Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR276W (DSK2)8.837ON37337314900.0
Smik_13.4898.837ON37237614310.0
Skud_13.4488.837ON36437614030.0
Suva_13.4648.837ON36637813220.0
NCAS0C004308.837ON36939010511e-142
KAFR0B039008.837ON37938110341e-139
CAGL0M02937g8.837ON37338010271e-138
SAKL0D01540g8.837ON3653819881e-132
Kpol_1068.118.837ON3813919821e-131
TDEL0B006008.837ON3693789691e-129
Kwal_27.102758.837ON3793979261e-123
KLLA0D01859g8.837ON3713809001e-119
KLTH0C03938g8.837ON3763947693e-99
ZYRO0G14124g8.837ON3692357492e-96
KNAG0J002908.837ON3674007292e-93
TPHA0I002208.837ON3772247206e-92
TBLA0D032308.837ON3752217041e-89
NDAI0K004408.837ON4042207043e-89
ABL129W8.837ON3452126593e-83
Ecym_46088.837ON4062276428e-80
TBLA0B032408.837ON2842191549e-11
Kpol_1036.628.311ON77561182e-07
KLLA0F17974g8.311ON77711182e-07
SAKL0H15818g8.311ON77731172e-07
CAGL0B01589g8.311ON77561172e-07
KLTH0G12540g8.311ON77711154e-07
TPHA0C008908.311ON77561136e-07
NCAS0B035208.311ON77561111e-06
NDAI0J010708.311ON77561102e-06
ZYRO0D05962g8.311ON77561102e-06
TDEL0F043808.311ON77561075e-06
TDEL0G017504.16ON77561059e-06
NDAI0H002704.16ON77561041e-05
Smik_9.215.701ON124561072e-05
YDR139C (RUB1)8.311ON77561032e-05
Suva_10.32singletonON6256994e-05
NDAI0G003301.480ON427661105e-05
KAFR0E005301.480ON379751095e-05
KLTH0E01078g5.701ON128561026e-05
Kwal_YGOB_Anc_5.7015.701ON128561026e-05
Skud_9.205.701ON125561026e-05
Smik_11.3575.701ON125561026e-05
ZYRO0G06622g5.701ON128561027e-05
KAFR0D022305.701ON128561027e-05
KAFR0H002205.701ON128561027e-05
Suva_11.3305.701ON128561027e-05
Skud_11.3335.701ON128561027e-05
YIL148W (RPL40A)5.701ON128561027e-05
YKR094C (RPL40B)5.701ON128561027e-05
SAKL0E14894g5.701ON128561027e-05
KLLA0A00616g5.701ON128561027e-05
TPHA0E002405.701ON128561027e-05
TPHA0D046005.701ON128561027e-05
TBLA0E021105.701ON128561027e-05
CAGL0G02475g5.701ON128561027e-05
Kpol_1043.695.701ON128561027e-05
AFR358W1.480ON413791087e-05
TDEL0B022005.701ON128561028e-05
NDAI0E050305.701ON128561028e-05
NCAS0A032105.701ON128561028e-05
NCAS0G002405.701ON128561028e-05
Ecym_40195.701ON128561019e-05
AFR285C5.701ON128561019e-05
KNAG0L021205.701ON128561019e-05
NDAI0F003005.701ON187771049e-05
Suva_9.405.701ON144561011e-04
TPHA0K022504.16ON153561011e-04
Ecym_84084.16ON153561011e-04
KNAG0J028804.16ON153561011e-04
YEL037C (RAD23)1.480ON398661061e-04
Suva_10.34singletonON151561011e-04
KNAG0C065805.701ON14956992e-04
Suva_5.321.480ON409661042e-04
Skud_5.531.480ON397661042e-04
Ecym_41818.386ON15256993e-04
TBLA0G006704.16ON229561013e-04
NDAI0D049304.16ON229561013e-04
KAFR0I014704.16ON229561013e-04
ZYRO0C04026g8.386ON15256983e-04
Kwal_55.206074.16ON231561013e-04
KAFR0I027801.480ON214801013e-04
CAGL0L01309g1.480ON392661033e-04
TPHA0C023908.386ON15056983e-04
KLTH0E05852g4.16ON409561033e-04
AGL128W8.386ON15256983e-04
KLTH0F08734g8.386ON15056983e-04
Suva_10.33singletonON254561013e-04
Kwal_23.33118.386ON15056984e-04
Smik_5.561.480ON397661024e-04
SAKL0D11814g1.480ON400661024e-04
SAKL0H13926g8.386ON15456984e-04
SAKL0H25784g4.16ON305561014e-04
NDAI0G022808.386ON15256974e-04
KLLA0D18304g8.386ON15056974e-04
KAFR0H020008.386ON15256975e-04
YLR167W (RPS31)8.386ON15256975e-04
NCAS0C029408.386ON15256975e-04
Suva_10.304.16ON381561015e-04
Skud_12.294.16ON381561015e-04
YLL039C (UBI4)4.16ON381561015e-04
CAGL0G08173g8.386ON15256975e-04
ACL062C4.16ON382561015e-04
Kpol_1030.58.386ON15256966e-04
Kpol_1024.168.386ON15256966e-04
TDEL0F051008.386ON15056966e-04
KNAG0A027308.386ON15056966e-04
KLLA0E00749g4.16ON381561016e-04
Kpol_1070.64.16ON533561016e-04
NCAS0C058504.16ON388561016e-04
ZYRO0G07854g4.16ON460561016e-04
CAGL0D05082g4.16ON533561016e-04
Smik_12.184.16ON460561017e-04
Suva_10.2668.386ON15256959e-04
Skud_12.2348.386ON15256959e-04
Smik_12.2298.386ON15256959e-04
TBLA0H031808.386ON15256950.001
KLLA0E22133g1.480ON38368960.002
KAFR0C030008.142ON39740960.002
Ecym_35721.480ON44377960.002
AGL185W8.311ON5049840.003
Kwal_27.101521.480ON38147940.004
KLTH0C03410g1.480ON39147930.005
TPHA0O004401.480ON36964910.008
SAKL0H24772g8.142ON41443910.009
NDAI0B01850singletonON40344900.011
Ecym_42448.311ON5034790.016
TBLA0D022108.142ON56338890.016
NCAS0B045908.142ON44742890.019
CAGL0L06028g8.142ON50538880.021
NCAS0G041201.480ON39268860.043
TBLA0H013108.311ON7134760.071
Kpol_370.61.480ON40466830.087
YGL181W (GTS1)8.142ON39638820.12
Smik_7.918.142ON39938810.15
TDEL0B046908.142ON44238810.18
Kwal_56.238838.311ON5249710.20
ZYRO0D08140g6.343ON7358720.23
TBLA0B021601.480ON40467790.26
Ecym_41055.570ON90994790.34
KLLA0C08470g6.343ON7459710.37
Suva_7.818.142ON40138770.50
ZYRO0F05192g1.480ON38472760.56
Skud_4.3988.311ON9479700.69
Suva_2.3008.311ON8638681.2
TDEL0C025901.480ON36858731.3
Smik_4.3838.311ON10080681.8
Smik_15.413.65ON21464684.0
Skud_7.908.142ON39638694.6
KAFR0D042203.418ON101631686.3
Skud_15.413.65ON21464668.4
TPHA0H004008.142ON46638678.8
Kpol_541.508.142ON51138679.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR276W
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   578   0.0  
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   555   0.0  
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   545   0.0  
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   513   0.0  
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   409   e-142
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   402   e-139
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   400   e-138
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   385   e-132
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   382   e-131
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   377   e-129
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   361   e-123
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   351   e-119
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   300   3e-99
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   293   2e-96
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   285   2e-93
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   281   6e-92
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   275   1e-89
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   275   3e-89
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   258   3e-83
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   251   8e-80
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    64   9e-11
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    50   2e-07
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    50   2e-07
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    50   2e-07
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    50   2e-07
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    49   4e-07
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    48   6e-07
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    47   1e-06
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    47   2e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    47   2e-06
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    46   5e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    45   9e-06
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    45   1e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     46   2e-05
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    44   2e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    43   4e-05
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    47   5e-05
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    47   5e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    44   6e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    44   6e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     44   6e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    44   6e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    44   7e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    44   7e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    44   7e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    44   7e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    44   7e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    44   7e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    44   7e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    44   7e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    44   7e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    44   7e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    44   7e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    44   7e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    44   7e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    44   7e-05
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    46   7e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    44   8e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    44   8e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    44   8e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    44   8e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    44   9e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    44   9e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    44   9e-05
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        45   9e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     44   1e-04
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    44   1e-04
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    44   1e-04
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    44   1e-04
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    45   1e-04
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    44   1e-04
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    43   2e-04
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    45   2e-04
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    45   2e-04
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    43   3e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    44   3e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              44   3e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    44   3e-04
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    42   3e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    44   3e-04
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    44   3e-04
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    44   3e-04
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    42   3e-04
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    44   3e-04
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    42   3e-04
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    42   3e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    44   3e-04
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    42   4e-04
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    44   4e-04
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    44   4e-04
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    42   4e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    44   4e-04
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    42   4e-04
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    42   4e-04
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    42   5e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    42   5e-04
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    42   5e-04
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    44   5e-04
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    44   5e-04
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    44   5e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    42   5e-04
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    44   5e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    42   6e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    42   6e-04
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    42   6e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    42   6e-04
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    44   6e-04
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    44   6e-04
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             44   6e-04
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    44   6e-04
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    44   6e-04
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    44   7e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    41   9e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    41   9e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    41   9e-04
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    41   0.001
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    42   0.002
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    42   0.002
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    42   0.002
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    37   0.003
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    41   0.004
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    40   0.005
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    40   0.008
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    40   0.009
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    39   0.011
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    35   0.016
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.016
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    39   0.019
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    39   0.021
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    38   0.043
TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311...    34   0.071
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    37   0.087
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    36   0.12 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    36   0.15 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    36   0.18 
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    32   0.20 
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    32   0.23 
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    35   0.26 
Ecym_4105 Chr4 complement(211323..214052) [2730 bp, 909 aa] {ON}...    35   0.34 
KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly s...    32   0.37 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    34   0.50 
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    34   0.56 
Skud_4.398 Chr4 complement(705294..705386,705390..705431,705435....    32   0.69 
Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261 b...    31   1.2  
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    33   1.3  
Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300 b...    31   1.8  
Smik_15.41 Chr15 complement(76252..76896) [645 bp, 214 aa] {ON} ...    31   4.0  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    31   4.6  
KAFR0D04220 Chr4 complement(830052..833102) [3051 bp, 1016 aa] {...    31   6.3  
Skud_15.41 Chr15 complement(73388..74032) [645 bp, 214 aa] {ON} ...    30   8.4  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    30   8.8  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    30   9.1  

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/373 (80%), Positives = 299/373 (80%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKPQ                      PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXXX 240
           NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPN                 
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSAGGAASAFPAPG 240

Query: 241 XXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNAASTG 300
               EE                               PFASLLNPALNPFANAGNAASTG
Sbjct: 241 GDAPEEGSNTNTTSSSNTGNNAGTNAGTNAGANTAANPFASLLNPALNPFANAGNAASTG 300

Query: 301 MPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGS 360
           MPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGS
Sbjct: 301 MPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGS 360

Query: 361 VQGALDSLLNGDV 373
           VQGALDSLLNGDV
Sbjct: 361 VQGALDSLLNGDV 373

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/376 (76%), Positives = 293/376 (77%), Gaps = 7/376 (1%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MSLNIHIKSGQDKWEV+VAPESTV QFKEAI+KANG+PVANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKPQ                      PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXXX 240
           NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPN                 
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAASAFPAPG 240

Query: 241 XXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNAASTG 300
               EE                               PFASLLNPALNPFA+AGNA  TG
Sbjct: 241 GDAPEE----SANTNTNTNTASSPNAGSNASSSTAANPFASLLNPALNPFASAGNATGTG 296

Query: 301 MPAFDPALLASMFQP---PVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 357
           MPAFDPALLASMFQP     QASQ EDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS
Sbjct: 297 MPAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 356

Query: 358 GGSVQGALDSLLNGDV 373
           GGSVQGALDSLLNGDV
Sbjct: 357 GGSVQGALDSLLNGDV 372

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/376 (75%), Positives = 290/376 (77%), Gaps = 15/376 (3%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MSLNIHIKSGQDKWEV VAPE TVLQFKEAI+KAN IPVANQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKP                       PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXXX 240
           NPQLQAMGPQARQMLQSPMFRQMLTNP+M+RQSMQFARMMDPN                 
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPN----ADNSAASAFPAPG 236

Query: 241 XXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNAASTG 300
               EE                               PFASLLNPALNPFANAGN A TG
Sbjct: 237 GDASEE--------GANTNAVPSSNAGTNGSANAAANPFASLLNPALNPFANAGNTAPTG 288

Query: 301 MPAFDPALLASMFQP---PVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 357
           MPAFDPALLASMFQP     QASQ ED+RPPEERYEHQLRQLNDMGFFDFDRNVAALRRS
Sbjct: 289 MPAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 348

Query: 358 GGSVQGALDSLLNGDV 373
           GGSVQGALDSLLNGDV
Sbjct: 349 GGSVQGALDSLLNGDV 364

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/378 (74%), Positives = 291/378 (76%), Gaps = 17/378 (4%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MSLN+++KSGQDKWEV+VAPESTVLQFKEAI++ANGIPVANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXX-XXXXXXPNMSSGQSAGFNPLADLTS 119
           HIQDGHSVHLVKSQP+PQ                       PNMSSGQSAGFNPLADLTS
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTS 120

Query: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179
           ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMM+NPIFQSQMNEMLSNPQMLDFMIQ
Sbjct: 121 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQ 180

Query: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXX 239
           SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPN                
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSAGGAASAFPAP 240

Query: 240 XXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPFANAGN-AAS 298
                EE                                 ASLLNPALNPFANAGN AA+
Sbjct: 241 GGDAPEETTDTDAAPSSNAGANAAANPF------------ASLLNPALNPFANAGNSAAA 288

Query: 299 TGMPAFDPALLASMF---QPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALR 355
           TGMPAFDPALLASMF   Q   QA Q EDTRPPEERYE QLRQLNDMGFFDFDRNVAALR
Sbjct: 289 TGMPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALR 348

Query: 356 RSGGSVQGALDSLLNGDV 373
           RSGGSVQGALDSLLNGDV
Sbjct: 349 RSGGSVQGALDSLLNGDV 366

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  409 bits (1051), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 224/390 (57%), Positives = 257/390 (65%), Gaps = 38/390 (9%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS++IH+KSGQ+ W+V++ P ST+LQ KE I K + +P  NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  HIQDGHSVHLVKS---------QPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGF 111
            I DG S+H+VKS          P PQ                      PNM++G++ GF
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVA-------------PNMAAGETGGF 107

Query: 112 NPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNP 171
           NPL+DLTSARYAGYLN+PSAD FGPDGG LNN   NQDE+LRM++NP+FQSQMNEMLSNP
Sbjct: 108 NPLSDLTSARYAGYLNLPSADTFGPDGG-LNNSGPNQDEMLRMLDNPVFQSQMNEMLSNP 166

Query: 172 QMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNXXXX 227
           QMLDF+IQ+NPQLQAMGPQARQ+LQ+PMFRQMLTNPDMIRQSMQ AR M    DPN    
Sbjct: 167 QMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQ 226

Query: 228 XXXXXXXXXXXXXXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPAL 287
                                                             PFASL NPA+
Sbjct: 227 ANTSSDFPAPGG-------DDDNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAM 279

Query: 288 NPF----ANAGNAASTGMPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMG 343
           NPF    AN   A S   PAFDP+  ASMFQPP    Q EDTRPPEERYEHQLRQLNDMG
Sbjct: 280 NPFAAGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMG 339

Query: 344 FFDFDRNVAALRRSGGSVQGALDSLLNGDV 373
           FFDFDRNVAALRRSGG+V+ AL++LLNGDV
Sbjct: 340 FFDFDRNVAALRRSGGNVESALNALLNGDV 369

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  402 bits (1034), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/381 (57%), Positives = 246/381 (64%), Gaps = 10/381 (2%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS+ IHIKSGQ+KW+VN     ++   KE I+K + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQ---PKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADL 117
            I++GHS+HLVKS     +                         N++SGQ+ GFNPL DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 118 TSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFM 177
           TSARYAGYLNMPSADMFGPDGG   N   +QD++LRM++NP+FQSQMNEMLSNPQM+DFM
Sbjct: 121 TSARYAGYLNMPSADMFGPDGGL--NSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFM 178

Query: 178 IQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXX 237
           IQSNPQLQAMGPQARQMLQSPMFRQML NPDMIRQSMQFARMM+                
Sbjct: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFP 238

Query: 238 XXXXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPF---ANAG 294
                                                   PF +L NPA NPF   ++  
Sbjct: 239 APGEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFGAMSSNT 298

Query: 295 NAASTGMPAFDPALLASMFQPP--VQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVA 352
           N +    PAFDPALLASM   P   Q    +D RPPEERYE QLRQLNDMGFFDFDRNVA
Sbjct: 299 NGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVA 358

Query: 353 ALRRSGGSVQGALDSLLNGDV 373
           ALRRSGGSVQGALD+LLNGDV
Sbjct: 359 ALRRSGGSVQGALDALLNGDV 379

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  400 bits (1027), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 246/380 (64%), Gaps = 14/380 (3%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS+ IHIKSGQ+KW+V++ P  T+L  KE I K + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           +I+D H++H+VKS                            N++SGQ+ GFNPLADLT A
Sbjct: 61  NIKDDHAIHMVKS--GGNASTSNAPTNANESSNSSTTAVPSNIASGQTGGFNPLADLTGA 118

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PSADMFGPDGG   N++ +QDE+LRMMENPIFQSQMNEMLSNP+MLDFMIQS
Sbjct: 119 RYAGYANLPSADMFGPDGGI--NNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQS 176

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXXX 240
           NPQLQAMGPQARQMLQSP FRQMLTNP MIRQSMQFARMM+                   
Sbjct: 177 NPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATDASAFPAP 236

Query: 241 XXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPFA-------NA 293
                E                                 A+L++PA NPFA       N 
Sbjct: 237 GGDDTETTTGSTENTSTNNRTNSNANANPNAAANPF---AALMDPASNPFAAMMGNMNNQ 293

Query: 294 GNAASTGMPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAA 353
              A    PAFDP LLAS+    + A   ED RPPEERYE QLRQLNDMGFFDFDRNVAA
Sbjct: 294 QGGAGVQQPAFDPTLLASLLGGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVAA 353

Query: 354 LRRSGGSVQGALDSLLNGDV 373
           LRRSGGSVQGALD+LLNGDV
Sbjct: 354 LRRSGGSVQGALDALLNGDV 373

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 245/381 (64%), Gaps = 24/381 (6%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+V++ P +TV++ KEAI+K + IP ANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQ-PKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTS 119
            I D H+VHLV+S  PKP                        N+SSGQ+ GFNPLADLT 
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPS-NISSGQTGGFNPLADLTG 119

Query: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179
           ARYAGY N+PSADMFGPDGG  N  + N DE+L M++NPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 120 ARYAGYANLPSADMFGPDGGLTN--APNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177

Query: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXX 239
            NPQLQAMGP+AR++LQS  FRQM+TNPDMIRQSMQFARM                    
Sbjct: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEGAEGAGGAFPAPGTAT 237

Query: 240 XXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPFANA---GNA 296
                E                                PFASL N   NPFA+    G A
Sbjct: 238 QTASTE--------GGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRA 289

Query: 297 ASTGMPAFDPALLASMF----QPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVA 352
                P FDP+LL+S        P Q  Q +D RPPEERYE QLRQLNDMGFFDFDRNVA
Sbjct: 290 -----PQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVA 344

Query: 353 ALRRSGGSVQGALDSLLNGDV 373
           ALRRSGGSVQGALD+LLNGDV
Sbjct: 345 ALRRSGGSVQGALDALLNGDV 365

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  382 bits (982), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/391 (57%), Positives = 249/391 (63%), Gaps = 28/391 (7%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           M + IHIKSGQ+KWEV V   +TVLQ KE I K + IPV NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXP---NMSSGQSAGFNPLADL 117
            IQD HS+HLVKS    +                      P   N+++GQS GFNPL+DL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           TSARYAGY LN+PSADMFGPDGG   N   NQD++LRM+ENP+FQSQMNEMLSNPQM+DF
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGM--NSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDF 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXX 236
           MIQSNPQLQAMGP+ARQM QSP FRQMLTNP+MIRQSMQ A MM  N             
Sbjct: 179 MIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAASSFP 238

Query: 237 XXXXXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPF------ 290
                                                    PFASL NPA+NPF      
Sbjct: 239 A--------PGETDTTAAAETNTETTSTPAATGAAAAGQQNPFASLFNPAMNPFAAMMNN 290

Query: 291 --------ANAGNAASTGMPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDM 342
                      G A +TG PAFDP+L ASMFQPP Q  Q +D RPPEERYE QLRQLNDM
Sbjct: 291 NAAAAAGAGATGAAGATGTPAFDPSLFASMFQPPQQQQQEQDNRPPEERYESQLRQLNDM 350

Query: 343 GFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373
           GFFDFDRNVAALRRSGGSVQGALD+LL+ DV
Sbjct: 351 GFFDFDRNVAALRRSGGSVQGALDALLSNDV 381

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  377 bits (969), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 238/378 (62%), Gaps = 14/378 (3%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS+ + +K GQ KWEV+V PE TV +FK+ I K + IP ANQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXX--XXXXXPNMSSGQSAGFNPLADLT 118
            IQDGH++HLVKS                              N++SGQ+ GFNPL+DLT
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 119 SARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMI 178
           SARYAG+ N+PSADMFGPDGG  N    NQD++L M+ENPIFQSQMNEMLSNPQM+DFMI
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNMP--NQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178

Query: 179 QSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXX 238
           QSNPQLQAMGPQARQ+LQSP FRQMLTNP M+RQSMQF+ MM+P+               
Sbjct: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGD 238

Query: 239 XXXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNAAS 298
                                                  P AS+       F N G  A+
Sbjct: 239 STTEASSTEANTDANANTNANANTNAANPFAAMFNPGSNPLASM-------FGNQGVGAA 291

Query: 299 TGM--PAFDPALLASMFQPPVQASQAE-DTRPPEERYEHQLRQLNDMGFFDFDRNVAALR 355
                  FDP++LAS+        +AE D RPPEERYE QLRQLNDMGFFDF++NVAALR
Sbjct: 292 DNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALR 351

Query: 356 RSGGSVQGALDSLLNGDV 373
           RSGGSVQGALDSLLNGDV
Sbjct: 352 RSGGSVQGALDSLLNGDV 369

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  361 bits (926), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/397 (51%), Positives = 246/397 (61%), Gaps = 42/397 (10%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS+ +H+KSGQ KW+V+V  +STV QFK AI + + I   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXX----XXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLAD 116
            I DGH+VHLVKS  K                             ++SSGQ+ GFNPL+D
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 117 LTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           LTSARYAGYLN+PSAD FGPDGG  +  + N D++LRM+ENP+ QSQMNEMLSNPQM+DF
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTS--APNSDDMLRMLENPVMQSQMNEMLSNPQMIDF 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNXXXXXXXXX 232
           +IQ +PQLQ+MGPQARQMLQSP FRQM+TNP+MIRQSMQF+ ++    DP+         
Sbjct: 179 LIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAF-- 236

Query: 233 XXXXXXXXXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLL--------- 283
                                                        PFASLL         
Sbjct: 237 -------------PAPGTADSDASAQPASTNTSTADAAQSATNANPFASLLAGQAAAPGG 283

Query: 284 -----NPALNPFANAGNAASTGMPAFDPALLASMFQPPVQ--ASQAEDTRPPEERYEHQL 336
                NP L+        A  G+PAFDPA+L+++        + Q +DTRPPEERYE QL
Sbjct: 284 ASAPANPFLSMLGQQAPGAG-GLPAFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQL 342

Query: 337 RQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373
           RQLNDMGFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 343 RQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  351 bits (900), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 230/380 (60%), Gaps = 21/380 (5%)

Query: 3   LNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHI 62
           +++H+KSGQ+ W V +   +T+  FKE I+  +G+P  NQRLIYSGKILKD +TVESY I
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  QDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSARY 122
           QDGHSVH+VKS                            N+S+GQ+ GFNPLADLT ARY
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTGARY 123

Query: 123 AGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSNP 182
           AG  N+PSADMFGPDGG  +++  N + +L+M+ENPIFQSQMNEMLSNPQM+DF+IQ NP
Sbjct: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183

Query: 183 QLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXXXXXXXXXXXXXX 242
           QLQA+GP+AR MLQSP FRQM+T+P MIRQSMQ A  M  +                   
Sbjct: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSPDGAASAFPAPGSASGAGG 243

Query: 243 XXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLN------PALNPFANAGNA 296
             E                                PFA L         A NPF  AG  
Sbjct: 244 ANE----------TSTNDADSAATGAAASSTGQANPFAGLFGATPGNAAAANPF--AGLF 291

Query: 297 ASTGMPAFDPALLASMF---QPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAA 353
                P F+  LLASMF        A+ A D RPPEERYE QLRQLNDMGFFDFDRNVAA
Sbjct: 292 PGGQQPQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAA 351

Query: 354 LRRSGGSVQGALDSLLNGDV 373
           LRR+GGSVQGALD+LLNGDV
Sbjct: 352 LRRAGGSVQGALDALLNGDV 371

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  300 bits (769), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 184/394 (46%), Positives = 216/394 (54%), Gaps = 39/394 (9%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+V + P ST+ QFK AI   + I   NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXP----------NMSSGQSAG 110
            I D HSVHLVKS    +                      P          N+S+GQ  G
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 111 FNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSN 170
           FNPL+DLTSARYAG+LN+PSAD FGPDGG  +  + N D++LRM+ENP+ QSQMNEMLSN
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTS--APNSDDVLRMLENPVMQSQMNEMLSN 178

Query: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNXXXXXXX 230
           PQM+DF+IQ                QSP  + M      + QS  F +MM          
Sbjct: 179 PQMIDFLIQ----------------QSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSM 222

Query: 231 XXXXXXXXXXXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFASLLN------ 284
                                                          PFASLL       
Sbjct: 223 QFSSMLGGDSAAGGGSSFPAPGTPAEADAPSQPAANPSAAPSAGTANPFASLLGGQAGAS 282

Query: 285 ---PALNPFANAGNAASTGMP-AFDPALLASMFQPPVQASQA-EDTRPPEERYEHQLRQL 339
              PA NPF +     S G P A DP +L+S+      A+Q  +DTRPPEERYEHQLRQL
Sbjct: 283 GASPAANPFLSMLGGGSAGTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQL 342

Query: 340 NDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373
           NDMGFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 343 NDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  293 bits (749), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 150/235 (63%), Positives = 173/235 (73%), Gaps = 16/235 (6%)

Query: 2   SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYH 61
           ++ + IKSGQ+KWEV V PESTV  FKE I+K + IP ++QRLIYSGKILKDDQT++ Y+
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXP--------------NMSSGQ 107
           +QDGHSVHLVKS   P                       P              N+S+GQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 108 SAGFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEM 167
           S GFNPLADLTSARYAG+ ++PSADMFGPDGGA N    NQ++LL M++NPIFQSQMNEM
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMP--NQEDLLNMLDNPIFQSQMNEM 180

Query: 168 LSNPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDP 222
           LSNPQM+DFMIQSNPQLQAMGPQARQM QSP FRQMLTNP MIRQSMQFARMM+P
Sbjct: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNP 235

 Score =  117 bits (294), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 57/69 (82%), Positives = 59/69 (85%)

Query: 305 DPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGA 364
           DP LLASM   P Q  Q +D RPPEERYE QLRQLN+MGFFDFDRNVAALRRSGGSVQGA
Sbjct: 301 DPQLLASMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGA 360

Query: 365 LDSLLNGDV 373
           LDSLLNGDV
Sbjct: 361 LDSLLNGDV 369

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  285 bits (729), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 219/400 (54%), Gaps = 60/400 (15%)

Query: 1   MSLNIHIKSGQDKWEVNVAPE---STVLQFKEAINKANGIPVANQRLIYSGKILKDDQTV 57
           M + + +K GQ++W+V VA E   +TV QFKE +    G+PV NQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYHIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSS--GQSAGFNPLA 115
           E Y I DGH+VHLVKS                              S   GQ  GFNPLA
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 116 DLTSARYAGY-LNMPSADMFGPDGGALNNDSNNQ----DELLRMMENPIFQSQMNEMLSN 170
           DLTSARYAGY L MPSADMFGPDGG  +          +E+L M+ENPIFQSQMNEM SN
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSP----------MFRQMLTNPDMIRQSMQFARMM 220
           PQM+DF+IQSNPQLQAMGPQAR+MLQSP          M RQ +    M++ S   A   
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGAGAGGA 240

Query: 221 DPNXXXXXXXXXXXXXXXXXXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFA 280
           DPN                                                      PF+
Sbjct: 241 DPNAFPAPGGDDTGAPTNTSTNAS-------------------------AAGPAGANPFS 275

Query: 281 SLLN----PALNPFANAGNAASTGMPAFDPA-LLASMFQPPVQASQA--EDTRPPEERYE 333
           SL      PA  PF +A        P FD A  + +M +    A  A  +DTRPPEERYE
Sbjct: 276 SLFGGAPAPAAQPFQSA--------PGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYE 327

Query: 334 HQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373
            QLRQLNDMGF DFDRNVAALRR+GGS+QGALD+LLNGDV
Sbjct: 328 QQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  281 bits (720), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 169/224 (75%), Gaps = 6/224 (2%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS+++ IKSGQ+KW+V V P +T+L+FKE I+KA+ IP  NQRLIYSGKILKD +TVESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  HIQDGHSVHLVKS---QPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADL 117
            IQDGHS+HLVKS                               N++SGQ+ GFNPLADL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           TSARYAGY L MPSADMFGPDGG  N    NQD++L M+ENP+FQSQMNEMLSNPQM+++
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMP--NQDDMLSMLENPVFQSQMNEMLSNPQMVEY 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220
           MI SNPQLQA+GPQAR+M QSP FRQMLTNPDMIRQSM+ ARMM
Sbjct: 179 MINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMM 222

 Score =  131 bits (329), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 76/101 (75%), Gaps = 10/101 (9%)

Query: 282 LLNPALNPFANAGNAASTG---------MPAFDPALLASMFQPPVQASQAEDTRPPEERY 332
           L NP +NPFA  GN A+ G          P F+P++LASM Q P Q +Q EDTRPPE RY
Sbjct: 278 LFNPGMNPFAGLGNPAAAGSTGAPGTPQYPGFNPSMLASMLQQPRQPAQ-EDTRPPEVRY 336

Query: 333 EHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373
           E QLRQLNDMGFF+FDRN+AALRRSGGSVQGALD+LLN DV
Sbjct: 337 ESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  275 bits (704), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 132/221 (59%), Positives = 165/221 (74%), Gaps = 2/221 (0%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           M++++HIKSGQ+ W+V +   ST+  FK+ I   + IP  NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
            IQDGHS+H+VKS                             MS+G+ +GFNPL+DLTSA
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PSADMFGPDGG+    S +QD++L M+ENP+FQSQMNEMLSNP+++DF+I S
Sbjct: 121 RYAGYTNLPSADMFGPDGGSFA--SQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINS 178

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMD 221
           NPQLQ++GPQAR M QSPMFRQMLTNPDMIRQSM+ A+MM+
Sbjct: 179 NPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMN 219

 Score =  105 bits (262), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 278 PFASLLNPALNPFANAGNAASTGMPAFDPALLASMFQPPVQASQA-EDTRPPEERYEHQL 336
           PFA+L +P++NP+A  G         F+PA  A   Q     +Q  ED RPPEERYEHQL
Sbjct: 280 PFAALFDPSMNPYAALGGGNGNANNMFNPAAFAQALQAAAPHTQEPEDNRPPEERYEHQL 339

Query: 337 RQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLN 370
           RQLNDMGFFDFD+NVAALRRSGGSVQGA+++LL+
Sbjct: 340 RQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  275 bits (704), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 140/220 (63%), Positives = 163/220 (74%), Gaps = 6/220 (2%)

Query: 2   SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYH 61
           +++IHIKSGQ+ W+V++   +++   K+ I K + IP  NQRLIYSGKILKDDQ V+ Y+
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSAR 121
           IQDGHSVHLV+S  K                         N+S+GQ+ GFNPLADLTSAR
Sbjct: 63  IQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPS----NISAGQTGGFNPLADLTSAR 118

Query: 122 YAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           YAGY LN+PSAD FGPDGG +N    N DE L M++NPI QSQMNEMLSNPQM+DFMIQS
Sbjct: 119 YAGYNLNLPSADAFGPDGG-MNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQS 177

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220
           NPQLQAMGPQARQM QSPMFRQMLTNPDMIRQSMQ A MM
Sbjct: 178 NPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMM 217

 Score =  121 bits (303), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 81/119 (68%), Gaps = 23/119 (19%)

Query: 278 PFASLLNP---------ALNPF------ANAG----NAASTG-MPAFDPALLASMFQ--- 314
           PFASL NP         A NPF      A AG    NA +TG +P FDP++ AS+F    
Sbjct: 286 PFASLFNPTANNDSTGLAPNPFLAMLNNAGAGSGTNNAGATGTLPPFDPSMFASLFGGAG 345

Query: 315 PPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373
            P    Q +DTRPPEERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A+++LLNGDV
Sbjct: 346 APSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  258 bits (659), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 153/212 (72%), Gaps = 2/212 (0%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           M++ I +KSGQ++WEV+V    +V + K+ I K + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
            I DGH++HLVKS                            ++S+GQS GFNPLADLT A
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PS DMFGPDGG   N +  Q+E++ M+ENPIFQSQMNEML+NPQM+DF+IQ 
Sbjct: 121 RYAGYTNLPSTDMFGPDGGL--NSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQ 178

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQ 212
           +P LQAMGP AR+MLQSP FRQMLTNPD+IRQ
Sbjct: 179 HPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210

 Score =  118 bits (295), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/88 (65%), Positives = 64/88 (72%)

Query: 286 ALNPFANAGNAASTGMPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFF 345
           A NP   A       MP  DPA+L+S+F     +    D RPPEERYE QLRQLNDMGFF
Sbjct: 258 AANPLGAAPADRGLAMPPLDPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFF 317

Query: 346 DFDRNVAALRRSGGSVQGALDSLLNGDV 373
           DFDRNVAALRR+GGSVQGALD+LLNGDV
Sbjct: 318 DFDRNVAALRRAGGSVQGALDALLNGDV 345

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  251 bits (642), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 156/227 (68%), Gaps = 13/227 (5%)

Query: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
           MS+++H+KSGQ+KW+V+  P S++   K+ I + + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVK-----------SQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSA 109
            I DGHS+HLV+           +                            N+++GQ  
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 110 GFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLS 169
           GFNPLADLT ARYAGY N+PS DMFGPDGG   N +  Q+E+L M++NPIFQSQ+NEML+
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGL--NSAIGQEEILGMLDNPIFQSQVNEMLA 178

Query: 170 NPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQF 216
           NPQM+DF+IQ +P LQAMGP AR+MLQSP FRQM+TNPD+IRQ  +F
Sbjct: 179 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF 225

 Score =  106 bits (265), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 73/121 (60%), Gaps = 25/121 (20%)

Query: 278 PFASLLNP----ALNPFANAGNAASTGMPA------------------FDPALLASMFQP 315
           PFA++  P      NP  NAG   ST  PA                   DPA+L+++   
Sbjct: 286 PFAAMFAPPANSGPNPGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSG 345

Query: 316 PVQAS---QAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGD 372
              A+   Q ED RPPEERY+ QL QLN+MGF DFDRNVAALRRSGGSVQGAL++LLNGD
Sbjct: 346 GFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGD 405

Query: 373 V 373
           V
Sbjct: 406 V 406

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 102/219 (46%), Gaps = 14/219 (6%)

Query: 3   LNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHI 62
           ++++IK  ++K+ +    +  +      I     IP  NQRLIYSG+IL  ++T++ Y+ 
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  QDGHS-VHLVKSQPKPQXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSAR 121
           +DGH  + ++  + K                          ++S    G   +  +T+  
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGNIITITTT- 120

Query: 122 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQ-MLDFMIQS 180
                   S D +G     + +D   + ELL+++++P    Q NEML N Q +L F+IQ+
Sbjct: 121 --------SPDPYGVRSNEV-HDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFLIQT 170

Query: 181 NPQLQAMGPQ-ARQMLQSPMFRQMLTNPDMIRQSMQFAR 218
           NP L+ M    ARQ+L+ P  ++   + + + Q +   R
Sbjct: 171 NPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 33/56 (58%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V +     V   KE + +  GIP + QRLI+ GK + D+QTV+S  + DG  +HLV
Sbjct: 15 VEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
          M L +   +G++   V+V    TV   KE + +  GIP + Q+LI+ GK + D+ T+ S 
Sbjct: 1  MQLKVKTLTGKE-ISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 HIQDGHSVHLV 71
           +QDG  +HLV
Sbjct: 60 DLQDGSLLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 5/73 (6%)

Query: 1  MSLNIHIKSGQDKWEVNVAPES--TVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVE 58
          M L +   +G+   E+ ++ ES   V + KE + +  GIP + QRLI+ GK ++DDQTV+
Sbjct: 1  MELKVKTLTGK---EIPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVD 57

Query: 59 SYHIQDGHSVHLV 71
          S ++  G  +HLV
Sbjct: 58 SANLSSGMQLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V V+ E  V   KE + +  GIP + QRLI+ GK + +D T+ +  + DG  +HLV
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
          M L +   +G++   V V P+  V + KE + +  GIP   QRLI+ GK + DD++V S 
Sbjct: 1  MKLTVKTLTGKE-IPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 HIQDGHSVHLV 71
          ++  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (60%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V     V   K+ + +  GIP + QRLI+ GK + D+QTVES ++ DG  +HLV
Sbjct: 15 IEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESANLIDGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V++     V + KE + +  GIP + QRLI+ GK + D+QTV S ++ DG  +HLV
Sbjct: 15 VDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V ++    V + KE + +  GIP + QRLI+ GK + D+Q+V S ++ DG  +HLV
Sbjct: 15 VEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 33/56 (58%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V +  E  + + KE + +  GIP + QRLI+ GK + D QTV S  + DG  +HLV
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V +  ++ + + K+ + +  GIP + QRLI+ GK + D QT+E+  + DG  +HLV
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 11 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          V +     V   KE + +  GIP + QRLI+ GK + D  TV   H+ +G  +HLV
Sbjct: 15 VELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 40/66 (60%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  +++ P +T+L  K  + +A     +  ++IYSGK+L+D QTVE   +++G  +  
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQIIF 70

Query: 71 VKSQPK 76
          + S+ K
Sbjct: 71 MISKKK 76

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 3  LNIHIKS-GQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYH 61
          +NI  K   ++K  V +   ST+L  K  +       +   +LI+SGK+LKDDQTV S  
Sbjct: 1  MNIIFKDFKKEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCG 60

Query: 62 IQDGHSVHLVKSQPK 76
          ++D   V ++ S+ K
Sbjct: 61 LKDNDQVIMMISKKK 75

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1  MSLNIHIKS-GQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVES 59
          M++ IH K   +++  + ++P +T+ + K+ + +A     +  ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YHIQDGHSVHLVKSQPKPQ 78
            ++DG  V  + S+ K +
Sbjct: 61 CKLKDGDQVIFMISKKKAE 79

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 1   MSLNIHIKSGQDK------WEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDD 54
           + L+IHIK    K        + V    T+   K  I    GIP   QRLI++GK L+D 
Sbjct: 53  LLLHIHIKYSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG 112

Query: 55  QTVESYHIQDGHSVHLV 71
           +T+  Y+IQ   ++HLV
Sbjct: 113 RTLSDYNIQKESTLHLV 129

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 40/66 (60%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  +++ P +T+L+ K  + ++     +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MVSQKK 76

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 40/66 (60%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  +++ P +T+ + K  + +++    +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MISQKK 76

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  +++ P +T+ + K  + ++     +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MISQKK 76

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 1  MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQR--LIYSGKILKDDQTVE 58
          M L I     + K+++N     TV   K  I K++ +        LIYSGK+L+DD T+ 
Sbjct: 1  MKLYIKDPRTRSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLN 60

Query: 59 SYHIQD-GHSVHLVKSQPKP 77
          S H++D    V L++ +P P
Sbjct: 61 SLHLKDNAQIVMLIRRRPSP 80

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 41/66 (62%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K+ +++    +++  KEA+++      +  +LI+SGK+LKD  +VES + +DG+ V  
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEVIF 70

Query: 71 VKSQPK 76
          + S  K
Sbjct: 71 MVSAKK 76

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 119 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 195 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 271 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 347 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  +++ P +T+ + K  + ++     +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MVSQKK 76

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 38/66 (57%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + + P STVLQ K+ +           +LI+SGK+L+D +T+E   ++DG  V  
Sbjct: 11 KEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECKLKDGDQVIF 70

Query: 71 VKSQPK 76
          + S+ +
Sbjct: 71 MISKKR 76

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++ K L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQKESTLHLV 374

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 169 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 245 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 300

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 323 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 399 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 454

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 40/68 (58%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  + +A ++T+   KE I +      +  +LIY+GKIL+D +TV   ++++G  V  
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIF 69

Query: 71 VKSQPKPQ 78
          + S+ K +
Sbjct: 70 MISKTKKK 77

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%)

Query: 329 EERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           E  Y  Q+RQL +MGF D ++N+ AL++S G++  A+D L
Sbjct: 187 ESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 1  MSLNIHIKS-GQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVES 59
          M + I+ K   ++K  + ++P +T+ + K+ + K      +  ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YHIQDGHSVHLVKSQPK 76
            ++DG  V  + S+ K
Sbjct: 61 CKLKDGDQVIFMISKKK 77

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 37.0 bits (84), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 1  MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGK 49
          M L +   +G++  +++VAPE  V + KE + +  GIP + QRLI+ GK
Sbjct: 1  MLLKVKTLTGKE-IQIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGK 48

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 22 STVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSV 68
          STV + K+ + +      +  +LIYSGKIL+DD+T+  Y ++DG  V
Sbjct: 22 STVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 22 STVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSV 68
          ST+ + K+ + +      +  +LIYSGKIL+DD+T+  Y + DG  V
Sbjct: 22 STISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%)

Query: 13 KWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVK 72
          K  +++   STVL  K+ + +      +  +LIYSGK+L+D  ++E   ++DG  V  + 
Sbjct: 13 KISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQVIFMI 72

Query: 73 SQPK 76
          S+ K
Sbjct: 73 SKKK 76

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373
           R+ HQLR L ++G+ D D NV AL  + G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL--NGD 372
           +Y  +LR+L +MGF D D N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 35.0 bits (79), Expect = 0.016,   Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGK 49
          ++V PE  V   KE + +  GIP A QRLI+ GK
Sbjct: 15 IDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGK 48

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           +Y  QL++LNDMGF + D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGD 372
           +Y  QLR L DMGF D D NV AL    G++   ++ L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           +Y  +LRQL ++GF +  +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 3  LNIHIKSGQDKWEVNVAPEST--VLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60
          +NI  K  + K ++ +A EST  VL  K  + +      +  +LIYSGK+L+D +T+E  
Sbjct: 2  INITFKDFK-KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDC 60

Query: 61 HIQDGHSV 68
           ++DG  V
Sbjct: 61 GLKDGDQV 68

>TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311
          YDR139C
          Length = 71

 Score = 33.9 bits (76), Expect = 0.071,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGK 49
          + V PE  V   KE + +  GIP +  RLI+ GK
Sbjct: 15 IEVLPEDKVFHIKELLEQKEGIPPSQLRLIFQGK 48

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 36.6 bits (83), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          ++K  +++    TVL  K+ I        +  +LIYSGK+L++D T+    ++DG  V  
Sbjct: 11 KEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQVIF 70

Query: 71 VKSQPK 76
          + S+ K
Sbjct: 71 MISKKK 76

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           RY  +LR L +MG+ D D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
          YDR139C (RUB1) - ubiquitin-like protein [contig 171]
          FULL
          Length = 52

 Score = 32.0 bits (71), Expect = 0.20,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 1  MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGK 49
          M L +   +G++   V V P   V + KE + +  GIP   Q+LI+ GK
Sbjct: 1  MKLTVKTLTGKE-IAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGK 48

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 32.3 bits (72), Expect = 0.23,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 13 KWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 70
          K  V    E  V  FK+ ++   G P +  +L+  G ILKD  +++ Y I D   + L
Sbjct: 13 KIRVKCLEEDLVGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYEIHDNTFLEL 70

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDG-HSVH 69
          ++K  + +  +ST+   K  I       +   +LIYSGKILK+D T+ +  ++D  H + 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 70 LVKSQPK 76
          ++  + K
Sbjct: 71 MISKKKK 77

>Ecym_4105 Chr4 complement(211323..214052) [2730 bp, 909 aa] {ON}
           similar to Ashbya gossypii AER311W
          Length = 909

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 279 FASLLNPA-LNPFANAGNAASTGMPAFDPALLASMFQPPVQASQAEDTRPPEERYE-HQL 336
           F+S++ P+ ++  ANA N+ +  +  + P  L    QP +Q    ED +P E   E  + 
Sbjct: 384 FSSMVTPSDMSLAANAQNSTNPNLGMYHPRTLKQTIQPELQFFLTEDGQPLERTGEIFEK 443

Query: 337 RQLNDMGFF----DFDRNVAALRRSGGSVQGALD 366
            ++N+  FF    +FD N+  L  SG  ++ + D
Sbjct: 444 VKVNEKSFFVAKQEFDGNINELTISGHLIRISSD 477

>KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1 Ubiquitin-like protein modifier
          Length = 74

 Score = 32.0 bits (71), Expect = 0.37,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 13 KWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSG-KILKDDQTVESYHIQDGHSVHL 70
          K  V    E TV  FK+ ++   G   A++ ++  G  +LKD  T+E Y + DG ++ L
Sbjct: 13 KVNVKCLSEDTVGDFKKVLSVQLGTASASKIVLQKGGSVLKDHITLEDYEVHDGTNLEL 71

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 3  LNIHIKS-GQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYH 61
          +NI  K   ++K  + + P S+V   K  +        +  +LIYSGK+L+D + ++   
Sbjct: 2  INIIFKDFKKEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESG 61

Query: 62 IQDGHSVHLVKS 73
          ++DG  V  + S
Sbjct: 62 LKDGDQVIFMIS 73

>Skud_4.398 Chr4
          complement(705294..705386,705390..705431,
          705435..705581) [282 bp, 94 aa] {ON} YDR139C (REAL)
          Length = 94

 Score = 31.6 bits (70), Expect = 0.69,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 32/79 (40%), Gaps = 23/79 (29%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGK----------------------ILKD 53
          V +     V   KE + +  GIP + QRLI+ GK                      +  D
Sbjct: 9  VELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQMYVKLAWLITFQACLYLRFYRLRSD 68

Query: 54 DQ-TVESYHIQDGHSVHLV 71
          D+ TV   H+ +G  +HLV
Sbjct: 69 DKLTVTDAHLVEGMQLHLV 87

>Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261
          bp, 86 aa] {ON} YDR139C (REAL)
          Length = 86

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKD 53
          V +     V   KE + +  GIP + QRLI+ GK + D
Sbjct: 15 VELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIVD 52

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 33/58 (56%)

Query: 11 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSV 68
          ++K  +++   S+VL  K  + +         +LIYSGK+L+D ++++   ++DG  V
Sbjct: 11 KEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQV 68

>Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300
          bp, 100 aa] {ON} YDR139C (REAL)
          Length = 100

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 24/80 (30%)

Query: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKI------------------LKDDQ-- 55
          V +     V   KE + +  GIP + QRLI+ GK                   L +DQ  
Sbjct: 15 VELRESDLVYHIKELLEEKEGIPPSQQRLIFQGKQMYVKFTSSIVSKFSTFSDLTNDQDS 74

Query: 56 ----TVESYHIQDGHSVHLV 71
              TV   H+ +G  +HLV
Sbjct: 75 DDKLTVTDAHLVEGMQLHLV 94

>Smik_15.41 Chr15 complement(76252..76896) [645 bp, 214 aa] {ON}
           YOL111C (REAL)
          Length = 214

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 15  EVNVAPESTVLQFKE-AINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKS 73
           E + +P  T+LQ K+  I K     V+  +L+  GK+L D+  +    I+  +S+  V  
Sbjct: 89  EHDFSPSDTILQIKQHLIEKEKASHVSEIKLLLKGKVLHDNLFLSDLKIEAANSIITVMI 148

Query: 74  QPKP 77
           +P P
Sbjct: 149 KPIP 152

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           RY  QL +L DMG+ D  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>KAFR0D04220 Chr4 complement(830052..833102) [3051 bp, 1016 aa] {ON}
           Anc_3.418 YPR104C
          Length = 1016

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 291 ANAGNAASTGMPAFDPALLASMFQPPVQASQ 321
           + A  A  T  P+FDP  L+  FQP  QA++
Sbjct: 844 STASTAVPTSTPSFDPTSLSRFFQPRQQATR 874

>Skud_15.41 Chr15 complement(73388..74032) [645 bp, 214 aa] {ON}
           YOL111C (REAL)
          Length = 214

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 15  EVNVAPESTVLQFKE-AINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLVKS 73
           E +  P  TVLQ K+  I++     V+  +L+  GK+L D+  +    I   +S   V +
Sbjct: 89  EHDFCPSDTVLQIKQHLIDEEKASHVSEIKLLLKGKVLHDNLFLSDLKIGPANSTITVMT 148

Query: 74  QPKP 77
           +P P
Sbjct: 149 KPNP 152

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           +Y   ++ L  MG+ D D N  AL  + G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 331 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 368
           RY  +L +L +MGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,146,419
Number of extensions: 1169995
Number of successful extensions: 4128
Number of sequences better than 10.0: 182
Number of HSP's gapped: 4189
Number of HSP's successfully gapped: 273
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)