Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR277W (FCP1)8.839ON73273235290.0
Smik_13.4908.839ON73273133900.0
Skud_13.4498.839ON73473332530.0
Suva_13.4658.839ON73273230550.0
TDEL0B005808.839ON71374521490.0
NCAS0C004208.839ON72565521220.0
ZYRO0G14168g8.839ON76465121230.0
KAFR0B039108.839ON72465921110.0
CAGL0M02959g8.839ON75865620740.0
NDAI0K004208.839ON77878320170.0
TBLA0D032608.839ON76868119270.0
Kpol_1068.98.839ON74565619130.0
KNAG0J002808.839ON74276518820.0
TPHA0I002408.839ON73265918760.0
SAKL0D01496g8.839ON68865318310.0
KLTH0C03894g8.839ON74564717780.0
Kwal_27.102638.839ON74365417720.0
Ecym_46108.839ON75166017560.0
ABL127W8.839ON72865417480.0
KLLA0D01595g8.839ON71966016380.0
TPHA0E030705.202ON494821064e-04
NCAS0A068005.202ON4731311020.001
TPHA0H010705.94ON10151251030.001
Kpol_1010.615.94ON932921010.002
Ecym_20665.94ON880109990.003
NDAI0D018605.202ON51451980.004
Smik_8.2385.94ON1075142980.004
SAKL0G12870g5.202ON399132960.006
Kpol_1050.635.94ON105870960.008
Smik_12.825.202ON39245940.010
YLR019W (PSR2)5.202ON39745920.016
Kpol_478.165.202ON35094910.023
SAKL0G15620g5.94ON879164910.028
NDAI0C032305.94ON103496900.037
KAFR0E021405.94ON95191900.040
ZYRO0B10428g5.202ON48240890.042
Ecym_50527.46ON87397890.049
Skud_12.875.202ON39245880.056
Suva_10.655.202ON415115870.082
Kpol_2002.1005.202ON47776860.096
CAGL0I01958g5.94ON1099169870.10
Skud_12.575.202ON415123850.13
TBLA0C060905.202ON484123850.14
YHR154W (RTT107)5.94ON107091850.14
Skud_8.2185.94ON1076145850.15
Smik_12.535.202ON414112840.15
TPHA0N006705.202ON45241840.16
Suva_10.995.202ON38541840.16
NDAI0I021705.202ON39145840.17
CAGL0D03234g5.202ON410112830.22
YLL010C (PSR1)5.202ON427112830.24
KAFR0A065604.156ON55555820.29
KNAG0E005705.94ON981102820.33
TDEL0E042705.202ON453112820.33
AAL158W5.202ON47840820.34
Suva_15.3535.94ON107991820.39
NCAS0D027405.202ON39845800.43
Kwal_33.151405.202ON410132800.45
Ecym_72764.156ON59353790.69
Smik_16.1728.527ON477100790.73
CAGL0D05610g5.202ON44745790.76
KAFR0J009905.202ON483113790.76
KLLA0F15620g5.202ON414112780.79
Suva_16.2498.527ON480100790.79
KNAG0M017405.202ON48140780.91
Ecym_71045.202ON49240780.95
TPHA0A051105.94ON106594781.2
ADR369C7.46ON82797771.3
KLLA0E23101g8.527ON480106761.4
NCAS0D015105.94ON900127761.8
KLTH0C01584g5.94ON913114761.9
YPL063W (TIM50)8.527ON476100751.9
ADL145C5.94ON875109752.1
KLLA0E15621g5.94ON89171752.3
Skud_16.2188.527ON480100725.0
SAKL0H20592g4.156ON50877725.0
NCAS0C022108.527ON491100715.8
CAGL0H05159g8.527ON485100708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR277W
         (732 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...  1363   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...  1310   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...  1257   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...  1181   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   832   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   822   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   822   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   817   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   803   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   781   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   746   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   741   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   729   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   727   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   709   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   689   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   687   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   681   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   677   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   635   0.0  
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    45   4e-04
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    44   0.001
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    44   0.001
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    44   0.002
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    43   0.003
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     42   0.004
Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W...    42   0.004
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    42   0.006
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    42   0.008
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    41   0.010
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    40   0.016
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    40   0.023
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    40   0.028
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    39   0.037
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    39   0.040
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    39   0.042
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    39   0.049
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    39   0.056
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    38   0.082
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    38   0.096
CAGL0I01958g Chr9 (162266..165565) [3300 bp, 1099 aa] {ON} weakl...    38   0.10 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    37   0.13 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    37   0.14 
YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}  RTT107Pro...    37   0.14 
Skud_8.218 Chr8 (374359..377589) [3231 bp, 1076 aa] {ON} YHR154W...    37   0.15 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    37   0.15 
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    37   0.16 
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    37   0.16 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     37   0.17 
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    37   0.22 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    37   0.24 
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    36   0.29 
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    36   0.33 
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    36   0.33 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    36   0.34 
Suva_15.353 Chr15 (607037..610276) [3240 bp, 1079 aa] {ON} YHR15...    36   0.39 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    35   0.43 
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    35   0.45 
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    35   0.69 
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    35   0.73 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    35   0.76 
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    35   0.76 
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    35   0.79 
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    35   0.79 
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    35   0.91 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    35   0.95 
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    35   1.2  
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    34   1.3  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    34   1.4  
NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {O...    34   1.8  
KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {...    34   1.9  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    33   1.9  
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    33   2.1  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    33   2.3  
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    32   5.0  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    32   5.0  
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     32   5.8  
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    32   8.3  

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score = 1363 bits (3529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/732 (91%), Positives = 669/732 (91%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 121 VYGGLCTQCGKEVSADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVVD 180
           VYGGLCTQCGKEVSADAF             QISETEAIRTGKALKEHLRRDKKLILVVD
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDVDLQISETEAIRTGKALKEHLRRDKKLILVVD 180

Query: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPV 240
           LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPV
Sbjct: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPV 240

Query: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 300
           RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE
Sbjct: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 300

Query: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360
           NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS
Sbjct: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360

Query: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420
           TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE
Sbjct: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420

Query: 421 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTYYD 480
           SKEELTKKLEYSASLEVQQQNRP                        MGTLSNIHKTYYD
Sbjct: 421 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKTYYD 480

Query: 481 MLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPD 540
           MLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPD
Sbjct: 481 MLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPD 540

Query: 541 IDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600
           IDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS
Sbjct: 541 IDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600

Query: 601 DEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNXXXXXXXXXXXXXX 660
           DEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNN              
Sbjct: 601 DEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNDDDEDIPDTASDDD 660

Query: 661 XXXXXXXXXXXXNNSEGIDRKRSIEDNHDDTSQKKTKAEPSQDGPVQHKGEGDDNEDSDS 720
                       NNSEGIDRKRSIEDNHDDTSQKKTKAEPSQDGPVQHKGEGDDNEDSDS
Sbjct: 661 EDDDHDDESDDENNSEGIDRKRSIEDNHDDTSQKKTKAEPSQDGPVQHKGEGDDNEDSDS 720

Query: 721 QLEEELMDMLDD 732
           QLEEELMDMLDD
Sbjct: 721 QLEEELMDMLDD 732

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 1310 bits (3390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/731 (88%), Positives = 656/731 (89%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           MTTQIRSP+GLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERAS+TG DDNEHD SP
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GG AGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 121 VYGGLCTQCGKEVSADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVVD 180
           VYGGLCTQCGKEVSADAF             QISETEAIRTGKALKEHLRRDKKLILVVD
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVVD 180

Query: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPV 240
           LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMN+DGS+LRPPPV
Sbjct: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPV 240

Query: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 300
           RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTG+LFGDRILSRDE
Sbjct: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDE 300

Query: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360
           NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS
Sbjct: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360

Query: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420
           TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE
Sbjct: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420

Query: 421 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTYYD 480
           SKEELTKKLEYSASLEVQQQNRP                        MGTLSNIH TYY 
Sbjct: 421 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMTYYQ 480

Query: 481 MLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPD 540
           MLSQ+NEPEPNLMEIIPSLKQKVFQNC+FVFSGLIPLGTDIQRSDIVIWTSTFGATST D
Sbjct: 481 MLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 540

Query: 541 IDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600
           ID+LTTHLITKNPSTYKARLAKKFNP+IKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS
Sbjct: 541 IDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600

Query: 601 DEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNXXXXXXXXXXXXXX 660
           DEELQNFQ+QLQKRQEYLEE QEQQHMLTSQENLNLFA GTSWLNN              
Sbjct: 601 DEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWLNNDDDDDIPDTASDDD 660

Query: 661 XXXXXXXXXXXXNNSEGIDRKRSIEDNHDDTSQKKTKAEPSQDGPVQHKGEGDDNEDSDS 720
                       N+ EGIDRKRSIEDNH+DTSQKKTKAEP QDGPVQ K EGDDNEDSDS
Sbjct: 661 EDDEHNDESDEENHPEGIDRKRSIEDNHEDTSQKKTKAEPLQDGPVQQKREGDDNEDSDS 720

Query: 721 QLEEELMDMLD 731
           QLEEELMDMLD
Sbjct: 721 QLEEELMDMLD 731

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score = 1257 bits (3253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/733 (85%), Positives = 649/733 (88%), Gaps = 2/733 (0%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDT-GDDDNEHDVS 59
           MTTQIRSP+GLPYPIQIDKL+PSVGSYLHEGDRL+VYKFWYLVERASDT GDDDNEHD +
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 60  PGGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHD 119
           PGG AGS  VSPPTKQLRESIEFFESPYEGDLISWNVDVGDE+ATANQVICEIKRPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 120 IVYGGLCTQCGKEVSADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVV 179
           IVYGGLCTQCGKEVSADAF             QISETEAIR+G+ALKEHLRRDKKLILVV
Sbjct: 121 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV 180

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPP 239
           DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMN+DGS+L+PPP
Sbjct: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP 240

Query: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 299
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYA+QIAKIVDPTGELFGDRILSRD
Sbjct: 241 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD 300

Query: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359
           ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ
Sbjct: 301 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 360

Query: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419
           STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP AN
Sbjct: 361 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN 420

Query: 420 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTYY 479
           ESKEELTKKLEYSASLEVQQQNRP                        MGTLSNIH TYY
Sbjct: 421 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHNTYY 480

Query: 480 DMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTP 539
            M+SQ NEPEPNLMEIIPSLKQKVFQNC+FVFSGLIPLGTDIQRSDIVIWTSTFGATST 
Sbjct: 481 QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 540

Query: 540 DIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599
           DIDYLTTHLITKNPSTYKARLAKKFNP+IKI+HPDWIFECLVNWKKVDEKPYTLIVDSPI
Sbjct: 541 DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600

Query: 600 SDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNXXXXXXXXXXXXX 659
           SDEELQNFQ QLQKRQEYLEE Q+QQHMLT QENLNLFAAGTSWLNN             
Sbjct: 601 SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTASDE 660

Query: 660 XXXXXXXXXXXXXNNSEGIDRKRSIEDNHDDTSQKKTKAEPSQDGPVQH-KGEGDDNEDS 718
                        NN  GIDRKRSIEDNH+D SQKKTKAEP QDGPVQH + E ++NEDS
Sbjct: 661 DEDDDHNDESNNENNPTGIDRKRSIEDNHNDASQKKTKAEPPQDGPVQHNEEEEENNEDS 720

Query: 719 DSQLEEELMDMLD 731
           DSQLEEELMDMLD
Sbjct: 721 DSQLEEELMDMLD 733

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 1181 bits (3055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/732 (82%), Positives = 629/732 (85%), Gaps = 2/732 (0%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           MTTQIRSP+GLPYPIQIDKLIPSVGS+L EGDRLLVYKFWYLVER SD GDDDN+HD SP
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GG  G +   P TKQLRESIEFFESPYEGDLISWNVDVGDE+ATANQVICEIKRPCNHDI
Sbjct: 61  GGGGGGSVSPP-TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDI 119

Query: 121 VYGGLCTQCGKEVSADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVVD 180
           VYGGLCTQCGKEVSADAF             QISETEAIRTG+ALKEHLRRDKKLILVVD
Sbjct: 120 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVD 179

Query: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPV 240
           LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYM +DGS+ +PPPV
Sbjct: 180 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPV 239

Query: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 300
           RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE
Sbjct: 240 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 299

Query: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360
           NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS
Sbjct: 300 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 359

Query: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420
           TGMLQLGRKTRQKSQESQEL+TDIMDNEKKLQEKID EVKRQEE+LNHQLATAEEP ANE
Sbjct: 360 TGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANE 419

Query: 421 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTYYD 480
           SKEELTKKLEYSASLEVQQQNRP                        M TL NIHKTYY 
Sbjct: 420 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTYYQ 479

Query: 481 MLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPD 540
           MLSQ  E EPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST D
Sbjct: 480 MLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 539

Query: 541 IDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600
           I+YLTTHLITKNP TYKARLAKKFNP+IK+VHPDWIFECLVNWKKVDEKPYTLIVDSPIS
Sbjct: 540 INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 599

Query: 601 DEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNXXXXXXXXXXXXXX 660
           D+ELQ+FQ QLQK+QEYL+E  EQQHML  QEN+NLFAAGTSWLN+              
Sbjct: 600 DDELQSFQKQLQKKQEYLDEHHEQQHMLMPQENINLFAAGTSWLNDDDDEDIPDTASDDD 659

Query: 661 XXXXXXXXXXXXNNSEGIDRKRSIEDNHDDTSQKKTKAEPSQ-DGPVQHKGEGDDNEDSD 719
                        +S  IDRKRSIED  D+  QKKTKAE SQ DGP QH+ EG++NEDSD
Sbjct: 660 DDNDDNSESDDERDSGDIDRKRSIEDGQDEAPQKKTKAEHSQEDGPAQHEEEGENNEDSD 719

Query: 720 SQLEEELMDMLD 731
           SQLEEELM MLD
Sbjct: 720 SQLEEELMGMLD 731

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/745 (57%), Positives = 515/745 (69%), Gaps = 45/745 (6%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           MTT + SP+ LPYPI ID+LI  +GS++ +G RL  +KFWY+VE AS    D+NE     
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSP--DENE----- 53

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GG           K +RESIEFFE+P+EGDL+SWNVDVGDEV   NQ ICEI RPCNHDI
Sbjct: 54  GGHR--------KKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDI 105

Query: 121 VYGGLCTQCGKEV-SADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVV 179
           VYGGLCT CGKEV  ++ F             ++S  EA      LK  LR  KKL+LVV
Sbjct: 106 VYGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVV 165

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPP 239
           DLDQT+IHCGVDPTI EWK D +NPN+E L+DV+SF LDEE +LPL+YM         PP
Sbjct: 166 DLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPK------PP 219

Query: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 299
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+IAKI+DP G LFGDRILSRD
Sbjct: 220 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRD 279

Query: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359
           ENGS+T KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+Q
Sbjct: 280 ENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQ 339

Query: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419
              MLQLGR  R+K+QES EL+TDIMD EKKLQEKID+EVKRQEEKLNHQ+A+ EE PA 
Sbjct: 340 QNTMLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAP 399

Query: 420 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTYY 479
           ESK++L KKLEYSASLEVQQQNRP                           L+ +H  YY
Sbjct: 400 ESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYY 459

Query: 480 DMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTP 539
             L Q +E + ++  ++P +K KVF++C+FVFSGLIPLGT+I R+DIV+WT+ FGA S+P
Sbjct: 460 KTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSP 519

Query: 540 DIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599
           +ID  TTH+IT+ P TYKAR+AK FN  IK+VHPDW+FECLV+WK VDEKPY LIV+   
Sbjct: 520 EIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTA 579

Query: 600 SDEELQNFQTQLQKRQEYLEETQEQQHMLTSQEN--LNLFAAGTSWLNNXXXXXXXXXXX 657
           +DEEL +++ +L +R   L E QE +  + S +N  +NLFA GTSWLN+           
Sbjct: 580 TDEELGDYKQKLARRSSALAE-QEMELAMESAKNGTINLFAGGTSWLNDDDDDEMPDGLD 638

Query: 658 XXXXXXXXXXXXXXXNNSEG--IDR-----KRSIEDNHD---DTSQKKTKAEPSQDGPVQ 707
                             +   +D      KRS+E++HD   D+S  K            
Sbjct: 639 DSDDEDDDDEQEEEKTEDQNQVVDGHTSQPKRSLENDHDSLGDSSPYKK----------S 688

Query: 708 HKGEGDDNEDSDSQLEEELMDMLDD 732
           H  E   + DSDS++EEEL++ LD+
Sbjct: 689 HVDELKQDNDSDSEIEEELLNALDE 713

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/655 (62%), Positives = 488/655 (74%), Gaps = 27/655 (4%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           M+TQI +P GLPYPI ID+LI  VG  + +GDRLL YKFW++V+ AS    DDN  DVS 
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSP--DDN--DVSS 56

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
             +AG        K +RESIEFFESPY+G LISWNVD+GDE+A+ NQV+ EI RPCNHD+
Sbjct: 57  PPTAGK-------KSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDV 109

Query: 121 VYGGLCTQCGKEVSAD-----AFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKL 175
           VYGGLCT CG+EV  D                    +IS  EA+  G  ++  LR++KKL
Sbjct: 110 VYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKL 169

Query: 176 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSML 235
           +LVVDLDQT+IHCGVDPTI EWKNDP NPNFETL+DVK F+L+EE +LP +YM       
Sbjct: 170 VLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPK---- 225

Query: 236 RPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRI 295
             PP+RKCWYYVKVRPGLKEF  K+APLFEMHIYTMATRAYA +IAKI+DP G+LFGDRI
Sbjct: 226 --PPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRI 283

Query: 296 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 355
           LSRDENGS+TTKSL +LFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNF
Sbjct: 284 LSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNF 343

Query: 356 LPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEE 415
           LPKQ   MLQLGR++R+KS+++++LL DIMD+EKKL+EKID+EVKRQEE+L+HQ AT EE
Sbjct: 344 LPKQQATMLQLGRRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEE 403

Query: 416 PP--ANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 473
           PP  A E+KEE++KK+EYSASLEVQQQNRP                          TL  
Sbjct: 404 PPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVR 463

Query: 474 IHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 533
           IH  YY++L +  E + ++  I+P++KQ V  NC FVFSGLIPLGTDIQR+DIVIWT+TF
Sbjct: 464 IHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTF 523

Query: 534 GATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTL 593
           GA ST DID  TTH+ITK P TYKARLAK FNP+IKI+HPDW+FECL +WK VDEKPY L
Sbjct: 524 GAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYEL 583

Query: 594 IVDSPISDEELQNFQTQLQKRQEYLEETQEQQHML--TSQENLNLFAAGTSWLNN 646
           IV+ P+S+ EL+ F+ +L KRQ  L    E       T+   L LF+ G SWL++
Sbjct: 584 IVEQPVSETELEEFKKKLAKRQ-LLATANENLSPANGTNSAELELFSGGMSWLDD 637

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/651 (60%), Positives = 485/651 (74%), Gaps = 23/651 (3%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           M T + +P+ LPYPI ID+LI  +GS + +G RL  YKFWY+VE AS           SP
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIAS-----------SP 49

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
             + G+ G     K +RESIEFFESP+EGDL+SW VD GDEVA+A QVICEI RPCNHD+
Sbjct: 50  DENDGNGGAQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDV 109

Query: 121 VYGGLCTQCGKEVSA-DAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVV 179
           VYGGLCT CGKEV   D               ++S  EA      LK+ LR+ KKL+LVV
Sbjct: 110 VYGGLCTMCGKEVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVV 169

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPP 239
           DLDQT+IHCGVDPTI EWK DP+NPN+ETL+DV+ F+L+EE ++P MYM   G  L   P
Sbjct: 170 DLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYM---GPRL---P 223

Query: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 299
            RKCWY+VKVRPGL+EFFA++APL+EMHIYTMATR YAL+IAKI+DP G LFGDRILSRD
Sbjct: 224 ERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRD 283

Query: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359
           ENGSLT KSL +LFPTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+Q
Sbjct: 284 ENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQ 343

Query: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419
            +G+LQLGR+T +K QES ELLTDIMD EK+LQEKID+EVKRQEEKL+HQL T +EP   
Sbjct: 344 QSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQG 403

Query: 420 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTYY 479
           ESKE+LTKKLEYSASLEVQQQNRP                          TL+ IH+ YY
Sbjct: 404 ESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYY 463

Query: 480 DMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTP 539
            +L + NE   ++  ++P++K +VF++CYFVFSGLIPLGT+I+R+DIV+WT  FGA ++ 
Sbjct: 464 KLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSS 523

Query: 540 DIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599
           +ID  TTH+ITK P TYKAR+AK FN  +K+VHPDW+FECLV W  VDEKPY LI+  P 
Sbjct: 524 EIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPA 583

Query: 600 SDEELQNFQTQLQKRQEYLEETQEQ----QHMLTSQEN-LNLFAAGTSWLN 645
           ++EE+Q+F+ ++++R    E+ +EQ      M T+Q++ LNLFA GTSWLN
Sbjct: 584 TEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/659 (61%), Positives = 491/659 (74%), Gaps = 29/659 (4%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           MTT + +P+GLPYPI ID+LI  +G+Y+ +G RL  YKFWY+VE AS   D+D      P
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDND------P 54

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
             +      S P K++RESIEFF++P+EG LISWN+DVGDE+++A+QVICEIKRPCNHDI
Sbjct: 55  ANT--DTQASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDI 112

Query: 121 VYGGLCTQCGKEV---SADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLIL 177
           VYGGLCTQCGKEV       F             +IS  EA+  G+  K+ LR +KKL+L
Sbjct: 113 VYGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVL 172

Query: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRP 237
           VVDLDQT+IHCGVDPTI EWK+DPNNPN++TL+DV+ F L+EE VLP MYM       +P
Sbjct: 173 VVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGP-----KP 227

Query: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILS 297
            P RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+I KI+DPTGELFG+RILS
Sbjct: 228 TP-RKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILS 286

Query: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357
           RDENGSLT+KSL +LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLP
Sbjct: 287 RDENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLP 346

Query: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417
           KQ T MLQLGR++R+K++E+ ELLTDIMD EKKLQEKID+EVKRQE+ L+HQ+   EE  
Sbjct: 347 KQQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESV 406

Query: 418 ANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKT 477
           +NE+KEE TKKLE+SAS+EVQQQNRP                          TL+ +H  
Sbjct: 407 SNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNE 466

Query: 478 YYDMLSQQ--NEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGA 535
           YY +L  +  +E   ++  I+P LKQ VF+ C+FVFSGLIPL TDI+R+DIV+WTS FGA
Sbjct: 467 YYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGA 526

Query: 536 TSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIV 595
            S+ +I+ +TTH+ITK P T+KARLAK FN  IKIVHPDW+FECL+ W  VDEKPYTLIV
Sbjct: 527 ESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIV 586

Query: 596 DSPISDEELQNFQTQLQKRQEYLEETQEQQH----MLTSQEN----LNLFAAGTSWLNN 646
           + PISD EL+ F+  L  R+  L E   +Q+      T  EN    ++LFA GTSWLN+
Sbjct: 587 EEPISDRELKKFREDLNNRK--LTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLND 643

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/656 (60%), Positives = 488/656 (74%), Gaps = 26/656 (3%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           M+T + +P GLPYPI +D+L+  +GSY+ +G RL  YKFWY+VE A+   D+D +++   
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYE--- 57

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
                   +    +++RESIEF+E+P+EGDL+SWNVD  DE+A  N  +CEIKRPCNHDI
Sbjct: 58  -----GPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDI 112

Query: 121 VYGGLCTQCGKEVSA-DAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVV 179
           VYGGLCT CGKEV   D               ++S  EAI   K +   L+ +KKL+LVV
Sbjct: 113 VYGGLCTMCGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVV 172

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPP 239
           DLDQT+IHCGVDPTI EWK DP+NPN+ETL+DVK F+L+EE +LPL+YM         PP
Sbjct: 173 DLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG------PKPP 226

Query: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 299
           VR CWYYVK+RPGLKEFF K+APL+EMHIYTMATRAYAL+IAKI+DP   LFGDRILSRD
Sbjct: 227 VRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRD 286

Query: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359
           ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ
Sbjct: 287 ENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 346

Query: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419
            T MLQLGR+TRQK +ES+ELLTDIMD EKKLQEKID+EVKRQEEKLNHQ+ATAEE    
Sbjct: 347 QTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQ 406

Query: 420 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTYY 479
           ESKE++ KKLE+SASLEVQQQNRP                          TL+ IHK +Y
Sbjct: 407 ESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFY 466

Query: 480 DML---SQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGAT 536
            +L   S QNE +  ++  +P LK+KVF+ C+FVFSGLIPLGTDI+R+DIVIWTS FGA 
Sbjct: 467 HLLEDASDQNEADITML--LPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAE 524

Query: 537 STPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVD 596
           ST DID  TTH++TK P TYKARLAK FNP IK+VHPDWIFECL +WK++DEKPY LIV+
Sbjct: 525 STSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVE 584

Query: 597 SPISDEELQNFQTQLQKRQEYLEETQEQQHMLTS------QENLNLFAAGTSWLNN 646
            P+S++EL  F+ +L+++++ LEE + ++    +      +  + LF   TSWLN+
Sbjct: 585 QPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERANQMEPTMPLFGGDTSWLND 640

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/783 (53%), Positives = 522/783 (66%), Gaps = 62/783 (7%)

Query: 3   TQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDV---- 58
           T IR+P GLPYPI ID+L+  +G+ +++ DRLL YKFWY+VE A  T  D+ E D     
Sbjct: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIA--TSPDELEDDNDNDN 62

Query: 59  -----------SPGGSAGSNGVSPPTKQ------------------LRESIEFFESPYEG 89
                      +  G+  +N  + P+ +                  +RESIEFF+ PY+G
Sbjct: 63  DNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPYDG 122

Query: 90  DLISWNVDVGDEVATANQVICEIKRPCNHDIVYGGLCTQCGKEVSA----DAFXXXXXXX 145
            L SW V+ GD++   NQ +CEI+RPCNHD++YGGLCT CGKEV      D         
Sbjct: 123 ILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLTIS 182

Query: 146 XXXXXXQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPN 205
                 +IS  EA+  G+++K+ LR DKKLILVVDLDQT+IHCGVDPTI EWK DP NPN
Sbjct: 183 HTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTNPN 242

Query: 206 FETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFE 265
           FETL+DVK F L+EE +LPLMYM         PP RKCWYYVKVRPGLK+FF KVAPLFE
Sbjct: 243 FETLKDVKEFALEEEPILPLMYMGPK------PPARKCWYYVKVRPGLKDFFQKVAPLFE 296

Query: 266 MHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDD 325
           MHIYTMATRAYA +IAKI+DPTG+LFG+RILSRDENGSLTTKSL +LFPTDQSMV++IDD
Sbjct: 297 MHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDD 356

Query: 326 RGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRKTRQ-----KSQESQEL 380
           RGDVWNW PNLIKV+PYNFFVGVGDINSNFLPKQ   MLQLGR++ +      ++E+ +L
Sbjct: 357 RGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDL 416

Query: 381 LTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP--ANESKEELTKKLEYSASLEVQ 438
           LTDIMD EK LQ KI++EVKRQEEKLNHQLAT EEPP  A E+KEE++KK+EYSASLEVQ
Sbjct: 417 LTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQ 476

Query: 439 QQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTYYDMLSQQNEP----EPNLME 494
           Q+NRP                          TLS IH  YY+ML + NE     EP++  
Sbjct: 477 QKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKY 536

Query: 495 IIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPS 554
           I+P +KQ V Q+C+FVFSGLIPLGT+IQ+SDIVIWT+ FGA ST DID  TTH+ITK P 
Sbjct: 537 IMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPG 596

Query: 555 TYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQTQLQKR 614
           TYKARLAK ++P IKIVHPDW+FECL+ WK V+EKPY L+V+  +SD+EL +F  +L++R
Sbjct: 597 TYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERR 656

Query: 615 QEYLEETQEQQHMLTSQENL-----NLFAAGTSWLNNXXXXXXXXXXXXXXXXXXXXXXX 669
            +  E   E  +      N+     NLFA GTSWL+                        
Sbjct: 657 IQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWLDEDEEIFEGDDDDDDDDDDDDDDDE 716

Query: 670 XXXNNSEGIDRKRSIEDNHDDTSQKKTKAEPSQDGPVQHKGEGDDNEDSDSQLEEELMDM 729
               ++EG     S E   DD++ +K   + +++ P +   +  D+++S S+ EEEL++M
Sbjct: 717 DEDEDNEGTKTSTS-EKPMDDSTAEKDAKKNTKEAPSEGASDDGDDDESGSEFEEELLNM 775

Query: 730 LDD 732
           LDD
Sbjct: 776 LDD 778

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/681 (55%), Positives = 474/681 (69%), Gaps = 42/681 (6%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDD----NEH 56
           M+T + SP  LP+PI ID+LI  +GS++ +G RL  YKFWY+VE A    ++D    N  
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 57  DVSPGGS---AGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIK 113
           D+S   S      N  S   K +RESIEFFESP+EGDLI WNVD GDE+ + NQ++C+IK
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 114 RPCNHDIVYGGLCTQCGKEVS-ADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRD 172
           RPCNHDIVY G+CTQCGKEV  +D               +IS  EA    ++    L++ 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232
           KKLILVVDLDQT+IHCGVDPTI EWKNDP NPN+ETL+DV+SF+LDEE +LP  YM    
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPR- 239

Query: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 292
                PPVRKCWYYVKVRPGLKEFFAK+APL+EMHIYTMATRAYAL+IAKI+DP G LFG
Sbjct: 240 -----PPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294

Query: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352
            RILSRDENGSLT KSL +LFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDIN
Sbjct: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354

Query: 353 SNFLPKQSTGMLQLGRKTRQKSQ----------------------ESQELLTDIMDNEKK 390
           SNFLP+Q + MLQLG ++ +K                        +++ELLTDIMD EKK
Sbjct: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414

Query: 391 LQEKIDKEVKRQEEKLNHQLATAEEPPANESK-EELTKKLEYSASLEVQQQNRPXXXXXX 449
           LQ+KID+EV+RQE+KL        +  ++ES   EL+KK+E+SASLEVQQQNRP      
Sbjct: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474

Query: 450 XXXXXXXXXXXXXXXXXXMGTLSNIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYF 509
                                L+ +H T+Y+ L +      ++  ++P LK  VF    F
Sbjct: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534

Query: 510 VFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIK 569
           VFSGLIPLGTDI+R+DIV+WT+ FGA ST DID  TTH+ITK   TYKARLAK FNP+IK
Sbjct: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594

Query: 570 IVHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQTQLQKRQEYLE----ETQEQQ 625
           +VHPDWIFECLV+WK++ EKPY LI++ P S+EEL+ F+ +L+ + E LE    ET+ Q 
Sbjct: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQF 654

Query: 626 HMLTSQE-NLNLFAAGTSWLN 645
             L +++  ++LFA+GTSWLN
Sbjct: 655 EALNTRDPAIDLFASGTSWLN 675

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/656 (56%), Positives = 462/656 (70%), Gaps = 31/656 (4%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           M+T + +P GLPYPI I KLI S+GS++ +G RL  YKFWY+VE A     D+N+  V+ 
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAK--SPDENDDGVND 58

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
             S          K +RESIEFF+SP+EGDL+SWNVDVGDE+   NQ ICEI RPCNHDI
Sbjct: 59  EHSK---------KSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDI 109

Query: 121 VYGGLCTQCGKEV-SADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVV 179
           VY G+CT CGKEV  +D               ++S  EA   G+ +K+ L R+KKLILVV
Sbjct: 110 VYAGICTMCGKEVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVV 169

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPP 239
           DLDQT+IHCGVDPTIAEWKNDP NPNFETLRDVKSF L+EE +LP MYM         PP
Sbjct: 170 DLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMG------PKPP 223

Query: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 299
             KCWYYVK+RPGLKEFF +V+ L+EMHIYTMATR+YA +IAKI+DP G LF DRILSR+
Sbjct: 224 THKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRN 283

Query: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359
           ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLP+Q
Sbjct: 284 ENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQ 343

Query: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQ-LATAEEPPA 418
            T MLQLGR+  +K++++ ELLTDIMD EKKLQEKID+EVKRQEE L+HQ  A  EE  +
Sbjct: 344 QTTMLQLGRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISS 403

Query: 419 NESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHKTY 478
              KE++TKK+E+SASLEVQQQNRP                           L N+ + Y
Sbjct: 404 QVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKY 463

Query: 479 YDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           Y+ L  + + E  +  ++P LK+KV + C FVFSGLIPLGT+IQ++DIV+WT+ FGA S+
Sbjct: 464 YEEL--KTDKEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSS 521

Query: 539 PDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSP 598
            DI   TTH+ITK P TYKA++AK F   IK++HPDW+FECL+NWK + E PY   +   
Sbjct: 522 ADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPT 581

Query: 599 ISDEELQNFQTQLQKRQEYL--------EETQEQQHMLTSQE--NLNLFAAGTSWL 644
            +D+EL  F+  L++R++          EE+ E      S +  +++LFA+G SWL
Sbjct: 582 ATDKELNEFKEALERRKKKETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWL 637

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/765 (50%), Positives = 495/765 (64%), Gaps = 64/765 (8%)

Query: 3   TQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSPGG 62
           T + S  GLPYP+ +D+LIP VG  +  GDRL  YKFWY+VE A          D +  G
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAG--------VDAAAEG 58

Query: 63  SAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDIVY 122
            +   G +   K +RES+EFFESP+EG ++SW+VD GDE+      +C ++RPCNHD+VY
Sbjct: 59  DSDGTGTTA-KKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVY 117

Query: 123 GGLCTQCGKEV----------SADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRD 172
            GLCT CG+EV          ++                QIS  EA +    L++ LR  
Sbjct: 118 NGLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAA 177

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232
           +KL+LVVDLDQT++HCGVDPTI EWK DP NPN+E LRDV+SF L+EE +LP +Y+    
Sbjct: 178 QKLVLVVDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGK- 236

Query: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 292
              RP P RKCWYYVKVRPGLK+FF ++APLFEMHIYTMATRAYAL+IAKI+DP   LFG
Sbjct: 237 ---RPAP-RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFG 292

Query: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352
           DRILSRDENGSLT KSL +LFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDIN
Sbjct: 293 DRILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDIN 352

Query: 353 SNFLPKQSTGMLQLGRKTR--QKSQESQE---------LLTDIMDNEKKLQEKIDKEVKR 401
           SNFLPKQ   MLQ+GR+++  ++  ES++         LLTDIM+ EK+LQEKID+EVKR
Sbjct: 353 SNFLPKQQPTMLQMGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKR 412

Query: 402 QEEKLNHQLATAEEPPA-NESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXX 460
           QE KLN   A  +E     +SKEE TKKLE+SAS+EVQQ+NRP                 
Sbjct: 413 QEHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDN 472

Query: 461 XXXXXXXMGTLSNIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTD 520
                     L+++HK YY  L ++N  + N+  I+  LK +VFQ+C+FVFSGLIPL T+
Sbjct: 473 DDELFYLKDRLADLHKRYYSTL-KENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTN 531

Query: 521 IQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECL 580
           +Q +DIVIWT+ FGAT+T D+D  TTHLITK P T KARLAK FNP IKIVHPDWIFECL
Sbjct: 532 VQAADIVIWTNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECL 591

Query: 581 VNWKKVDEKPYTLIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQE----NLNL 636
           + W++VD KPY LIV+ P+S+ +++ F+ +L +++E  E    +  +L + +    +++L
Sbjct: 592 IKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDL 651

Query: 637 FAAGTSWLNNX------XXXXXXXXXXXXXXXXXXXXXXXXXNNSEGIDRKRSIEDNHDD 690
           FA G SWLN+                                  + G   KRS+ +N D 
Sbjct: 652 FAGGISWLNDEDDEEIPKEDEESEDDEDENDENNTTMLDDGEPETGGTPDKRSLFENPDQ 711

Query: 691 TSQKKTK---AEPSQDGPVQHKGEGDDNEDSDSQLEEELMDMLDD 732
            ++KK +   AEPS               +SDS+LE+EL+++LDD
Sbjct: 712 PAEKKPRIQDAEPSS--------------ESDSELEDELLNVLDD 742

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/659 (55%), Positives = 453/659 (68%), Gaps = 29/659 (4%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           M T ++ P G+PYPI I KLI  VGSY+++GDRL  YKFWYLVE A    + D   +V  
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           G  +         K +RESI+FF++P+EG +I WNVDVGDE+    +++CE+KRPC+HDI
Sbjct: 61  GEQS--------KKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDI 112

Query: 121 VYGGLCTQCGKEV-SADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLILVV 179
           VY G+CT CGKEV   D               ++S  EA   G+  K  L R KKLILVV
Sbjct: 113 VYAGICTMCGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172

Query: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPP 239
           DLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM         PP
Sbjct: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGP------KPP 226

Query: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 299
           V KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+RILSRD
Sbjct: 227 VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRD 286

Query: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359
           ENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+Q
Sbjct: 287 ENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQ 346

Query: 360 STGMLQLGRKTRQK--SQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQ-LATAEEP 416
              MLQ+GR+       +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+  A  EE 
Sbjct: 347 QATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEA 406

Query: 417 PANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHK 476
            A     ++TKK+E+SASLEVQQQNRP                           L+ +  
Sbjct: 407 VAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQS 466

Query: 477 TYYDMLSQQ--NEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFG 534
            +Y  L  +  N  + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+WT  FG
Sbjct: 467 EFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFG 526

Query: 535 ATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLI 594
           A+ST +I   TTH+ITK P T KAR+AK FNP IK+VHPDW+FECL  WK VDEK + L 
Sbjct: 527 ASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELK 586

Query: 595 VDSPISDEELQNFQTQLQKRQE--------YLEETQEQQHMLTSQEN-LNLFAAGTSWL 644
           VD   S+ EL+ F+  L+KR +        +  +       ++S +N ++LFA G+SWL
Sbjct: 587 VDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/653 (54%), Positives = 450/653 (68%), Gaps = 34/653 (5%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           MTT ++ P  LPYPI I +L  S G  + +G RL  YK+W   +  +           SP
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVT-----------SP 49

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
             ++     + P KQ  + I  F+SP EG L+S+N+ +GDE   +N V+ EIK+ C HD+
Sbjct: 50  NDTS-----TKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDV 104

Query: 121 VYGGLCTQCGKEV-------SADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDK 173
            YGGLC  CGK V       ++D               +ISE +A    +  ++ LR+ K
Sbjct: 105 TYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLK 164

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           KL+LVVDLDQT+IHCGVDPTI EW  DP NPN+E L+D+KSF L EE +LP  YM     
Sbjct: 165 KLVLVVDLDQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPK-- 222

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 293
               PP RKCWYYVK+RPGLKEFF K+AP FE+HIYTMATRAYAL+IAKI+DP G+LFGD
Sbjct: 223 ----PPARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGD 278

Query: 294 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 353
           RILSRDENGS+T KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINS
Sbjct: 279 RILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINS 338

Query: 354 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 413
           NFLP+Q   ML LGR+ R+K++E +ELLTDI+D EKKLQEKID+EVKRQEEKL+ ++   
Sbjct: 339 NFLPRQQNSMLHLGRRHRKKAEE-EELLTDILDTEKKLQEKIDEEVKRQEEKLS-KMTEE 396

Query: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 473
           ++P    SKE+L KKLE+SASLEVQQQNRP                           L  
Sbjct: 397 KQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQ 456

Query: 474 IHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 533
           +H  YY+ LS+ + P PN+  ++P LK++VF  C FVFSGLIPLGTD++++DI +WTS F
Sbjct: 457 VHGKYYEDLSKHSSP-PNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMF 515

Query: 534 GATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTL 593
           GA +T DID  TTH+ITK P T+KARLAK FNP+IK+VHPDWIFECLVNWK+VDEK Y L
Sbjct: 516 GAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYEL 575

Query: 594 IVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNN 646
           +++ P+S+EEL +F+ +L+  ++   + QE+   ++S E +NL A   SWL+N
Sbjct: 576 LIEQPVSEEELDDFKKKLENEKKD-AQIQEEVDRVSSDE-INLLAGNDSWLDN 626

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/647 (53%), Positives = 441/647 (68%), Gaps = 35/647 (5%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           MTT IR P  LP+P+ I KL  S G  + +G RL VYK+W L +  +             
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIIT------------- 47

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
                 N  +P  K+  + I  F+SP EG L+S N+ +GDE      VI E+ + C+H++
Sbjct: 48  ----APNEEAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEV 103

Query: 121 VYGGLCTQCGKEVSAD--------AFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRD 172
            YGGLC  CGK V  D                       ++SE +A    K  ++HLR  
Sbjct: 104 TYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREH 163

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232
           KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM    
Sbjct: 164 KKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGP-- 221

Query: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 292
              RPPP RKC YYVK+RPGL+EFF K+AP FE+HIYTMATRAYAL+IAKI+DP GELFG
Sbjct: 222 ---RPPP-RKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFG 277

Query: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352
           DRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDIN
Sbjct: 278 DRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDIN 337

Query: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412
           SNFLP+Q   ML LGR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N ++  
Sbjct: 338 SNFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINE 395

Query: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLS 472
             +P    SKE+LTKKLE++ASLEVQQQNRP                           L 
Sbjct: 396 ENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILL 455

Query: 473 NIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 532
           N+HKTYYD L++Q +P P++  ++P +K +VF+ C+FVFSGLIPLGT+++++DIV+WTS 
Sbjct: 456 NVHKTYYDKLAEQGQP-PDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSM 514

Query: 533 FGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYT 592
           FGAT++ D+D  TTH+ITK P T+KARLAK +NP IK++HPDWIFECLV W +V+EKPY 
Sbjct: 515 FGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYE 574

Query: 593 LIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAA 639
           L  +  +S EEL+ F+ +L K+++  +   E      +QE LNL   
Sbjct: 575 LTTEQDVSPEELEEFKKRLDKKKQSEKALSESIQQEATQE-LNLLTG 620

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/654 (53%), Positives = 442/654 (67%), Gaps = 35/654 (5%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           MTT IR P  LP+PI I KL  S G  + +G RL VYK+W L              DV  
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWEL-------------QDVI- 46

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
                 N  +   K+  + I  F+SP EG L+S  V VGDE    + +I E+++PC+H++
Sbjct: 47  ---TAPNEEASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEV 103

Query: 121 VYGGLCTQCGKEVSAD--------AFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRD 172
            YG LC  CGK V  D                       ++SE +A    K  ++ LR  
Sbjct: 104 TYGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRER 163

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232
           KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM    
Sbjct: 164 KKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGP-- 221

Query: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 292
              RPPP R+C YYVK+RPGL+EFF KVAP FE+HIYTMATRAYAL+IAKI+DPT  LFG
Sbjct: 222 ---RPPP-RRCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFG 277

Query: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352
           DRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDIN
Sbjct: 278 DRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDIN 337

Query: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412
           SNFLP+Q   ML +GR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N +++ 
Sbjct: 338 SNFLPRQQNSMLHMGRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISE 395

Query: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLS 472
             +P  + SKE+LTKKLE++ASLEVQQQNRP                           L 
Sbjct: 396 ENQPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILL 455

Query: 473 NIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 532
           N+H+TYY+ L+ + E  P++  ++P +K KVF  C+FVFSGLIPLGT+I+ +DIV+WT+ 
Sbjct: 456 NVHRTYYEELA-KTEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNM 514

Query: 533 FGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYT 592
           FGA ++ DID  TTH+ITK P T+KARLAK +NP IKIVHPDWIFECLV W + DEKPY 
Sbjct: 515 FGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYE 574

Query: 593 LIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNN 646
           LI++  +S +EL+ FQ  L+KRQ   +  +E     T +E LNL A    WL+N
Sbjct: 575 LIIEQEVSSDELEEFQRNLKKRQMAEKAARESLQQETGEE-LNLLAGNDMWLDN 627

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/660 (51%), Positives = 434/660 (65%), Gaps = 35/660 (5%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           M+T IR P  LPYPI + +L  S G  +  G RL  YK+W   +  +  GD+      S 
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDE------SA 54

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
           GG +         +Q  + +  F+SP  G ++S N+ +GDE   +   + EIK+PC HD+
Sbjct: 55  GGKS--------KRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDV 106

Query: 121 VYGGLCTQCGKEVSADAFX-------XXXXXXXXXXXXQISETEAIRTGKALKEHLRRDK 173
            YGGLC QCG+ V  +                      +ISE +A    K+ ++ LR  +
Sbjct: 107 TYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREAR 166

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           KL+LVVDLDQT+IHCGVDPTI EW  DP+NPN+E+L+DV+SF+L EE VLP  YM     
Sbjct: 167 KLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGP--- 223

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 293
               PP RKCWYYVK+RPGL++FF+ +AP FE+HIYTMATR YAL+IAKI+DP G LFGD
Sbjct: 224 ---KPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGD 280

Query: 294 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 353
           RILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDINS
Sbjct: 281 RILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINS 340

Query: 354 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 413
           NFLP+Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+ KI +EVKRQEE++  +L+  
Sbjct: 341 NFLPRQQNSMLHLGRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QKLSEE 399

Query: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 473
           + P    SKE++ KKLE++ASLEVQQQNRP                           L  
Sbjct: 400 KIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLR 459

Query: 474 IHKTYYDMLSQQ----NEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIW 529
           +H  YYD L +      E  P++  +IPSLK+ VF+ C FVFSGLIPL T+I R+DIV+W
Sbjct: 460 VHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLW 519

Query: 530 TSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEK 589
           T+TFGA +T +IDY TTHLITK P T KARLA  FN  IKIVHPDWIFEC+VNWK+VDEK
Sbjct: 520 TNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEK 579

Query: 590 PYTLIVDSPISDEELQNFQTQL---QKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNN 646
           PY LIV+ P+S E L+NF+ +L   +K +  ++     Q   T  + + L     SWL+N
Sbjct: 580 PYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDN 639

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/654 (52%), Positives = 441/654 (67%), Gaps = 40/654 (6%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60
           M+T IR P  LPYPI I +L  S G  + +G RLL YK+W LV+  +  G+++       
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEE------- 53

Query: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120
            G A         KQ  + +  F+SP  G ++S +V VGDE   + + + EI++ C HD+
Sbjct: 54  AGKA--------RKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDV 105

Query: 121 VYGGLCTQCGKEV-----SADAFXXXXXXXXXXXXX-QISETEAIRTGKALKEHLRRDKK 174
            YGGLC QCG+ V     +AD                ++SE +A   G++ +  LR  +K
Sbjct: 106 TYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARK 165

Query: 175 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSM 234
           L+LVVDLDQT+IHCGVDPTI EW  DPNNPN+E L+DV+SF+LDEE VLP  YM      
Sbjct: 166 LVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPK--- 222

Query: 235 LRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDR 294
              PP RKCWYYVK+RPGLKEFFAK+AP FE+HIYTMATRAYAL+IAKI+DP G+LFGDR
Sbjct: 223 ---PPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDR 279

Query: 295 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 354
           ILSRDENGSLT KSL +LFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSN
Sbjct: 280 ILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSN 339

Query: 355 FLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAE 414
           FLP Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+EKI++EVKRQE+++ H+L   +
Sbjct: 340 FLPIQQNSMLHLGRRNRKKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRLTDEK 398

Query: 415 EPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNI 474
            P       ++ KKLE++ASLEVQQQNRP                           L  +
Sbjct: 399 LP----DTRDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKV 454

Query: 475 HKTYYDMLSQQN---EPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTS 531
           H  YYD L + N   +P P++  ++P LK+ VF+ C FVFSGLIPL T+I+R+DIV+WT+
Sbjct: 455 HSAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTN 514

Query: 532 TFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPY 591
            FGA++T ++DY TTHLIT+ P T KARLAK FNP IKIVHPDWIFECLV W++V+E PY
Sbjct: 515 MFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPY 574

Query: 592 TLIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLN 645
            LIV+ P+ +E L+NF+  L + Q+ ++   +      S+ +L L     SWL+
Sbjct: 575 ELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQD-----SRSSLLLLDGNGSWLD 623

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/660 (48%), Positives = 424/660 (64%), Gaps = 48/660 (7%)

Query: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFW----YLVERASDTGDDDNEH 56
           + T ++    LPYPI + +L    G ++ +G RL  Y++W     LV+    T       
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT------- 55

Query: 57  DVSPGGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPC 116
                            KQ  + +  F+SP  G +  W+  V DE A+AN  +  I++ C
Sbjct: 56  ----------------KKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDC 99

Query: 117 NHDIVYGGLCTQCGKEVSADAFXXXXXXXXXXXXXQISETEAIRTGKALKEHLRRDKKLI 176
           NHDI YGGLC QCG  V  +               ++SE +A    ++    LR +KKL+
Sbjct: 100 NHDITYGGLCVQCGNTVDEEDNSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLV 159

Query: 177 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLR 236
           LVVDLDQT+IHCGVDPTI EW  DP NPN++ L+DVKSFTL++E ++P  Y         
Sbjct: 160 LVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPK----- 214

Query: 237 PPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRIL 296
            PP RK WYYVK+RPGLKEFF  V+P FEMHIYTMATR+YA +IAKI+DPTGELFGDRIL
Sbjct: 215 -PPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRIL 273

Query: 297 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 356
           SRDENGSLTTKSL +LFP DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFL
Sbjct: 274 SRDENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFL 333

Query: 357 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNH---QLATA 413
           P+Q   +L LGR  R+K QE ++L++DI+DNEKKL+EKID+EVKRQEE ++H        
Sbjct: 334 PRQQNSVLHLGRHHRRK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRK 392

Query: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 473
           E  P N  KE+++KKLE+SASLEVQQQNRP                           L  
Sbjct: 393 EGGPPN--KEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLR 450

Query: 474 IHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 533
           +HK Y++  ++  +  P++  ++P +K KVFQ C+FVFSGLIPL TD++++DIV+WT  F
Sbjct: 451 VHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMF 510

Query: 534 GATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTL 593
           GAT++ DI+Y TTH+IT    T+KARLAK FNP IKIVHPDW+FECLV W++V E PY L
Sbjct: 511 GATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYEL 570

Query: 594 IVDSPISDEELQNFQTQLQKRQEY-------LEETQEQQHMLTSQENLNLFAAGTSWLNN 646
           ++  P+ +++++ F+ +L K+           E+  E + +L  +   +L A   SWL+N
Sbjct: 571 LIQDPVDEDKVKEFKEKLDKKISNPSSSVNPFEDGNEDEEVLGDE--FHLLAGNDSWLDN 628

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 217 LDEELVLPLMYMNDDGSMLRPPPVRKCWYYVKV--RPGLKEFFAKVAPLFEMHIYTMATR 274
           LDE LV       D    + P  +    ++V V  RPG+ EF  +V+ L+E+ ++T +  
Sbjct: 330 LDETLVHSSFKYVDSADFVIPVTIDNQTHHVYVIKRPGVDEFLKRVSELYEVVVFTASVS 389

Query: 275 AYALQIAKIVDPTGELFGDRIL 296
            Y   +  I+DP   +   R+ 
Sbjct: 390 RYGDPLLNILDPANTIIHHRLF 411

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 38/131 (29%)

Query: 170 RRDKKLI----LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPL 225
           + +KKLI    LV+DLD+T++H                  F+ L+         + VLP+
Sbjct: 294 KTEKKLIGKKCLVLDLDETLVHSS----------------FKYLQTA-------DFVLPV 330

Query: 226 MYMNDDGSMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
              N D  +           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 331 ---NIDEQIHN--------VYVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILD 379

Query: 286 PTGELFGDRIL 296
           P  +L   R+ 
Sbjct: 380 PGRQLIHHRLF 390

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 60/125 (48%), Gaps = 15/125 (12%)

Query: 503 VFQNCYFVFSGLIPLGTDIQRSDIVIWT---STFGATSTPDIDYLTTHLITKNPS--TYK 557
           +F+N Y +F  L        +++++ ++   +  G T+   I  LTTHLIT +P+     
Sbjct: 119 IFKN-YQIFLSL----NSFNKTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVI 173

Query: 558 ARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQTQLQKRQEY 617
           A +A +    I  V+P W+ +C  +   V+E  + + + S   D      + +LQ     
Sbjct: 174 ATIASEQKQNISFVYPTWLCQCFKSMTLVNESDHLINIQSSAEDS-----KNRLQDLWNM 228

Query: 618 LEETQ 622
           +EE+Q
Sbjct: 229 VEESQ 233

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 519 TDIQRSDIVIWT---STFGATSTPDIDYLTTHLITKNPS--TYKARLAKKFNPQIKIVHP 573
           T   R++ ++++   +  G + +  I   TTHLI+ +P+     A +A   + +IK V+P
Sbjct: 133 TVFNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYP 192

Query: 574 DWIFECLVNWKKVDEKPYTLIVDSPISDEELQ 605
            W+ +C +  K VDEK +  I+DS +S E+ +
Sbjct: 193 AWLCQCFLEVKYVDEKNF--ILDSSLSPEDAE 222

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 11/109 (10%)

Query: 500 KQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTT---HLITKNPSTY 556
           K    ++CY   S           ++  ++TS         +DYL+T   H+IT +P   
Sbjct: 115 KTHFMKDCYVYVSS-----QQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 557 KARLAKKFNP-QIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPISDEEL 604
              + K+FN  ++  V   W+ EC V  + V E  Y  +V S +S+EE+
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAY--LVGSEMSNEEV 216

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRIL 296
           YV  RPG+ EF  KV  LFE+ I+T +   Y   +   +DP G+    R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W
           (REAL)
          Length = 1075

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 17/142 (11%)

Query: 471 LSNIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWT 530
           + N+   +Y    QQ  P      I      K+F +     +     G+  QR  I    
Sbjct: 342 VGNVSWLFYMFALQQFVPAAQCKLIHQPFHAKLFTSKELTVAYTNYFGS--QRFYIQRLV 399

Query: 531 STFGATSTPDIDYLTTHLITKNPSTYKARLAKKF--NPQIKIVHPD--WIFECLVNWKKV 586
              G  STP++    THLITKN    K ++AKK+  +PQ  I+  +  W+ EC +N  K+
Sbjct: 400 EILGGLSTPELTRKNTHLITKNAIGKKFKVAKKWSLDPQNAIIVTNHLWLEECYMNNSKL 459

Query: 587 DEKPYTLIVDSPISDEELQNFQ 608
           + K           D   QNF+
Sbjct: 460 NPK-----------DSRFQNFK 470

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 38/132 (28%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  LV+DLD+T++H                 +F+ LR         + V+P+    DD  
Sbjct: 229 KKCLVLDLDETLVHS----------------SFKYLRTA-------DFVIPVEI--DD-- 261

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTG----E 289
                  +    YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+DP G     
Sbjct: 262 -------QVHNVYVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHR 314

Query: 290 LFGDRILSRDEN 301
           LF D   + D N
Sbjct: 315 LFRDSCYNYDGN 326

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%)

Query: 522 QRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLV 581
           QR+ I   T+  G  +T  + ++   L+   P   K + A+K+  ++ IV P+W+ EC  
Sbjct: 360 QRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLIIVGPNWLEECYK 419

Query: 582 NWKKVDEKPY 591
             KK+D K +
Sbjct: 420 ANKKLDPKLF 429

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 290
           YV  RPG+ EF ++V  L+E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 290
           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP G +
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 7/94 (7%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE----N 301
           YV  RPG+  F    + LFE+ I+T +   Y   +  I+D T +L   R+  RD     N
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 302 GSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPN 335
           G+   K+LA+L     S ++++D+    + + PN
Sbjct: 276 GNY-IKNLAQL-GRPLSDIIILDNSPTSYLFHPN 307

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 72/164 (43%), Gaps = 10/164 (6%)

Query: 479 YDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           + M S Q    P+   ++  L+ K+F     + S    LG   QR  I       G  ST
Sbjct: 316 FFMWSMQEFISPSSKLLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGAST 373

Query: 539 PDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVD-------EKPY 591
            ++    TH+++  P   K + A +++   K+V+  W+ EC    KK+D       E P 
Sbjct: 374 TELSKKNTHVLSCMPYGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLDTDTTRYREIPV 433

Query: 592 TLIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLN 635
              + + +    L++++    K QE  EE ++   +  +QEN +
Sbjct: 434 RGGLKNVLGQLSLEDYEENTGK-QELHEEKEQLSTITDTQENFD 476

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 504 FQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTHLIT---KNPSTYKARL 560
           FQ C   +S  +     I  S+++   ++ G T T  I+  TTHLI     +P+    + 
Sbjct: 136 FQICISTYS--MKFSEYIFYSELI---NSLGGTITHVINNKTTHLIAIAIDDPAIIAIKE 190

Query: 561 AKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVD 596
             + N  IK V+P W+ +C    K +DE P+ +  D
Sbjct: 191 KGQNNTIIKSVYPTWLVQCFKERKYIDESPHLITED 226

 Score = 38.1 bits (87), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 478 YYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATS 537
           ++ M S      PN   +    K+K+F++   + +     G   QRS I   T   G  S
Sbjct: 331 FFHMWSICEFVPPNTNLLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGIS 388

Query: 538 TPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWI 576
           T ++    THL+++ P   K   AKK+  + ++++  W+
Sbjct: 389 TTELSKRNTHLVSRMPVGKKFFQAKKWKDRCQVINHLWL 427

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 9/91 (9%)

Query: 517 LGTDIQRSDIVIWTS---TFGATSTPDIDYLTTHLITKNP--STYKARLAKKFNPQIKIV 571
           L    + S+ +++T    + G T   +I+  TTH+IT NP  S ++  L +     IK +
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEI-LKRNGTTSIKYI 191

Query: 572 HPDWIFECLVNWKKVDEKPYTLIVDSPISDE 602
           +P W+  C+   + +DE  + ++   P +D+
Sbjct: 192 YPTWLIHCVKESQLIDESEHEIV---PFTDD 219

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           YV  RPG+ EF  KV  LFE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 6/97 (6%)

Query: 501 QKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARL 560
           ++VF+ C    +G      +  R +IV+    F    T   D   TH++ +N S  K   
Sbjct: 88  RRVFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKKSD--VTHIVAQNLSAAKCIE 145

Query: 561 AKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDS 597
            + F    K+V P WI  C+   K +  + Y++IV S
Sbjct: 146 FRNF----KVVQPGWIGACVRIGKMLSWREYSVIVRS 178

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 290
           YV  RPG+ EF  +V+ ++E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 38.1 bits (87), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 52/115 (45%), Gaps = 35/115 (30%)

Query: 171 RDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMND 230
           +DKK  L++DLD+T++H                 +F+ LR         + VLP+   + 
Sbjct: 243 KDKKC-LILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQ 278

Query: 231 DGSMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
             ++           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 279 VHNV-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 37.7 bits (86), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 217 LDEELVLPLMYMNDDGSMLRPPPV--RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATR 274
           LDE LV       D    + P  +  +    YV  RPG+ EF  +V  +FE+ ++T +  
Sbjct: 314 LDETLVHSSFKYIDTADFVLPVTIDDQTHQVYVIKRPGVDEFLKRVGKIFEVVVFTASVS 373

Query: 275 AYALQIAKIVDPTGEL 290
            Y   +  I+D +  +
Sbjct: 374 RYGDPLLDILDSSKSI 389

>CAGL0I01958g Chr9 (162266..165565) [3300 bp, 1099 aa] {ON} weakly
           similar to uniprot|P38850 Saccharomyces cerevisiae
           YHR154w ESC4 Establishes Silent Chromatin
          Length = 1099

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 75/169 (44%), Gaps = 25/169 (14%)

Query: 488 PEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTH 547
           P+ N +  +P  ++K+F+      +     G   QR+ +       G ++T ++    TH
Sbjct: 356 PDTNAI-CLPRRRRKLFRKQDLAVTYTNYFGE--QRTYLQQLIELLGGSATMELSKQNTH 412

Query: 548 LITKNPSTYKARLAKKF---NPQIKIVHPDWIFECLVNWKKV-----------DEKPYTL 593
           LI   P   K  +A K+     +I I    W+ EC ++ KKV           D+  Y+L
Sbjct: 413 LICNLPFGKKYEVAMKWKESGSKIVICSHRWLEECYISGKKVPVDEAYTRLERDDNTYSL 472

Query: 594 IVDSPIS----DEELQNFQTQLQKRQ----EYLEETQEQQHMLTSQENL 634
            +   +S     E   + +T +++ Q    EYL+ +Q + H LT  +++
Sbjct: 473 TLGQQLSPKLDSENSSDEETDIEESQVFALEYLKTSQSRAHDLTGLDDI 521

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 35/123 (28%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  L++DLD+T++H                 +F+ LR         + VLP+   +   +
Sbjct: 245 KKCLILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQVHN 281

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 293
           +           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D T ++   
Sbjct: 282 V-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TNKVIHH 329

Query: 294 RIL 296
           R+ 
Sbjct: 330 RLF 332

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 50/123 (40%), Gaps = 33/123 (26%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  L++DLD+T++H              NNP+F               +LP+    +DG 
Sbjct: 312 KKCLILDLDETLVHSSFKFI--------NNPDF---------------ILPIEI--EDGQ 346

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 293
           +           YV  RPG+  F  +V   +E+ I+T +   YA  +  ++D    L   
Sbjct: 347 IHN--------VYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINH 398

Query: 294 RIL 296
           R+ 
Sbjct: 399 RLF 401

>YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}
           RTT107Protein implicated in Mms22-dependent DNA repair
           during S phase; involved in recruiting the SMC5/6
           complex to double-strand breaks; DNA damage induces
           phosphorylation by Mec1p at one or more SQ/TQ motifs;
           interacts with Mms22p and Slx4p; has four BRCT domains;
           has a role in regulation of Ty1 transposition
          Length = 1070

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 522 QRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKF--NPQIKIVHPD--WIF 577
           QR  I       G  STP++    THLITK+    K ++AKK+  +PQ  I+  +  W+ 
Sbjct: 391 QRFYIQRLVEILGGLSTPELTRKNTHLITKSTIGKKFKVAKKWSLDPQNAIIVTNHMWLE 450

Query: 578 ECLVNWKKVDEKPYTLIVDSPISDEELQNFQ 608
           +C +N  K++ K           D   QNF+
Sbjct: 451 QCYMNNSKLNPK-----------DSRFQNFK 470

>Skud_8.218 Chr8 (374359..377589) [3231 bp, 1076 aa] {ON} YHR154W
           (REAL)
          Length = 1076

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 60/145 (41%), Gaps = 23/145 (15%)

Query: 471 LSNIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDI---QRSDIV 527
           + N+   +Y    QQ  P          L  + F    F F  L    T+    QR  I 
Sbjct: 342 VGNVSWLFYMFAIQQFAPVSQC-----KLIHQPFHAKLFTFKELTVAYTNYFGSQRFYIQ 396

Query: 528 IWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKF--NPQIKIVHPD--WIFECLVNW 583
                 G  STP++    THLITKN    K ++AKK+  +PQ  I+  +  W+ +C +  
Sbjct: 397 RLVEILGGLSTPELTRKNTHLITKNTIGKKFKVAKKWSLDPQNAIIVTNHMWLEQCYMKN 456

Query: 584 KKVDEKPYTLIVDSPISDEELQNFQ 608
            K++ +           D + QNF+
Sbjct: 457 AKLNPR-----------DSKFQNFK 470

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  L++DLD+T++H                 +F+ LR         + VLP+   +   +
Sbjct: 244 KKCLILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQVHN 280

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           +           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 281 V-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP 286
           YV  RPG+ EF   V  L+E+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP 286
           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP 293

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 290
           YV  RPG+ EF  +VA L+E+ ++T +   Y   +  I+D +  +
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 47/112 (41%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  LV+DLD+T++H                  F+ LR         + VLP+   N D  
Sbjct: 240 KKCLVLDLDETLVHSS----------------FKYLRTA-------DFVLPV---NIDDQ 273

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           +           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 274 VHN--------VYVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILD 317

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  L++DLD+T++H                 +F+ LR    F L  E+        DD  
Sbjct: 257 KKCLILDLDETLVHS----------------SFKYLRSA-DFVLSVEI--------DD-- 289

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
                  +    YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 290 -------QVHNVYVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 334

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%)

Query: 545 TTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599
           TTH I  +     A L +  N  I IV P+WI  C V  + V  + + L  D  I
Sbjct: 212 TTHFICNDEEEEDAELIRAKNSNIPIVRPEWIRACAVEKRIVGVRGFYLDADKSI 266

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 479 YDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           ++M S  +   P+   I   LKQ V ++   + S     G  +QRS I   T   G  ST
Sbjct: 324 FNMWSLDSFTLPSSKIIWGPLKQSVVRSDELILSFTNYFG--LQRSYIQRITERLGGVST 381

Query: 539 PDIDYLTTHLITKNPSTYKARLAKKFNPQ-IKIVHPDWIFEC 579
             +    THL+++     K  LAK++  Q  ++V+  W+ EC
Sbjct: 382 TSLTKRNTHLVSRMAIGKKFELAKQWGGQRCRVVNHLWLEEC 423

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  LV+DLD+T++H                 +F+ LR         + VLP+   +   +
Sbjct: 283 KKCLVLDLDETLVHS----------------SFKYLRTA-------DFVLPVDIDDQIHN 319

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           +           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 320 V-----------YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           YV  RPG+ EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>Suva_15.353 Chr15 (607037..610276) [3240 bp, 1079 aa] {ON} YHR154W
           (REAL)
          Length = 1079

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 15/91 (16%)

Query: 522 QRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKF--NPQIKIVHPD--WIF 577
           QR  I       G  STP++    THLITKN    K ++AKK+  +PQ  I+  +  W+ 
Sbjct: 391 QRFYIQRLVEILGGFSTPELTRKNTHLITKNTIGKKFKVAKKWSLDPQSAIIVTNHMWLE 450

Query: 578 ECLVNWKKVDEKPYTLIVDSPISDEELQNFQ 608
            C +   K++ K           D   QNF+
Sbjct: 451 LCYLTNSKLNPK-----------DSRFQNFK 470

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 290
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D +  +
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 54/132 (40%), Gaps = 38/132 (28%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  LV+DLD+T++H                 +F+ LR         + V+P+   N   +
Sbjct: 240 KKCLVLDLDETLVHS----------------SFKFLRTA-------DFVIPVEIDNQIHN 276

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPT----GE 289
           +           YV  RPG+ EF   V  L+E+ ++T +   Y   +  ++D T      
Sbjct: 277 V-----------YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHR 325

Query: 290 LFGDRILSRDEN 301
           LF D   + D N
Sbjct: 326 LFRDSCYNYDGN 337

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 545 TTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDS 597
           TTH +  +  +    LA+  N  I +V P+WI  C +  + V  + + L VDS
Sbjct: 211 TTHFVCNDAQSDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVDS 263

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSRDENGSL 304
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 290
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  ++D +  +
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKSNNI 359

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 48/113 (42%), Gaps = 34/113 (30%)

Query: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232
           +K  LV+DLD+T++H                  F+ L+         + VLP+   +   
Sbjct: 312 RKKCLVLDLDETLVHSS----------------FKYLKSA-------DFVLPVDIDDQIH 348

Query: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           ++           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  ++D
Sbjct: 349 NV-----------YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLD 390

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 34/112 (30%)

Query: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233
           K  LV+DLD+T++H                 +F+ LR         + V+P+   N   +
Sbjct: 244 KKCLVLDLDETLVHS----------------SFKYLRTA-------DFVIPVEIDNQVHN 280

Query: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           +           YV  RPG+ EF  ++  L+E+ ++T +   Y   +  I+D
Sbjct: 281 V-----------YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILD 321

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSRDENGSL 304
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 280 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 318

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILD 388

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 246 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 285
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 12/94 (12%)

Query: 522 QRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLV 581
           QR  I    +  G  STP +    THLI   P   K   A+    +I +V+  W+ +C++
Sbjct: 363 QRHYIKNLVTALGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVL 422

Query: 582 NWKKVD----EKPYT--------LIVDSPISDEE 603
              +V     EKP T         I  +PI DE+
Sbjct: 423 LKSRVPENLFEKPITSNCFNDSSFIEHAPIQDED 456

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 16/97 (16%)

Query: 500 KQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLT-----THLITKNPS 554
           +  +F+ C    +G      +  R +IV+   TF       + YL      TH++ ++  
Sbjct: 40  RTPIFRGCRVHVNGHTDPDREELRREIVMHGGTF-------VHYLARPSDVTHIVAEHVP 92

Query: 555 TYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPY 591
             K RL        K+V P W+  CL + + V  KPY
Sbjct: 93  VAKRRLWHA----CKVVRPAWVSACLCSGELVPWKPY 125

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 244 WYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSR 298
           W   K RPG+  F   ++  +E+ +++     YA +IA+ +DP     T  LF +  L +
Sbjct: 216 WRTAK-RPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYK 274

Query: 299 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
           D    +  K L+KL   D   V++ID   + +   P N I + P++
Sbjct: 275 D---GVHIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {ON}
           Anc_5.94 YHR154W
          Length = 900

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 16/127 (12%)

Query: 479 YDMLSQQNEPEPNLMEIIP--SLKQKV----------FQNCYFVFSGLIPLGTDI---QR 523
           ++++SQ N  + NL+ +    S+ Q +          FQ   F  + L P  T+    QR
Sbjct: 306 FEIISQTNAHKGNLIWMFHMWSMSQFIEPKENIIFEPFQPVIFKRNELRPAYTNYFGRQR 365

Query: 524 SDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFN-PQIKIVHPDWIFECLVN 582
           S I       G  ST +     THLI+++    K + A K+    + +V+  W+ EC   
Sbjct: 366 SYIQRLVELLGGVSTTEFSKRNTHLISRSNVGKKFKTAMKWGESSVIVVNHLWLEECYKL 425

Query: 583 WKKVDEK 589
            KK+D K
Sbjct: 426 NKKLDPK 432

>KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {ON}
           some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 913

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 47/114 (41%), Gaps = 5/114 (4%)

Query: 479 YDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           + M S Q+   P    ++  L+  VF     + S    LG   QR  I       G  ST
Sbjct: 316 FHMWSLQSFVLPQFKLLLSPLRPPVFNKGQLILSYTNYLGQ--QRYYIQKLVEALGGVST 373

Query: 539 PDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYT 592
            ++    THL+T  P   K   A ++    KI +  W+ +C   ++K  + P+ 
Sbjct: 374 TELTKKNTHLLTCLPLGQKYEAALRWEGTCKIANHLWLEDC---YRKQTQVPFV 424

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSRDENGSL 304
           RPG   F   ++  +E+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 46/109 (42%), Gaps = 3/109 (2%)

Query: 479 YDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 538
           + MLS Q    P    ++     K+F     V +    LG   QR  I       G +ST
Sbjct: 313 FYMLSMQQFIAPTAKLVLSPRYPKLFTEKELVLAFTNYLGQ--QRYYIQRLVDLLGGSST 370

Query: 539 PDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVD 587
            ++    THLI+  P   K   A K+N  I + H  W+ +C    KK+D
Sbjct: 371 TELSRKNTHLISLFPHGKKHETALKWNSCIVVNHL-WLEQCYKLRKKLD 418

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 530 TSTFGATSTPDIDYLTT---HLITKNPSTYKARLAKKFNPQIKI-VHPDWIFECLVNWKK 585
            S FG T    +DYL+T   H+IT + +    +  +KF+    I + P+W+ +CL   + 
Sbjct: 146 VSVFGGTC---MDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEY 202

Query: 586 VDEKPYTLIVD 596
           + E  Y + V+
Sbjct: 203 IKEDEYLINVN 213

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSRDENGSL 304
           RPG + F   ++  +E+ +++     Y+ + A+ +DP     +  LF +  + +D    +
Sbjct: 221 RPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHCVYKD---GV 277

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 278 HIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 521 IQRSDIVIWTSTFGATSTPD-IDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFEC 579
           + ++ I    S  GA +  D +   TTH I     +    L K  N  I +V P+W+  C
Sbjct: 186 VTKNQIETSLSNIGAKALQDHVGLDTTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRAC 245

Query: 580 LVNWKKVDEKPYTLIVD 596
            +  + V  + + L  D
Sbjct: 246 ELERRIVGVRGFYLDAD 262

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSRDENGSL 304
           RPG+  F   ++  +E+ +++     Y  +IA+ +DP     +  LF +  + +D    +
Sbjct: 229 RPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYNLFKEHCVYKD---GV 285

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D + V++ID   + +   P N I V P++
Sbjct: 286 HIKDLSKL-NRDVNKVLIIDTEPNNYKLQPENAIPVKPWD 324

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 250 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSRDENGSL 304
           RPG   F   ++  +E+ +++     YA +IA+ +DP     +  LF +  + +D    +
Sbjct: 224 RPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFISYNLFKEHCVYKD---GV 280

Query: 305 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 343
             K L+KL   D   V++ID   + +   P N I + P++
Sbjct: 281 HIKDLSKL-NRDLKKVMIIDTDENSYKLQPENAIPMDPWD 319

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,525,149
Number of extensions: 3593096
Number of successful extensions: 22593
Number of sequences better than 10.0: 250
Number of HSP's gapped: 23037
Number of HSP's successfully gapped: 274
Length of query: 732
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 615
Effective length of database: 40,065,477
Effective search space: 24640268355
Effective search space used: 24640268355
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)