  + TP     +     K++ G+++TASHN   P+ D G
Sbjct: 72  QKIGEIGAANGVK-KLIVGQNGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSI---DANLEPWANVWDFDDV----LNKALKQGKLMYSR 219
            K   SNG     P   ++++SI      L  +  V +F  +    + K  + G L+   
Sbjct: 131 IKYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDV 186

Query: 220 EEMLKLYLEEVSKNLVEINPLKLEV---KAKPWF--VYTPMHGVGFDIFSTIVKKTLCLV 274
            ++   Y+ ++ K + + + +K  +   ++   F  ++  ++G+       I    L L 
Sbjct: 187 IDVTAEYV-KLMKEIFDFDLIKKFIDHQRSTKGFKILFDALNGITGPYGKAIFADELGLP 245

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVA 334
             +    V +   P P F  +  P+P    A  + +   +K  I    A+D D DR  + 
Sbjct: 246 AEE----VLQNYEPKPDFGGL-HPDPNLTYAHTL-VERVDKEQIAFGAASDGDGDRNMI- 298

Query: 335 VKDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEI 394
                 G      G+ +  +       +Y S    F+      +  S  +S  I ++A+ 
Sbjct: 299 ---YGCGPAFVSPGDSVAII------AEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKA 349

Query: 395 EGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQA 454
           +G +  +  TG+K+    A+   KK   +    EE+ G     +  +KDG+ A + +L  
Sbjct: 350 QGLNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIVAWLNI 403

Query: 455 YCKWKIDH---NLDPLNVLENGFKKYG--VFKEYNGYYVVPNPTVTKDIFDYIRNVYTPE 509
              +  +H   ++    VL+  + KYG   F  Y+ +  V      K     +  V    
Sbjct: 404 LAIYNREHPDSDVSIKVVLDEFWAKYGRTFFTRYD-FEQVSGEAAAK-----VLRVLEDL 457

Query: 510 GASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEHIR 569
             S  S+IG+ +      DLT    +D  +   T      S+   + A+ SNG      R
Sbjct: 458 VVSKESAIGKLLPG--NTDLTV---TDCGDFSYTDLDGSVSEHQGLYAKLSNG-----CR 507

Query: 570 FTIRGSGTEPK---LKVYIEACANEEQRASFLAKLTWNVLRREWFRPDEMNIVTKF 622
           F +R SGT      +++Y+E   ++  + S         L  E F  D++  V KF
Sbjct: 508 FVVRLSGTGSSGATIRLYLERYTDDASKYS---------LNVEQFMKDDIKAVLKF 554

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 130/596 (21%), Positives = 239/596 (40%), Gaps = 89/596 (14%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDNL---VAVVGHDHRFHSKEFA 111
           GT+GLR + +      N T   IQA       + +  P+ +   V +VG D R+++    
Sbjct: 19  GTSGLRKRTKVFAEEPNYTENFIQA-------ILEAIPEGVKDSVLLVGGDGRYYNDVVL 71

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAV---DKLKASVGVMITASHNPKMDN--- 165
           +  AA     G K   +   +  + TP     +    K K + G+++TASHNP   N   
Sbjct: 72  QKIAAIGAANGVK-RLVVGQNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDF 130

Query: 166 GYKVYYSNGCQIIPPHDHAISDSI---DANLEPWANVWDFDDVLNKALKQ---GKLMYSR 219
           G K   +NG     P    +++++      L  +  V DF  V   AL +   G L    
Sbjct: 131 GIKYNLANGG----PAPENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDV 186

Query: 220 EEMLKLYLEEVSKNLVEINPLKLEV----KAKPW-FVYTPMHGVGFDIFSTIVKKTLCLV 274
            +  K Y++ + K + +   +K  V    + K W  ++  ++GV       I    L L 
Sbjct: 187 IDSTKAYVDFL-KTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGLP 245

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVA 334
           E +    V +  +P P F  +  P+P    A  + ++  ++ +I    A+D D DR  + 
Sbjct: 246 EDE----VLQNCHPKPDFGGL-HPDPNLTYARTL-VDRVDRENIAFGAASDGDGDRNMI- 298

Query: 335 VKDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEI 394
                +G      G+ +  +       +Y S    FQ      +  S  +SQ I  +A+ 
Sbjct: 299 ---YGAGPAFVSPGDSVAII------AEYASEIPYFQREGIYGLARSFPTSQAIDLVAKH 349

Query: 395 EGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQ- 453
                 +  TG+K+    A+   KK   +    EE+ G     +  +KDG+ A I +L  
Sbjct: 350 HNLSCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHI-REKDGLWAIIAWLNI 403

Query: 454 --AYCKWKIDHNLDPLNVLENGFKKYG--VFKEYNGYYVVPNPTVTKDIFDYIRN-VYTP 508
              Y K   + ++    + +  + KYG   F  Y+ Y  V      + + ++ +N V  P
Sbjct: 404 LAIYHKRNPEKDVSIKTIQDEFWDKYGRTFFTRYD-YENVSGEAANR-VIEFFQNFVSQP 461

Query: 509 --EGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENE 566
             +G+++P  + E ++V+   D        +++    L +  ++ + TV      GS   
Sbjct: 462 GVKGSNFP--LDESLKVVDAGDFEYKDLDGSVSSNQGLFLKLSNGVRTVLRLSGTGSAGA 519

Query: 567 HIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNVLRREWFRPDEMNIVTKF 622
            IR             +Y+E  +++  +    A+        E+ RP    +V+ F
Sbjct: 520 TIR-------------LYVEQYSDDASKYGLTAE--------EFLRPAIQQLVSFF 554

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 126/568 (22%), Positives = 223/568 (39%), Gaps = 85/568 (14%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFA 111
           GT+GLR + +      N T   IQA       +    P+   + V VVG D RF++    
Sbjct: 17  GTSGLRKKTKVFMEEPNYTENFIQA-------IMDAIPEGAKDAVLVVGGDGRFYNDVIM 69

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166
           +  AA     G +   +   +  + TP     +     K + G+++TASHN   P+ D G
Sbjct: 70  QKIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLG 128

Query: 167 YKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNKALKQGKLMYSREEM 222
            K   +NG     P  + + + +   L  +  + DF  V    + K  + G L+    + 
Sbjct: 129 IKYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDT 187

Query: 223 LKLYLEEVSKNLVEINPLKL-------EVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLV 274
            + Y+    K + EI   KL       + +AK W  ++  ++G+       I      L 
Sbjct: 188 TEDYV----KFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDLP 243

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVA 334
             +    V +  +P P F  +  P+P    A  + +   ++  I+   A+D D DR  + 
Sbjct: 244 ADE----VLQNWHPQPDFGGL-HPDPNLTYAHTL-VERVDREKIEFGAASDGDGDRNMI- 296

Query: 335 VKDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEI 394
                +G      G+ +  +  + +   Y      FQ      +  S  +S  I ++A+ 
Sbjct: 297 ---YGAGPAFVSPGDSVAIIAEYAKEIPY------FQKQGIYGLARSFPTSGAIDRVAKA 347

Query: 395 EGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDG---ISASIVF 451
           +G +  +  TG+K+    A+   KK   +    EE+ G     +  +KDG   I A +  
Sbjct: 348 QGLNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHI-REKDGVWAICAWLNI 401

Query: 452 LQAYCKWKIDHNLDPLNVLENGFKKYG--VFKEYNGYYVVPNPTVTK--DIFDYIRNVYT 507
           L  Y K   +       + E  + KYG   F  Y+ Y  +      K  D+ D   N   
Sbjct: 402 LALYNKHNPEKEASIKTIQEEFWAKYGRTFFTRYD-YEGITTEKANKVVDLLDKFVNDPK 460

Query: 508 PEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEH 567
            + A +P    E + V    D +      +++    L V           + SNG+    
Sbjct: 461 SKNAPFPGD--ESLTVSDCGDFSYTDLDGSVSDHQGLFV-----------KLSNGA---- 503

Query: 568 IRFTIRGSGT---EPKLKVYIEACANEE 592
            RF +R SGT      +++YIE  ++++
Sbjct: 504 -RFVLRLSGTGSAGATIRLYIEEYSDDK 530

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           +VGVMITASHNP  DNG K+   NG  +
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 131/595 (22%), Positives = 241/595 (40%), Gaps = 95/595 (15%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDN---LVAVVGHDHRFHSKEFA 111
           GT+GLR + +      N T   IQA       + +  P+       V+G D R+++    
Sbjct: 19  GTSGLRKKTKVFEETPNYTENFIQA-------IMEAIPEGSQGATLVIGGDGRYYNDVVI 71

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166
           +  AA     G +   +   +  + TP     +     K + G+++TASHN   P  D G
Sbjct: 72  QKIAAIGSANGVRKIVIG-HNGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPTNDFG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSI---DANLEPWANVWDFDDV----LNKALKQGKLMYSR 219
            K   +NG     P   ++++SI      L  +  V  F  +    + +  K G L+   
Sbjct: 131 IKYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDLLVDI 186

Query: 220 EEMLKLYLEEVSKNLVEINPLK--LEVKAKPWF--VYTPMHGVGFDIFSTIVKKTLCLVE 275
            +    Y+ E+ K + +   +K  ++ +AK  F  ++  M+GV       +  K L L E
Sbjct: 187 VDSTAAYV-ELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKELGLPE 245

Query: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAV 335
                   +  +P P F  +  P+P    A  + +   +K+ I    A+D D DR  +  
Sbjct: 246 SS-----LQNYHPKPDFGGL-HPDPNLTYAHTL-VERVDKYGIQFGAASDGDGDRNMI-- 296

Query: 336 KDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIE 395
               +G      G+ +  +       +Y S    F+      +  S  +S  I ++A+ +
Sbjct: 297 --YGAGPAFVSPGDSVAII------AEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQ 348

Query: 396 GFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEH--DKDGISASIVFLQ 453
           G +  +  TG+K+    A+   KK   +    EE+ G       H  +KDG+ A + +L 
Sbjct: 349 GLNCYEVPTGWKFF--CALFDAKK---LSICGEESFG---TGSNHVREKDGVWAIMAWLN 400

Query: 454 --AYCKWKIDHNLDPLNVLENGF-KKYG--VFKEYNGYYVVPNPTVTKDIF---DYIRNV 505
             A    +  +    +  ++  F +KYG   F  Y+ +  + +    K I    +Y+ + 
Sbjct: 401 ILAIYNQRFPNKEASIKSIQTDFWQKYGRTFFTRYD-FENLSSEDAGKVILLLQNYVADP 459

Query: 506 YTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSEN 565
            + +G  +P+   + + V+   D +      +++    L V           R SNG   
Sbjct: 460 ESIKGTKFPAD--DSLTVVEGGDFSYTDLDGSVSSHQGLYV-----------RLSNG--- 503

Query: 566 EHIRFTIRGSGTEPK---LKVYIEACANE----EQRA-SFLAKLTWNVLRREWFR 612
             +RF +R SGT      +++Y+E   N+    EQ A  FL K    +L+   F+
Sbjct: 504 --VRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAEEFLGKDIKTILKFLKFK 556

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 119/296 (40%), Gaps = 40/296 (13%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFP---DNLVAVVGHDHRFHSKEFA 111
           GT+GLR +        N T   IQA       + +  P   D    VVG D R+++    
Sbjct: 19  GTSGLRKKTVIFKDEPNYTENFIQA-------IMESIPEGSDGATLVVGGDGRYYNDVIL 71

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166
              A      G K   +   +  + TP     +     K + G+++TASHN   PK D G
Sbjct: 72  EKIAKIGAANGVKKLVVG-QNGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDMG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV-------LNKALKQGKLMYSR 219
            K   +NG     P   +++D I  N +   +     D+       + +  K G ++   
Sbjct: 131 IKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGPILIDV 186

Query: 220 EEMLKLYLEEVSKNLVEINPLK----LEVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLV 274
            ++ K Y+E + K + +   +K     + K K W  ++  ++G+       I      L 
Sbjct: 187 IDVTKAYVEFL-KEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVDEFELP 245

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADR 330
           E +    V +  +P P F  +  P+P    A  + ++  +K  I+   A+D D DR
Sbjct: 246 ENE----VLQNYHPQPDFGGL-HPDPNLTYARSL-VDRVDKEKIEFGAASDGDGDR 295

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 121/296 (40%), Gaps = 40/296 (13%)

Query: 56  GTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNL---VAVVGHDHRFHSKEFAR 112
           GT+GLR + +    + N +      +     V +  P+     V VVG D R+++    +
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 113 ATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMITASHN---PKMDNGY 167
             AA     G K   +   +  + TP     +   K K + G+++TASHN   P+ D G 
Sbjct: 72  KIAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130

Query: 168 KVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNKALKQGKLMYSREEML 223
           K   SNG     P  + I + I   L  +  V DF ++    L +  K G L+    +  
Sbjct: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTT 189

Query: 224 KLYLEEVSKNLVEINPLKL-------EVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVE 275
             Y++     L EI   +L       + K K W  +   M+GV     +    K + + E
Sbjct: 190 DAYIQL----LKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGV-----TGPYAKAIFVDE 240

Query: 276 -GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADR 330
            G D   V +  +P P F  +  P+P    A  + +    K  I+   A+D D DR
Sbjct: 241 FGLDSKEVLQNWHPQPDFGGL-HPDPNLTYAHTL-VERVNKEKIEFGAASDGDGDR 294

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 22/80 (27%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKA 209
           +VGVMITASHN   DNG K+   +G              +D + EP+A      ++ NKA
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSM------------LDQSWEPFAT-----ELANKA 99

Query: 210 LKQGKLMYSREEMLKLYLEE 229
                  +S +E  KLYL+E
Sbjct: 100 ----SFCHSTQE-FKLYLQE 114

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 59/143 (41%), Gaps = 21/143 (14%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFA 111
           GT+GLR + +      N T   IQA       +    P+   +   VVG D RF++    
Sbjct: 19  GTSGLRKKTKVFMDEPNYTENFIQA-------IMDAIPEGSKDATLVVGGDGRFYNDVIM 71

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV--GVMITASHN---PKMDNG 166
              AA     G K   +   +  + TP     +   K  V  G+++TASHN   P  D G
Sbjct: 72  NKIAAIGAANGVKKLIIG-QNGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSI 189
            K    NG     P   A++D+I
Sbjct: 131 IKYNLGNGA----PAPEAVTDAI 149

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 119/294 (40%), Gaps = 35/294 (11%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDNL---VAVVGHDHRFHSKEFA 111
           GT+GLR +        N T   IQA       + +  P+       VVG D R+++    
Sbjct: 20  GTSGLRKKTAIFEKEPNYTENFIQA-------IMEAIPEGCKGATLVVGGDGRYYNDAIL 72

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL---KASVGVMITASHN---PKMDN 165
              AA     G K   +   +  + TP     +      + + G+++TASHN   PK D 
Sbjct: 73  HNIAAIGAANGVK-KLIVGQNGLLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDM 131

Query: 166 GYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDV----LNKALKQGKLMYSREE 221
           G K    NG     P   AI ++    L+ +  + DF ++    L K  + G L+    +
Sbjct: 132 GIKYNIQNGAPAPEPVTEAIWEA-SKKLQNYKIIKDFPELELKTLGKNKQYGPLLVDVID 190

Query: 222 MLKLYLEEVSKNLVEINPLK----LEVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVEG 276
             + Y++ + K + +   +K     + K K W  ++  M+GV       I    L L   
Sbjct: 191 TCEAYVQFI-KEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELGLPAD 249

Query: 277 KDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADR 330
           +    V +  +P P F     P+P    A  + ++  +K  I+   A+D D DR
Sbjct: 250 E----VLKDWHPSPDFGG-HHPDPNLTYAKSL-VDRVDKEKIEFGAASDGDGDR 297

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNG 174
           +GVM+TASHNP +DNG KV   +G
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG 82

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 58/143 (40%), Gaps = 20/143 (13%)

Query: 56  GTAGLRSQMQAGFSRMNTLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFAR 112
           GT+GLR + +   S  N       ++     +    P+   N   VVG D RF++     
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 113 ATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV---GVMITASHN---PKMDNG 166
                    G +   +   +  + TP   + +   K S    G+++TASHN   P+ D G
Sbjct: 73  KIMQISAANGVRKLVIG-QNGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDIG 131

Query: 167 YKVYYSNGCQIIPPHDHAISDSI 189
            K   SNG     P   +I+D I
Sbjct: 132 IKYNLSNGG----PAPESITDEI 150

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 124/296 (41%), Gaps = 40/296 (13%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFA 111
           GT+GLR + +   +  N T   IQA       +    P+   N   VVG D RF++    
Sbjct: 19  GTSGLRKKSKVFMNEPNYTENFIQA-------ILDAIPEGSENSTLVVGGDGRFYNDVIL 71

Query: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV--GVMITASHN---PKMDNG 166
           +  A      G +   +      + TP     +      V  G+++TASHN   P+ D G
Sbjct: 72  QLIAEIGAANGVRKLIIG-QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSI---DANLEPWANVWDFDDV----LNKALKQGKLMY-- 217
            K   +NG     P   +++++I     NL  +  + DF  +    +++ +K G L+   
Sbjct: 131 IKYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKYGPLLIDI 186

Query: 218 --SREEMLKLYLEEVSKNLVEINPLKLEVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLV 274
             S E+ +K +L+E+    +    ++ + K   W  ++  ++GV       I      L 
Sbjct: 187 IDSTEDYVK-FLKEIFDFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKAIFVDEFGLP 245

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADR 330
             +    V +  +P P F  +  P+P    A  + ++  +K  I+   A+D D DR
Sbjct: 246 ADE----VLQNWHPQPDFGGL-HPDPNLTYARTL-VDRVDKEKIEFGAASDGDGDR 295

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 149 ASVGVMITASHNPKMDNGYKV 169
           A VGVM+TASHNP  DNG KV
Sbjct: 56  AQVGVMVTASHNPPEDNGVKV 76

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 122/295 (41%), Gaps = 37/295 (12%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +     ++ T   IQA+           P  +  VVG D RF++       
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT----IESIPNGPGGVTLVVGGDGRFYNDVIMNKI 74

Query: 115 AAAFLLKGFKVHYLNPDHEFVHTPLVPFAV----DKLKASVGVMITASHN---PKMDNGY 167
           AA     G +   +      + TP     +    DK     G+++TASHN   P+ D G 
Sbjct: 75  AAVGAANGVRKLVIG-QGGLLSTPAASHVIRTYEDKCSGG-GIILTASHNPGGPENDLGI 132

Query: 168 KVYYSNGCQIIPPHDHAISDSI---DANLEPWANVWDFDDV----LNKALKQGKLMYSRE 220
           K    NG     P   +++++I      L  +  + DF ++    L K  + G L+    
Sbjct: 133 KYNLPNGG----PAPESVTNAIWEASKKLTHYKIIKDFPELNLNKLGKNQRYGPLLVDII 188

Query: 221 EMLKLY---LEEVSKNLVEINPLKLEVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVE- 275
           E  K Y   L+E+    +    LK + + K W  ++  ++G+     +    K L + E 
Sbjct: 189 EPAKAYVQLLKEIFDFDLIRGFLKEQRRVKGWKLLFDSLNGI-----TGPYGKALFVDEF 243

Query: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADR 330
           G     V +  +P P F  +  P+P    A  + ++  ++  I+   A+D D DR
Sbjct: 244 GLPAEEVLQNWHPLPDFGGL-HPDPNLTYAHTL-VDRVDREKIEFGAASDGDGDR 296

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VGVMITASHNP  DNG K+
Sbjct: 58  VGVMITASHNPPQDNGVKI 76

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VGVMITASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 150 SVGVMITASHNPKMDNGYKV 169
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 150 SVGVMITASHNPKMDNGYKV 169
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 93  DNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KAS 150
           +N   VVG D R+++ E  +   A     G +   L   +  + TP     +     K +
Sbjct: 53  ENATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILG-QNGILSTPAASHIIRSYPEKCT 111

Query: 151 VGVMITASHN---PKMDNGYKVYYSNG 174
            G+++TASHN   P+ D G K   SNG
Sbjct: 112 GGIILTASHNPGGPENDFGIKYNLSNG 138

>Smik_5.226 Chr5 (339164..340891) [1728 bp, 575 aa] {ON} YER087W
           (REAL)
          Length = 575

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/149 (18%), Positives = 58/149 (38%), Gaps = 25/149 (16%)

Query: 362 KYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGY 421
           KY+++ +     HP ++ N T+ S+  +++ +  GF     +  F+W+            
Sbjct: 3   KYRTLFRTCHIFHPKSLSNDTLKSETTQELLQTMGFVRRSQVGLFQWL------------ 50

Query: 422 YVPFGFE---EAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYG 478
             P G     +  G +   M++D + I  S+  +     W+     +   + +       
Sbjct: 51  --PLGLRSLNKLTGAIRNRMDNDGEAIEVSLSAISPRALWQTTGRWNNSELFK------- 101

Query: 479 VFKEYNGYYVVPNPTVTKDIFDYIRNVYT 507
            FK+  G       T  +DI D ++N  T
Sbjct: 102 -FKDSKGKQYCLTATCEEDITDLMKNYIT 129

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANV 199
           A VGVM+TASHNP  DNG K        ++ PH   ++   + +    AN 
Sbjct: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALANC 98

>Kpol_1031.31 s1031 (72969..74099) [1131 bp, 376 aa] {ON}
           (72969..74099) [1131 nt, 377 aa]
          Length = 376

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 52/133 (39%), Gaps = 11/133 (8%)

Query: 92  PDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV 151
           P+  V   G      S  FAR+    F  +  +V Y     EF    ++  A     +  
Sbjct: 108 PNARVIEAGTGSGSFSHAFARSAQKLFTYEFHQVRYEQALEEFKDHGILGDA-----SKY 162

Query: 152 GVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANL------EPWANVWDFDDV 205
           G  +T +H    +NG+++  ++        D  I   I+AN+       PW  + + +DV
Sbjct: 163 GENVTITHRDVCENGFRIKQNDTTSFEFGEDEEIEAKINANVIFLDLPAPWDAIPNLNDV 222

Query: 206 LNKALKQGKLMYS 218
           +    K G   +S
Sbjct: 223 IASDEKVGLCCFS 235

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 98  VVGHDHRFHSKEFARATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMI 155
           V+G D RF++       AA     G +   +   +  + TP   + +   K KA+ G+++
Sbjct: 59  VIGGDGRFYNDVVINKIAAISAANGVRKLVIG-QNGLLSTPATSYIIRSYKDKATGGIIL 117

Query: 156 TASHN---PKMDNGYKVYYSNG 174
           TASHN   P+ D G K   +NG
Sbjct: 118 TASHNPGGPENDMGIKYNLANG 139

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 56/130 (43%), Gaps = 20/130 (15%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFA 111
           GT+GLR + +      N T   IQA       V    P+   +   VVG D RF++    
Sbjct: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRFYNDVVV 71

Query: 112 RATAAAFLLKGFKVHYLN-PDHEFVHTPLVPFAVDK---LKASVGVMITASHNP---KMD 164
           +  AA     G  VH L    +  + TP     +      K + G+++TASHNP   K D
Sbjct: 72  QKIAAIGAANG--VHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKND 129

Query: 165 NGYKVYYSNG 174
            G K   SNG
Sbjct: 130 FGIKYNLSNG 139

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 102/250 (40%), Gaps = 26/250 (10%)

Query: 98  VVGHDHRFHSKEFARATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAV----DKL--KASV 151
           VVG D R+++ +  +  A+     G     +   H  + TP     +    DK   K + 
Sbjct: 58  VVGGDGRYYNDKILQIIASISAANGVGKLVIG-QHGLLSTPAASHIIRTYQDKSGKKVTG 116

Query: 152 GVMITASHNPKM---DNGYKVYYSNGCQIIPPHDHAISDSIDANLEPW---ANVWDFDDV 205
           G+++TASHNP     D G K   SNG        +AI + I   L  +    N+   D  
Sbjct: 117 GIILTASHNPGGPDNDIGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIIKNLPQLDLS 175

Query: 206 LNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLK----LEVKAKPW-FVYTPMHGVGF 260
                K G L     ++ + Y+E + K + + + +K     +   K W  ++  ++GV  
Sbjct: 176 TKGEKKLGNLEIDVVDVTQAYVEFL-KEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTG 234

Query: 261 DIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDL 320
                I    L L E +    V +  +P P F  +  P+P    A  + +   +K  I+ 
Sbjct: 235 PYGKAIFVDELGLPENE----VLQNCHPKPDFGGI-HPDPNLTYARTL-VERVDKEKIEF 288

Query: 321 LVANDPDADR 330
             A+D D DR
Sbjct: 289 GAASDGDGDR 298

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VG MITASHNP  DNG K+
Sbjct: 58  VGAMITASHNPPQDNGVKL 76

>CAGL0I10054g Chr9 complement(955545..957776) [2232 bp, 743 aa] {ON}
           similar to uniprot|P33336 Saccharomyces cerevisiae
           YGR143w SKN1 glucan synthase or uniprot|P32486
           Saccharomyces cerevisiae YPR159w KRE6
          Length = 743

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 96/241 (39%), Gaps = 50/241 (20%)

Query: 131 DHEFVHTPLVPFAVDKLKASVGVMIT-ASHNPKMDNGYKVYYSNGCQIIPPHDH-AISDS 188
           ++E  HTP +        +S G     AS N KM   YK YYS   +  P   + A S  
Sbjct: 70  NYELAHTPDLIAPEHHFTSSSGSNSNPASLNEKMAADYKGYYSKHNKGSPSRFYSANSRK 129

Query: 189 IDANLEPWANVWDFDDVLNKALKQGKLMYSREEML--KLYLEEVSKNLVEIN----PLKL 242
             +++ P  N+ ++ D+ +  ++     + R  ++  +L+L    +N ++ +    P K 
Sbjct: 130 NSSSITPPLNIGNYSDLSSNDIR-APPAFDRYPLVGSRLHLSNYRQNFIKNDSPPPPFKN 188

Query: 243 EVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302
           E  A                 S IV  ++  ++ +D+       +P   +P   FP    
Sbjct: 189 EKLAD-------------GESSLIVPSSVMFLDDQDF-------SPFGGYPASAFP---- 224

Query: 303 KGALDIGINLAEKHDIDLLVANDP------DADRFSVAVKDMQSGEWRQLTGNEIGFLFA 356
                  +++ EK D D L   DP      D  RFS  +K M     ++  G  +G LF 
Sbjct: 225 -------LSMDEKEDDDFLHNPDPEEEARLDKHRFSEDLKHMN----KKSFGGILGVLFL 273

Query: 357 F 357
           F
Sbjct: 274 F 274

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 58/141 (41%), Gaps = 16/141 (11%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR + +   +  + T   IQA          + P     VVG D RF++       
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQAMMECI----PEGPSGATLVVGGDGRFYNDVIMNKI 74

Query: 115 AAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV---GVMITASHN---PKMDNGYK 168
           AA     G K   +      + TP     +   + +    G+++TASHN   P+ D G K
Sbjct: 75  AAVGAANGIKKLVIG-QAGLLSTPAASHIIRTYEDNCNGGGIILTASHNPGGPENDLGIK 133

Query: 169 VYYSNGCQIIPPHDHAISDSI 189
               NG     P   +++D+I
Sbjct: 134 YNLPNGG----PAPESVTDAI 150

>Smik_14.334 Chr14 complement(592266..593219) [954 bp, 317 aa] {ON}
           YNR003C (REAL)
          Length = 317

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 468 NVLENGFKKYGVFKEYNGYYV--VPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLY 525
           N   NGFK +      N +Y   V N + T++I D+I           PS+I    EVL 
Sbjct: 189 NTFPNGFKNFENGPNRNVFYAPNVKNYSTTQEILDFITAAQVANVELTPSNIRSLCEVLM 248

Query: 526 YRD 528
           Y D
Sbjct: 249 YDD 251

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 534 QSDTINHKPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQ 593
           ++D I  K TL    T+ M +   R +NG        TI GSG+ P+++  IE  A +EQ
Sbjct: 342 RTDDILEKQTLMF--TATMSSSIERIANGYLRNPGFVTIGGSGSAPQIQQIIEYVATDEQ 399

Query: 594 RASFLAK 600
           R   L +
Sbjct: 400 RFKMLTQ 406

>KAFR0A04200 Chr1 complement(842429..843211) [783 bp, 260 aa] {ON}
           Anc_8.740 YOR280C
          Length = 260

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 166 GYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLK 224
           GY+++Y  G ++IP +D  + +  DA +  W  V + D      +K   + Y RE ++K
Sbjct: 32  GYELHYPCGTEVIPANDVGLEEDTDAEMFGWF-VRNKDSFTEFEIKPKTINYLREYIIK 89

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 129/592 (21%), Positives = 232/592 (39%), Gaps = 88/592 (14%)

Query: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARAT 114
           GT+GLR +     +  N T   IQA         Q    +   VVG D RF++       
Sbjct: 19  GTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQ----DATLVVGGDGRFYNDVIMNKI 74

Query: 115 AAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNGYKV 169
           AA     G K   +   +  + TP     +     K + G+++TASHN   P+ D G K 
Sbjct: 75  AAISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGIKY 133

Query: 170 YYSNGCQIIPPHDHAISDSI---DANLEPWANVWDFDDV----LNKALKQGKLMYSREEM 222
             +NG     P   +++++I      L  +  + +F  +    + K  K G L+    ++
Sbjct: 134 NLANGG----PAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLLVDIIDV 189

Query: 223 LKLYLEEVSKNLVEINPLK----LEVKAKPW-FVYTPMHGVGFDIFSTIVKKTLCLVEGK 277
            K Y++ + K + +   +K     + + K W  ++  ++G+       I      L   +
Sbjct: 190 TKDYVDFL-KEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFDLPANE 248

Query: 278 DYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKD 337
               V +  +P P F  +  P+P    A  + +   ++  I+   A+D D DR  +    
Sbjct: 249 ----VLQNWHPKPDFGGL-HPDPNLTYAKTL-VERVDREKIEFGAASDGDGDRNMI---- 298

Query: 338 MQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGF 397
             +G      G+ +  +       +Y S    F       +  S  +S  I ++A+  G 
Sbjct: 299 YGAGPAFVSPGDSVAII------AEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGL 352

Query: 398 HYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQA--- 454
              +  TG+K+    A+   KK   +    EE+ G     +  +KDG+ A + +L     
Sbjct: 353 SCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHI-REKDGLWAIVAWLNVLAI 406

Query: 455 YCKWKIDHNLDPLNVLENGFKKYG--VFKEYNGYYVVPNPTVTKDIFDYIRN-VYTPE-- 509
           Y K   + +     + E  + KYG   F  Y+ Y  + N   +K + D + N V  P   
Sbjct: 407 YNKHNPEKDASIKTIQEEFWNKYGRTFFTRYD-YEHISNEDASK-VVDLLNNFVSKPNVI 464

Query: 510 GASYPSSIGEEIEVLYYRDLT-TGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEHI 568
           G+++P    E + V+   D + T       +H+                + SNG+     
Sbjct: 465 GSAFPGD--ESLTVVDAGDFSYTDLDGSVSDHQGLF------------FKLSNGA----- 505

Query: 569 RFTIRGSGTEPK---LKVYIEACAN-----EEQRASFLAKLTWNVLRREWFR 612
           R  +R SGT      +++Y+E   +     EE    FLA     V++   F+
Sbjct: 506 RIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQDFLAPTIKTVVKFLKFK 557

>AAR162C Chr1 complement(634067..637582) [3516 bp, 1171 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL062W
           (PYC1) and YBR218C (PYC2)
          Length = 1171

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 391 MAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFP-AMEHDKDGISASI 449
           MA +  + YED L+  +   + A ++ ++G Y P G   AI  +   A +HD D I    
Sbjct: 42  MATVAVYSYEDRLSMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGY 101

Query: 450 VFL 452
            FL
Sbjct: 102 GFL 104

>Smik_4.752 Chr4 complement(1328812..1331445) [2634 bp, 877 aa] {ON}
           YDR475C (REAL)
          Length = 877

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGY 167
           H L   HEF + P + F  ++ K S G   T   NP +++G+
Sbjct: 209 HRLEQKHEFFNYPTILFPPNRKKWSTGAASTIKFNPPLEDGF 250

>Suva_14.356 Chr14 complement(615577..616530) [954 bp, 317 aa] {ON}
           YNR003C (REAL)
          Length = 317

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 42/102 (41%), Gaps = 6/102 (5%)

Query: 468 NVLENGFKKYGVFKEYNGYYV--VPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLY 525
           N   NGFK +      N +Y   V N + T++I ++I           PS+I    EVL 
Sbjct: 189 NTFPNGFKNFENGPNRNVFYAPNVKNYSTTQEILEFITAAQVANVELTPSNIRSLCEVLV 248

Query: 526 YRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEH 567
           Y D       D   +K TL  +   QM    + P  G++ E 
Sbjct: 249 YDDKLEKVMHDC--YKVTL--ESILQMNQGQSEPDTGNKAEE 286

>Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 43/113 (38%), Gaps = 18/113 (15%)

Query: 406 FKWIGN--RAILLEKKGY---YVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKI 460
           F+ IGN   AI     G    Y+PF FE     + PA   ++D I   I           
Sbjct: 283 FREIGNIKSAINSSSNGLHKDYIPFAFENRTTQLMPAATVNRDEIQQPISTRDTTSSGIP 342

Query: 461 DHNLD------------PLNVLEN-GFKKYGVFKEYNGYYVVPNPTVTKDIFD 500
             N D            P +V+ N  FK + + +E      VPN    KDIF+
Sbjct: 343 GGNFDRNSSSSATEQQRPSSVVVNPNFKLHDLAEEVLDITEVPNLFTDKDIFE 395

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,741,665
Number of extensions: 3242847
Number of successful extensions: 8093
Number of sequences better than 10.0: 84
Number of HSP's gapped: 8271
Number of HSP's successfully gapped: 84
Length of query: 622
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 506
Effective length of database: 40,180,143
Effective search space: 20331152358
Effective search space used: 20331152358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)