Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR273C (ZDS1)8.831ON91590636550.0
Smik_13.4868.831ON92392927030.0
Skud_13.4458.831ON89892523670.0
Suva_13.4618.831ON93167018090.0
KLTH0C04048g8.831ON9355485285e-55
TDEL0B006608.831ON9595145144e-53
KNAG0G033708.831ON10762075032e-51
NCAS0B011108.831ON993994994e-51
Kpol_541.108.831ON10564694961e-50
NDAI0E003508.831ON11631204942e-50
CAGL0F03421g8.831ON817964761e-48
KAFR0A027708.831ON8842084771e-48
Kpol_1069.28.831ON1001984729e-48
KLLA0D01683g8.831ON944964701e-47
KAFR0B038608.831ON8431004611e-46
SAKL0D01716g8.831ON942964593e-46
YML109W (ZDS2)8.831ON942994513e-45
Kwal_27.103188.831ON9251704503e-45
AAL185W8.831ON10181004505e-45
TPHA0I002008.831ON1049984488e-45
Suva_13.358.831ON982994381e-43
Ecym_27108.831ON8961004362e-43
Smik_13.258.831ON949974372e-43
Skud_13.328.831ON948994263e-42
ZYRO0G13992g8.831ON12112354274e-42
TBLA0B032008.831ON1086994249e-42
CAGL0J06688g8.831ON828994192e-41
TPHA0C047208.831ON10721004078e-40
TBLA0D031908.831ON1682943892e-37
Skud_14.8singletonON74791352e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR273C
         (915 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...  1412   0.0  
Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...  1045   0.0  
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...   916   0.0  
Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...   701   0.0  
KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...   207   5e-55
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...   202   4e-53
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   198   2e-51
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   196   4e-51
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   195   1e-50
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   194   2e-50
CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...   187   1e-48
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   188   1e-48
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   186   9e-48
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   185   1e-47
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   182   1e-46
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...   181   3e-46
YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...   178   3e-45
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   177   3e-45
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   177   5e-45
TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...   177   8e-45
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...   173   1e-43
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   172   2e-43
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...   172   2e-43
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...   168   3e-42
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   169   4e-42
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   167   9e-42
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   166   2e-41
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   161   8e-40
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   154   2e-37
Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [2...    57   2e-09

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score = 1412 bits (3655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/906 (79%), Positives = 719/906 (79%)

Query: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID
Sbjct: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFXXXXXXXXXXXXXXXXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSN 120
           PELDIKF                          VNNTRYSDPTPLENLHGRGNSGIESSN
Sbjct: 61  PELDIKFGGESSGRRSWSGTTSSSASMPSDTTTVNNTRYSDPTPLENLHGRGNSGIESSN 120

Query: 121 KTKQGNYLGIKKGVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNFLELVQDTLQNIQLS 180
           KTKQGNYLGIKKGVHSPSR            WVPANQHPNVKPDNFLELVQDTLQNIQLS
Sbjct: 121 KTKQGNYLGIKKGVHSPSRKLNANVLKKNLLWVPANQHPNVKPDNFLELVQDTLQNIQLS 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRS 240
                                 KESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRS
Sbjct: 181 DNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRS 240

Query: 241 YTEFXXXXXXXXXXXSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAI 300
           YTEF           SASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAI
Sbjct: 241 YTEFDDNEDDDNKGDSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAI 300

Query: 301 TLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPER 360
           TLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPER
Sbjct: 301 TLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPER 360

Query: 361 SSLRRSRFNTYRIRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDE 420
           SSLRRSRFNTYRIR              MKNDDEERLKLTKNTIKVEIDPHKSPFRQQDE
Sbjct: 361 SSLRRSRFNTYRIRSQEQEKEVEQSVDEMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDE 420

Query: 421 DSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGT 480
           DSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGT
Sbjct: 421 DSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGT 480

Query: 481 TDMVKPSATDDNKETKRHRRRNGWTWLNNKMSRXXXXXXXXXXXXXXXXVDSQRMELDNS 540
           TDMVKPSATDDNKETKRHRRRNGWTWLNNKMSR                VDSQRMELDNS
Sbjct: 481 TDMVKPSATDDNKETKRHRRRNGWTWLNNKMSREDDNEENQGDDENEENVDSQRMELDNS 540

Query: 541 KKHYISLFNGGEKTEVSNKEEMNNXXXXXXXXXXRQKIEKTFANLFRRKPHHKHDAXXXX 600
           KKHYISLFNGGEKTEVSNKEEMNN          RQKIEKTFANLFRRKPHHKHDA    
Sbjct: 541 KKHYISLFNGGEKTEVSNKEEMNNSSTSTATSQTRQKIEKTFANLFRRKPHHKHDASSSP 600

Query: 601 XXXXXXXXXIPNNDAVHVRVRKSKKLGNKSGREPVEPIVLXXXXXXXXXXXXXXGSQKIS 660
                    IPNNDAVHVRVRKSKKLGNKSGREPVEPIVL              GSQKIS
Sbjct: 601 SSSPSSSPSIPNNDAVHVRVRKSKKLGNKSGREPVEPIVLRNRPRPHRHHHSRHGSQKIS 660

Query: 661 VKTLKDSXXXXXXXXXXXXEGAXXXXXXXXXXXXXLPQLQPAVSVSSTKSNSRDXXXXXX 720
           VKTLKDS            EGA             LPQLQPAVSVSSTKSNSRD      
Sbjct: 661 VKTLKDSQPQQQIPLQPQLEGAIEIEKKEESDSESLPQLQPAVSVSSTKSNSRDREEEEA 720

Query: 721 XXXXXXXXXXXXISNQQHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPV 780
                       ISNQQHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPV
Sbjct: 721 KKKNKKRSNTTEISNQQHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPV 780

Query: 781 QTSAPVEASAQTQXXXXXXLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLL 840
           QTSAPVEASAQTQ      LKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLL
Sbjct: 781 QTSAPVEASAQTQAPAAPPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLL 840

Query: 841 TVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           TVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ
Sbjct: 841 TVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900

Query: 901 VAHDKE 906
           VAHDKE
Sbjct: 901 VAHDKE 906

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/929 (60%), Positives = 630/929 (67%), Gaps = 36/929 (3%)

Query: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSNR+NE  LRTTS+ K  ASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLL+D
Sbjct: 1   MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD 60

Query: 61  PELDIKFXXXXXXXXXXXXXXXXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSN 120
           PELDIKF                          +NNTRYSDPTPLENLH RG+  +ESS+
Sbjct: 61  PELDIKFGGESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSD 120

Query: 121 KTKQGNYLGIKKGVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNFLELVQDTLQNIQLS 180
           K +Q NY G KKGVHS SR            WVPANQHPNVKPDN+LELVQDTLQNIQL+
Sbjct: 121 KGRQSNYAGSKKGVHSTSRKLNANALKKNLLWVPANQHPNVKPDNYLELVQDTLQNIQLN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRS 240
                                   S+ Y+NKEN+T NLNR +SRHG ASLIRRPSTLRRS
Sbjct: 181 GSEDNNDDQNNGNKNSG-------SKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRS 233

Query: 241 YTEFXXXXXXXXXXXSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAI 300
           YTEF             S+TVNKVEER S+IKERPVSLRDITEELTKISNSAGLTDNDAI
Sbjct: 234 YTEFDDSEDDN----GDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAI 289

Query: 301 TLARTLSMAGSYSDKKDQPQP---EGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTW 357
           TLARTLSMAGSYSDKKD+ +P   EGH+ E D    TSQA   DDGE+ASNMPINN MTW
Sbjct: 290 TLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTW 349

Query: 358 PERSSLRRSRFNTYRIRXXXXXXXXXXXXXXMKN-DDEERLKLTKNTIKVEIDPHKSPFR 416
           PERSSLRRSRFNTYRIR              +K+ + E  L L  NT K  IDPHKSPFR
Sbjct: 350 PERSSLRRSRFNTYRIRQQEQEKEVEEDKEKIKDYETEHHLPLANNTSKTAIDPHKSPFR 409

Query: 417 QQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLEL 476
           QQ E+ E+MSSPGSIGDFQDIY+HYRQSSGEWEQEMGIEKEAE V  K   D++EQDLEL
Sbjct: 410 QQAEEPESMSSPGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEIDSLEQDLEL 469

Query: 477 REGTTDMVKPSATDDNKETKRHRRRNGWTWLNNKMSRXXXXXXXXXXXXXXXXVDSQRME 536
           RE    ++K S+T++NKETKRHRRRNGWTWLNNKM+R                +DSQRME
Sbjct: 470 REEPVGVIKSSSTEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRME 529

Query: 537 LDNSKKHYISLFNGGEKTEVSNKEEMNNXXXXXXXXXXRQKIEKTFANLFRRKPHHKHDA 596
            +NSK+H+ISLFNG EK E SNKEE N+          RQKIEKTFANLFRRKPHHKH+A
Sbjct: 530 RENSKRHHISLFNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRRKPHHKHEA 589

Query: 597 XXXXXXXXXXXXX----IPNNDAVHVRVRKSKKLGNKSGREPVEPIVLXXXXXXXXXXXX 652
                            +PNNDAVH   +K KK+G K+G+EPVEPIVL            
Sbjct: 590 SSSPSSSPSSSPSSIPLMPNNDAVHAPEKKVKKIGTKNGKEPVEPIVLRNRRRPQRNHHS 649

Query: 653 XXGSQKISVKTLKDSXXXXXXXXXXXXE-----------GAXXXXXXXXXXXXXLPQLQP 701
             GS++ISVK  KDS            +                          LP+LQP
Sbjct: 650 RRGSREISVKITKDSQPQSQLQSQQQLQQQIQLQLKSEINEMEMKKNEENDSDNLPKLQP 709

Query: 702 AVSVSSTKSNSRDXXXXXXXXXXXXXXXXXXISNQQHSKHVQKENTDEQKAQLQAPAQEQ 761
           AVSVSSTKSNSRD                  +SN+QH K+VQKE T EQKA  ++P+Q  
Sbjct: 710 AVSVSSTKSNSRDTGEEEIKKRNEKRSNTIELSNEQHRKYVQKEKTHEQKAPCRSPSQAP 769

Query: 762 VQTSVPVQASAPVQNS--APVQTSA--PVEASAQTQXXXXXXLKHTSILPPRKLTFADVK 817
            Q      + AP++ S   P++T +  P EA A+TQ      L+HTS+LPPRKLTFADVK
Sbjct: 770 SQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQ--AAPPLRHTSVLPPRKLTFADVK 827

Query: 818 KPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLRE 877
           KPDKPN+PVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLRE
Sbjct: 828 KPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLRE 887

Query: 878 QVLLSNFMYAYLNLVNHTLYMEQVAHDKE 906
           QVLLSNFMYAYLNLVNHTLYMEQVAHDKE
Sbjct: 888 QVLLSNFMYAYLNLVNHTLYMEQVAHDKE 916

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/925 (56%), Positives = 599/925 (64%), Gaps = 59/925 (6%)

Query: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSN  N+SMLR TS+++  A QRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID
Sbjct: 1   MSNTINDSMLRATSNNRMAACQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFXXXXXXXXXXXXXXXXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSN 120
           PELDIKF                          +NNTRYSDPTPLENLH R +SGIE+  
Sbjct: 61  PELDIKFCGESNGRRSWSGTTSKPTSAPNGTTGMNNTRYSDPTPLENLHERRSSGIETCA 120

Query: 121 KTKQGNYLGIKKGVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNFLELVQDTLQNIQLS 180
           K KQG+  G K+GVHSPSR            WVPANQHPNVKPDN+LELVQDTLQNI+L 
Sbjct: 121 KNKQGSSTGHKRGVHSPSRKLTANALKKNLLWVPANQHPNVKPDNYLELVQDTLQNIRLG 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXKESQSYENKEN-NTINLNRGLSRHGNASLIRRPSTLRR 239
                                 +E++S+ NKEN NT++LNRG+ RHGNASLIRRPSTLRR
Sbjct: 181 DNDDNDDENDKNENNRVT----EETESHGNKENMNTVDLNRGMLRHGNASLIRRPSTLRR 236

Query: 240 SYTEFXXXXXXXXXXXSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDA 299
           SYTEF            AS+TVN+VEER S+IKERPVSLRDITEELTKISNSAGLT+ND 
Sbjct: 237 SYTEFDDIEDDNGQRNEASKTVNRVEERTSRIKERPVSLRDITEELTKISNSAGLTNNDT 296

Query: 300 ITLARTLSMAGSYSDKKDQPQPEGHYD--EGD-IGFSTSQANTLDDGEFASNMPINNTMT 356
           ITLARTLSMAGSYSD  ++  P+   D  EG+ IG ++SQ    DDGE+ASNMP NN MT
Sbjct: 297 ITLARTLSMAGSYSDGGNEAGPKDLKDDYEGESIGVASSQRKASDDGEYASNMPTNNDMT 356

Query: 357 WPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFR 416
            PERSSL+RSRFNTYRIR               KN++  RL LT  T+K EI+  KSPF 
Sbjct: 357 GPERSSLKRSRFNTYRIRSQEQEKEEEQNVEETKNEEAGRLHLTDKTLKTEIESPKSPFG 416

Query: 417 QQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLEL 476
           Q+D++SE  SSPGS+GDFQDIY+HYRQ SG+WEQE GIEKE E     + +DTVEQ LEL
Sbjct: 417 QEDDESEYASSPGSVGDFQDIYDHYRQFSGDWEQEEGIEKEEEPTAAMLPDDTVEQQLEL 476

Query: 477 REGTTDMVKPSATDDNKETKRHRRRNGWTWLNNKMSRXXXXXXXXXXXXXXXXVDSQRME 536
            E +  M K  +TDD+KETKRHRRRNGWTWLN+KM++                V+SQ+ME
Sbjct: 477 GEESAGMNK--STDDSKETKRHRRRNGWTWLNSKMNKENDNEENQGDDENEESVESQKME 534

Query: 537 LDNSKKHYISLFNGGEKTEVSNKEEMNNXXXXXXXXXXRQKIEKTFANLFRRKPHHKHDA 596
            +NSKKH+ISLFNGGEK E S+K+E+N+          RQKIEKTFANLFRRKPHHKH+ 
Sbjct: 535 RENSKKHHISLFNGGEKNEPSSKDEVNSANVPTTTSQTRQKIEKTFANLFRRKPHHKHE- 593

Query: 597 XXXXXXXXXXXXXIPNNDAVHVRVRKSKKLGNKSGREPVEPIVLXXXXXXXXXXXXXXGS 656
                        +PNNDAV V  RK K L  K+ REP+EPIVL              GS
Sbjct: 594 ---ESLSPSTSPPVPNNDAVRVPERKLKNLDEKNEREPIEPIVLHSRARRHRHRHNRHGS 650

Query: 657 QKISVKTLKDSXXXXXXXXXXXX-----------EG---AXXXXXXXXXXXXXLPQLQPA 702
           ++ISV+   D                        EG                 L QLQPA
Sbjct: 651 REISVEAFNDKQSHSQLQPQPQQKPLQLQLQLQVEGEVSGIEVGKEVESDSEGLLQLQPA 710

Query: 703 VSVSSTKSNSRDXXXXXXXXXXXXXXXXX-XISNQQHSKHVQKENTDEQKAQLQAPAQEQ 761
           V+VSSTKSN RD                   + N++ +K VQKE   E+KA        Q
Sbjct: 711 VNVSSTKSNRRDTEEAETRKQNKKKRGDTIDLPNERLTKDVQKEKAHERKA--------Q 762

Query: 762 VQTSVPVQASAPVQNSAPVQTSAPVEASAQTQXXXXXXLKHTSILPPRKLTFADVKKPDK 821
           VQT  PVQ  APV   AP                    L+HTS+LPPRKLTFADVKKP+K
Sbjct: 763 VQTEAPVQVQAPV---AP-------------------PLRHTSVLPPRKLTFADVKKPEK 800

Query: 822 PNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLL 881
           PN+PVQF+DSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLL
Sbjct: 801 PNAPVQFSDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLL 860

Query: 882 SNFMYAYLNLVNHTLYMEQVAHDKE 906
           SNFMYAYLNLVNHTLYMEQ A DKE
Sbjct: 861 SNFMYAYLNLVNHTLYMEQAAQDKE 885

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/670 (56%), Positives = 441/670 (65%), Gaps = 15/670 (2%)

Query: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSN  NESMLRTTS+++A ASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID
Sbjct: 1   MSNTINESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFXXXXXXXXXXXXXXXXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSN 120
           PELDIKF                          +NNTRYSDPTPLE LH + ++  ES  
Sbjct: 61  PELDIKFGGESNGRRSWSGATSSSTSAPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYE 120

Query: 121 KTKQGNYLGIKKGVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNFLELVQDTLQNIQLS 180
           + +QGNY G KK VHSPSR            WVPANQHPNVKPDN+LELVQDTLQNI+L 
Sbjct: 121 RCRQGNYTGHKKVVHSPSRKLNANALKNNLLWVPANQHPNVKPDNYLELVQDTLQNIRLG 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXKESQSYENKEN-NTINLNRGLSRHGNASLIRRPSTLRR 239
                                  E++SY NKEN N +N+NRG+ RHGNASLIRRPSTLRR
Sbjct: 181 DNDDDNDNNDNEGDEAHG-----ETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRR 235

Query: 240 SYTEFXXXXXXXXXXXSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDA 299
           SYTEF             S TVNK +ER S+I+ERP+SLRDITEELTKISNSAGLTD+DA
Sbjct: 236 SYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDA 295

Query: 300 ITLARTLSMAGSYSDKKDQPQPEGH---YDEGDIGFSTSQANTLDDGEFASNMPINNTMT 356
           ITLARTL+MAGSYSDK D P+ E     Y+E +   + SQ  T DD E+ASNMPINN  T
Sbjct: 296 ITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDST 355

Query: 357 WPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFR 416
            PERSSL+RSRFNTYRIR               K +D  RL L +NTI++ I+  KSPFR
Sbjct: 356 GPERSSLKRSRFNTYRIRSHTEEQEEEQVLEETKKEDVSRLHLAENTIEIGINSPKSPFR 415

Query: 417 QQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLEL 476
           Q+D++S+ +SSPGSIGDFQDIY+HY QSSG+WE+EMGIEK       KV ++ VEQ+LE 
Sbjct: 416 QEDDESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQELEP 475

Query: 477 REGTTDMVKPSATDDNKETKRHRRRNGWTWLNNKMSRXXXXXXXXXXXXXXXXVDSQRME 536
           +E +T  V    TDD+KETKRHRRRNGWTWLNNKM++                V+SQRME
Sbjct: 476 QEESTGTVVSGTTDDSKETKRHRRRNGWTWLNNKMNKEEDNGENQGDDEGDEDVESQRME 535

Query: 537 LDNSKKHYISLFNGGEKTEVSNKEEMNNXXXXXXXXXXRQKIEKTFANLFRRKPHHKHDA 596
            DNSKKH+IS+FNG EKTE S+KEE NN          RQKIEKTFANLFRRKPHHKH+A
Sbjct: 536 RDNSKKHHISIFNGAEKTEASSKEEANNANASTSTSQTRQKIEKTFANLFRRKPHHKHEA 595

Query: 597 XXXXXXXXXXXXXIPNNDAVHVRVRKSKKLGNKSGREPVEPIVLXXXXXXXXXXXXXXGS 656
                         P+ND  H    K KKL +K GREP EPIVL              GS
Sbjct: 596 ------SPLPSSPAPDNDTAHGPETKLKKLSSKGGREPTEPIVLHNRPHHHRHHQGRRGS 649

Query: 657 QKISVKTLKD 666
           +++S+K   D
Sbjct: 650 REVSMKGTSD 659

 Score =  239 bits (609), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 138/211 (65%), Gaps = 32/211 (15%)

Query: 696 LPQLQPAVSVSSTKSNSRDXXXXXXXXXXXXXXXXXXISNQQHSKHVQKENTDEQKAQLQ 755
           LP+LQPA+SVSSTKSN RD                   +  +H+KHVQKE   EQ+ Q  
Sbjct: 743 LPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRS----NTGKHAKHVQKEMDHEQRGQAA 798

Query: 756 APAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQXXXXXXLKHTSILPPRKLTFAD 815
           A                               A A         L+HTS+LPPRKLTFAD
Sbjct: 799 AAPV----------------------------APADPAAPPAPALRHTSVLPPRKLTFAD 830

Query: 816 VKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGL 875
           VKK +KPN+PVQFTDSAFGFPLPLLTVSTV+MFDHRLPINVERAIYRLSHLKLSNSKR L
Sbjct: 831 VKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKREL 890

Query: 876 REQVLLSNFMYAYLNLVNHTLYMEQVAHDKE 906
           REQVLLSNFMYAYLNLVNHTLYMEQ  HDKE
Sbjct: 891 REQVLLSNFMYAYLNLVNHTLYMEQAGHDKE 921

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score =  207 bits (528), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 170/548 (31%), Positives = 242/548 (44%), Gaps = 100/548 (18%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFXXXXXXXXXXXXXXXX 83
           +KRKSEVLIAAQSLD+E++ VKNLKR+SIGSMD+LIDPE++ +                 
Sbjct: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHD 93

Query: 84  XXXXXXXXXXVNNTRYS------DPTPLENLHGRGNSGIES----SNKTKQG--NYLGIK 131
                      ++   S      D T  E L     +G ES    SN    G     G++
Sbjct: 94  QQLYNSHSDHDSDDDLSYVNDSIDITSTEYLQESEGTGFESLGSSSNDADCGKRTLSGVR 153

Query: 132 KG-VHSPSRXXXXXXXXXXXX------WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXX 184
           +G +   +R                  WVPANQHPN+KP+N+LELVQDTL  +++     
Sbjct: 154 RGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNE 213

Query: 185 XXXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRSYTEF 244
                               +    N+      L  GL+     SL+RRPS LR+S+TE 
Sbjct: 214 GSVEGGNDEKIVHAPAAASANLPPSNQ------LRSGLN-----SLVRRPSGLRKSFTEL 262

Query: 245 XXXXXXXXXXXSASE------TVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDND 298
                      S  +      + +K+     +I  R  SL+DITEELT+ISN AG TD D
Sbjct: 263 EDLLLQEAQDTSGGDENAELPSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGD 322

Query: 299 AITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWP 358
           A++LARTLSMA SY   +D             G S        + E+AS+M   N +  P
Sbjct: 323 AVSLARTLSMASSYYTDED-------------GESVGSPEKKPEKEYASSMLTKNGLAIP 369

Query: 359 ERSSLRRSRFNTYRIRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQ 418
            RSSLRRS+FNTYRIR              +++   E  +L ++ I+V            
Sbjct: 370 ARSSLRRSKFNTYRIR---NTSGGSTAPSNLRSPSAEHNELDRSPIRV------------ 414

Query: 419 DEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEE----------VPVKVRND 468
           D+ +  + SP S+ DF +IY+HYRQSS  ++  +G      +             + ++D
Sbjct: 415 DQKNAQLQSPTSVNDFNEIYDHYRQSS--FDSSLGAYPHEHQNAHTSNFHSIASKRPKDD 472

Query: 469 TV---------------------EQDLELREGTTDMVKPSATDDNKETKRH--RRRNGWT 505
           T+                     EQ    R G  +       DD+K       R+++GW+
Sbjct: 473 TLLDSESSLHDLHKGSLNKALDDEQQASFR-GHVEATNNDEKDDHKHASSQAPRKKSGWS 531

Query: 506 WLNNKMSR 513
           W   K S+
Sbjct: 532 WFGKKSSK 539

 Score =  173 bits (439), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 90/97 (92%)

Query: 805 ILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 864
           +LPPRKL F+DV KP++PN+P++F+DS+FGFPLP LTVSTV+M DHRLPINVERAIYRLS
Sbjct: 819 VLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLS 878

Query: 865 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901
           HLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q+
Sbjct: 879 HLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQL 915

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score =  202 bits (514), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 236/514 (45%), Gaps = 108/514 (21%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPA QHP+VKP+NFLELVQDTL NIQL                       KE+   +N 
Sbjct: 198 WVPAAQHPSVKPENFLELVQDTLHNIQLDEK--------------------KETTDNDND 237

Query: 212 ENNTIN------LNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSAS---ETVN 262
           E+N  N      L   ++R  + SL+RRPS LR+SYTEF           S +   E+ N
Sbjct: 238 ESNKENAKAYDRLPIDITRKRD-SLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRN 296

Query: 263 KVEERI-----SKIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKK- 316
             E        S    R VSL+DITEEL KISN+AGLT +DAITLARTLSMAGS++  + 
Sbjct: 297 SFERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEV 356

Query: 317 ----DQPQPEG-HYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTY 371
               D  +  G H D  D+    ++ N  DD EFASNM + + +  P RSSLRRS+FNTY
Sbjct: 357 NEDYDTSKRNGIHLDADDV---QNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTY 413

Query: 372 RIRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEID--PHKSPFRQQD--------ED 421
           R+R                 DDE     TK  +   ++    +S   QQD         +
Sbjct: 414 RVRSSGSTSSL---------DDEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKGN 464

Query: 422 SENMSSPGSIGDFQDIYNHYRQSSGEWEQEM--GIEKE------------AEEVPVKVRN 467
              MSSP SI DFQDIY+HYRQ S +WE+E+  G E +            ++E+     +
Sbjct: 465 GSIMSSPSSINDFQDIYDHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLS 524

Query: 468 DTVEQDLELREGTTDMVKPSATDDNKETKRHRRRNGWTWLNNKMSRXXXXXXXXXXXX-- 525
           D  + + +      DM + S+T   +E K   +R+GW+WLN   S+              
Sbjct: 525 DLSQGNAKSSIEAQDMEQASST-VVREMK--GKRSGWSWLNGMGSKETNTEKNVKDTARQ 581

Query: 526 -------------------XXXXVDSQRMELDNSKKHYISLFNGGEKTEVSNKEE----- 561
                                  V ++    ++SK  ++ +F   E ++  +  E     
Sbjct: 582 EVPLHREPSDSHIDEDFEKTSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVS 641

Query: 562 --MNNXXXXXXXXXXRQKIEKTFANLFRRKPHHK 593
             M            RQ  EK  ANLFRRK   K
Sbjct: 642 TKMGRSSSSDSSNLTRQMFEKKIANLFRRKGKKK 675

 Score =  186 bits (472), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 104/210 (49%), Positives = 132/210 (62%), Gaps = 31/210 (14%)

Query: 696 LPQLQPAVSVSSTKSNSRDXXXXXXXXXXXXXXXXXXISNQQHSKHVQK-ENTDEQKAQL 754
           LP LQPAVSV+STKS                      +++    + V++ +  D Q   +
Sbjct: 751 LPALQPAVSVTSTKS------------------AHVPLASSVVIESVKELDGDDSQDVSM 792

Query: 755 QAPAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQXXXXXXLKHTSILPPRKLTFA 814
              AQ  +  S   +  +  + ++ VQT     A   +             +PPRKLTF 
Sbjct: 793 DQNAQTSIDIST--ETLSMKEQTSEVQTDVKQPADGPSHQP----------VPPRKLTFD 840

Query: 815 DVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRG 874
           DVK+ ++ N+P++FTDSAFGFPLP+LTVSTVIMFDHRLPINVERAIYRLSHLKLS+ KR 
Sbjct: 841 DVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRE 900

Query: 875 LREQVLLSNFMYAYLNLVNHTLYMEQVAHD 904
           LR+QV+LSNFMYAYLNLVNHTLYMEQVA +
Sbjct: 901 LRQQVVLSNFMYAYLNLVNHTLYMEQVAQE 930

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 45/47 (95%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          SQR+KRKSEVLIAAQS+DNE+++VK+LKR+SIGS+DLL+DPEL+ + 
Sbjct: 27 SQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV 73

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  198 bits (503), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/207 (52%), Positives = 131/207 (63%), Gaps = 30/207 (14%)

Query: 696  LPQLQPAVSVSSTKSNSRDXXXXXXXXXXXXXXXXXXISNQQHSKHVQKENTDEQKAQLQ 755
            LP LQPAVSV+S K N+RD                    N    + V++ + D+ +    
Sbjct: 850  LPGLQPAVSVTSAK-NTRD--------------------NGDVVETVRELDGDDSQDISG 888

Query: 756  APAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQXXXXXXLKHTSILPPRKLTFAD 815
               Q Q+Q         P+      + +   +    T           S LPPRKLT+AD
Sbjct: 889  GDIQYQMQ---------PIDEPVDGEVATVDDTQTVTAAAASALPAVISTLPPRKLTYAD 939

Query: 816  VKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGL 875
            VK+P+KPN+P+QFTDSAFGFPLP+LTVSTVIMFDHRL INVERAIYRLSHLKLS+SKR L
Sbjct: 940  VKRPEKPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLSDSKREL 999

Query: 876  REQVLLSNFMYAYLNLVNHTLYMEQVA 902
            R+QVLLSNFMYAYLNLVNHTLYMEQV+
Sbjct: 1000 RQQVLLSNFMYAYLNLVNHTLYMEQVS 1026

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 133/366 (36%), Positives = 180/366 (49%), Gaps = 58/366 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPNVKP+N+LELV DTLQ I                          +S    +K
Sbjct: 237 WVPANQHPNVKPENYLELVHDTLQTINGEGDGDGDGHTIDTSADTGTAA---DSVDESDK 293

Query: 212 ENNTINLNRGLSRHGNAS-LIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISK 270
           ENN   L R   R+G AS L+RRPS LRRSY E            +++  ++ +EE    
Sbjct: 294 ENNNTRL-RVRYRNGKASSLVRRPSRLRRSYIE----TDEDEDSNTSNAKIDDIEEGGRS 348

Query: 271 IKER----------PVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQ-- 318
           + ER           VSLRDITEELTK+SNS GLTD+DA+TLARTL+M  +Y+D   +  
Sbjct: 349 LDERKPTRTNGDRKSVSLRDITEELTKMSNSVGLTDDDAVTLARTLNMTCTYTDTDSEGL 408

Query: 319 ------PQPEGHYDEGDIGFSTSQANTL-DDGEFASNMPINNTMTWPERSSLRRSRFNTY 371
                  + +   +E +    T+ A  L D+ +FASNM + N ++ P RSSLRRS+FNTY
Sbjct: 409 DNLRTDSKEQLRAEESENPPGTTHAKILPDENQFASNMFMKNGLSIPTRSSLRRSKFNTY 468

Query: 372 RIRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQ-----DEDSENMS 426
           RIR                N    RL    +    E   H+SP   Q     ++++  + 
Sbjct: 469 RIRTTSAPTPLVEKPKR-NNSRHARLSFV-HLDDEEFASHESPAALQSPTVNNDEAGVIE 526

Query: 427 SPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGTTDMVKP 486
           SPGSI    D+Y+HY  ++ E                   +  V +D EL+E   DM + 
Sbjct: 527 SPGSIS---DLYDHYTGTASE-----------------PGSPDVSEDKELKE---DMSRE 563

Query: 487 SATDDN 492
            +TDDN
Sbjct: 564 YSTDDN 569

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/51 (70%), Positives = 44/51 (86%)

Query: 17 KAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          +A    R+KRKSEVLIAAQSLD E+++VK+LKRLSIGSMDLLIDPEL+ + 
Sbjct: 18 RATEMDRNKRKSEVLIAAQSLDVEVQNVKHLKRLSIGSMDLLIDPELEFRV 68

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
           Anc_8.831 YML109W
          Length = 993

 Score =  196 bits (499), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 87/99 (87%), Positives = 95/99 (95%)

Query: 805 ILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 864
           +LP RKLTFADVK+PD+PN+P+QFTDSAFGFPLP+LTVSTVIMFDHRL INVERAIYRLS
Sbjct: 849 VLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLS 908

Query: 865 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAH 903
           HLKLS+SKR LR+QVLLSNFMYAYLNLVNHTLYMEQVA 
Sbjct: 909 HLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQ 947

 Score =  174 bits (441), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 154/490 (31%), Positives = 218/490 (44%), Gaps = 76/490 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPNVKP+N+LELVQDTLQNI L                        +S   E +
Sbjct: 202 WVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDISKSNMSEEE 261

Query: 212 --ENNTINLNRGLSR--HGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEER 267
             + +  +L++      + N SL+RRPS LR SYTEF            A    +++  R
Sbjct: 262 PIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESEAKTNESQLSSR 321

Query: 268 ISK---------------IKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSY 312
             K                 +R VSL+DITEELT ISN AGLTD+DAITLARTLSMA S+
Sbjct: 322 EEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLARTLSMASSF 381

Query: 313 SDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYR 372
           SD        G+    ++G S  Q  + ++ EFASNM + N +T PERSSLRRS+FNTYR
Sbjct: 382 SD--------GNV---NLGKSKLQNESNEESEFASNMFMKNGLTIPERSSLRRSKFNTYR 430

Query: 373 IRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIG 432
           IR              +     +     +     + D  +SP    + DS   ++  S G
Sbjct: 431 IRSTSSSTSTREKTSPLL----QSSSFARQEADTD-DLQRSPVSFTNRDSYLATTTSSPG 485

Query: 433 DFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGTTD--MVKPSAT- 489
              D+Y+HY Q + E +Q    + EA +  +   + + E      E + D  +VKP  + 
Sbjct: 486 SISDLYDHY-QDNAESKQGNDNDNEARQGDLSHASISQESSFLSNESSNDSILVKPLGSK 544

Query: 490 -------------DDNK--------------ETKRHR-RRNGWTWLNNKMSRXXXXXXXX 521
                        DD++              +T R + +RNGW+W  N   R        
Sbjct: 545 SMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSWSGN---RANSEEDAT 601

Query: 522 XXXXXXXXVDSQRMELDNSKKHYISLFNGGEKTEVSNKEEMNNXXXXXXXXXXRQKIEKT 581
                     +   +  +  +H   L    +  +++ + E+            R+ IEK 
Sbjct: 602 VLVNSQDEDQTGYTDQKSKSRHRPILARSRDHLKINKEAEL------PKESHKRETIEKR 655

Query: 582 FANLFRRKPH 591
           F  LFRRK H
Sbjct: 656 FVKLFRRKGH 665

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 51/57 (89%), Gaps = 2/57 (3%)

Query: 10 LRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          LR TS   ++ +QRDKRKSEVLIAAQSLDNE++SVKNLKRLSIGSMDLLIDPEL+ +
Sbjct: 10 LRKTSG--SLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFR 64

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
           complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  195 bits (496), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 150/469 (31%), Positives = 226/469 (48%), Gaps = 61/469 (13%)

Query: 20  ASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFXXXXXXXXXXXX 79
            S  DKRKS VLIAA+SLD E++ +K+LKR SIGSMD+L+DPEL+ +             
Sbjct: 28  TSMDDKRKSAVLIAAKSLDRELKHIKDLKRFSIGSMDMLMDPELEYRVSNINKQSTDTYS 87

Query: 80  XXXXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSN----------KTKQGNYLG 129
                          N+    DP  +++     +S I SSN          + K      
Sbjct: 88  KRRSITSDLQPLD-ANDDFSDDPLGIKSTEFLPSSVIRSSNPSGNRSDKYTRRKLSGSRS 146

Query: 130 IKKGVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXX 189
           +     S +             WVPA++HPNV PDN+++++Q++L N+ L          
Sbjct: 147 LNTIPDSMAYNSKASTTKKNLLWVPADKHPNVMPDNYIQMIQNSLNNLSLESNEDVDKDS 206

Query: 190 XXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFX---- 245
                             YE++E  ++   R      N SL+RRPS LR+SYTEF     
Sbjct: 207 KVLPQENKENI-------YEDRERLSVAYKRR-----NRSLVRRPSQLRKSYTEFNNSDD 254

Query: 246 ----------XXXXXXXXXXSASETVNKVEERISKIKER-PVSLRDITEELTKISNSAGL 294
                               SA+ +++ ++   S   +R  +SL+DIT ELTKISNS GL
Sbjct: 255 EEDNTDENNLSKNNKDTNENSANTSMDSIKTSKSFDNKRYSISLKDITAELTKISNSVGL 314

Query: 295 TDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFST-SQANTLDDGEFASNMPINN 353
           +D+DA++LAR+LS+ G Y   +D+ + +G    GDI     S   +L+D EF SNM + N
Sbjct: 315 SDSDAVSLARSLSITGPY---QDETESDG---AGDIMLDNPSDEESLND-EFVSNMVLRN 367

Query: 354 TMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKS 413
            +  P RSSLRRS+F TYR R               K + +++ + + ++ K   +  K+
Sbjct: 368 GLMIPTRSSLRRSKFTTYRSRTSSSDSLSPK-----KQNFDDKQETSVSSSKANENEIKN 422

Query: 414 PF----------RQQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEM 452
           PF           + +ED E++ +  +  DFQDIY+HYRQ S +W+ E 
Sbjct: 423 PFGKLPEVNLKAEESNEDDESLKTSPAASDFQDIYDHYRQPSSDWDMEF 471

 Score =  189 bits (479), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 83/97 (85%), Positives = 89/97 (91%)

Query: 804  SILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 863
            S+LPPRKL FADV K D PN P+QFTDSAFGFPLPLLT+STVIMFDHRLP+NVERAIYRL
Sbjct: 928  SVLPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNVERAIYRL 987

Query: 864  SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
            SHLKLS  KR LR+QVLLSNFMYAYL+LVNHTLYMEQ
Sbjct: 988  SHLKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQ 1024

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  194 bits (494), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 93/120 (77%), Positives = 100/120 (83%), Gaps = 3/120 (2%)

Query: 786  VEASAQTQX---XXXXXLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTV 842
            +EA  QTQ         L     LPPRKLTF DVK+P++PN+PV+FTDSAFGFPLP LTV
Sbjct: 1002 IEAEDQTQSFNDSATQPLSQQHGLPPRKLTFDDVKRPERPNAPVEFTDSAFGFPLPALTV 1061

Query: 843  STVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902
            STVIMFDHRL INVERAIYRLSHLKLS+SKR LREQVLLSNFMYAYLNLVNHTLYMEQVA
Sbjct: 1062 STVIMFDHRLGINVERAIYRLSHLKLSDSKRELREQVLLSNFMYAYLNLVNHTLYMEQVA 1121

 Score =  158 bits (399), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 134/253 (52%), Gaps = 39/253 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPN+KP+++LELVQDTL NI L                        +     NK
Sbjct: 270 WVPANQHPNIKPESYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDET---NK 326

Query: 212 ENNTINLNRGLS----RHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSA---------- 257
           EN  I+     S    R  N SL+RRPS LR+SYTEF           ++          
Sbjct: 327 ENLNIDYLTKPSTSELRRKNKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQQLST 386

Query: 258 ---SETVNKVEERISKIK-------------ERPVSLRDITEELTKISNSAGLTDNDAIT 301
              +   N  ++ I   K              R VSL+DITEELTKISN+AGLTD+DAIT
Sbjct: 387 DNSTNNANHHQDIIINNKTPEIIIPKGNTRSSRFVSLKDITEELTKISNNAGLTDSDAIT 446

Query: 302 LARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERS 361
           LARTLSMAGS+ D  +      +++E   G      NT +D E+ASNM + N +T P RS
Sbjct: 447 LARTLSMAGSFQDNSNNNHNSDNFNEEQNG------NTPEDDEYASNMFMKNGLTIPTRS 500

Query: 362 SLRRSRFNTYRIR 374
           SLRRSRFNTYRIR
Sbjct: 501 SLRRSRFNTYRIR 513

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/46 (69%), Positives = 44/46 (95%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          ++++KRKS++ IAA+SLDNE++SV+NLKRLSIGSMDLLIDPEL+ +
Sbjct: 33 ARKEKRKSDMFIAAKSLDNELQSVQNLKRLSIGSMDLLIDPELEFR 78

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score =  187 bits (476), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 84/96 (87%), Positives = 90/96 (93%)

Query: 805 ILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 864
           + PPRKLTFADVKK DK N+P++FTDSAFGFPLP LT STVIMFDHRLPI+VERAIYRLS
Sbjct: 720 LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLS 779

Query: 865 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           HLKLSNSKR LREQVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 780 HLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  147 bits (372), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 146/454 (32%), Positives = 210/454 (46%), Gaps = 94/454 (20%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WV A+QHPNVKP+N++ELVQD L NIQ+                       KE+    +K
Sbjct: 156 WVRADQHPNVKPENYIELVQDALHNIQIDKTEEHD----------------KENSDTLDK 199

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
            +   N N   S   N  L+RRPS LR+SYTEF           S+  T N V+   S  
Sbjct: 200 VSRYYNSNNKRSP-NNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSS--TNNNVD---STP 253

Query: 272 KERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAG-SYSDKKD--QPQPEGHYDEG 328
             +  +L+DITEELT+ISN AGLT+NDA+TLARTLSMA  +  D+ D  Q +PE   D  
Sbjct: 254 HNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDD-- 311

Query: 329 DIGFSTSQANTLDDGEFASNMPI-NNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXX 387
              ++    N  +D  +AS M +  +++   E S+L+RS++ TY IR             
Sbjct: 312 ---YARQSRN--NDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDP------ 359

Query: 388 XMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGE 447
                          TI V  +       +        +SPGSI    DIY+HYR+ SG+
Sbjct: 360 ---------------TIPVSTESQHQDVIE--------ASPGSIN---DIYDHYREPSGD 393

Query: 448 WEQEMGIEKEAEEVPVKVRNDT-VEQDLELREGTTDMVKPSAT--------DDNKETKRH 498
           W   + +  E E    K R DT ++ + ++ + +T+ V   +T        D NK+   H
Sbjct: 394 WSSLIQVAPENEN---KKRTDTDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAH 450

Query: 499 R-RRNGWTWLNNKMSRXXXXXXXXXXXXXXXXVDSQRMELDNSKKHYISLFNGGEKTEVS 557
           R +RNGW W ++K S                 V   R   ++SK  +  L+N   K E++
Sbjct: 451 RKKRNGWLW-SSKTSE--KVNVTSDKHENEDIVPESR--FNHSKNRHEPLYN--HKIEIA 503

Query: 558 NKEEMNNXXXXXXXXXXRQKIEKTFANLFRRKPH 591
           N                +  I+K  +N+FRRK H
Sbjct: 504 N--------TLGTLPEKKNAIDKKISNIFRRKHH 529

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (94%)

Query: 28 SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDI 65
          SEV IAAQSLD E+RSVKNLKRLSIGSMDLL+DPE+D+
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM 43

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
           Anc_8.831 YMR273C
          Length = 884

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 106/208 (50%), Positives = 123/208 (59%), Gaps = 26/208 (12%)

Query: 696 LPQLQPAVSVSSTKSNSRDXXXXXXXXXXXXXXXXXXISNQQHSKHVQKENTDEQKAQLQ 755
           LP LQPAVSV STK  S                    +      + V+ E  + Q    +
Sbjct: 661 LPSLQPAVSVVSTKKESNASAPPSSASSSSLSSSSSTVI-----QTVELEGDESQDVSYE 715

Query: 756 APAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQXXXXXXLKHT-SILPPRKLTFA 814
           A   E  +                     P  +S++T       LK   S LPPRKLTF 
Sbjct: 716 ALKGEDFRN--------------------PELSSSETTAEQEKELKSAISSLPPRKLTFD 755

Query: 815 DVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRG 874
           DVK+P+KPN+P+ F+DSAFGFPLP+LT STVIMFDHRL INVERAIYRLSHLKLS+ KR 
Sbjct: 756 DVKRPEKPNAPIHFSDSAFGFPLPMLTTSTVIMFDHRLGINVERAIYRLSHLKLSDPKRE 815

Query: 875 LREQVLLSNFMYAYLNLVNHTLYMEQVA 902
           LR+QVLLSNFMYAYLNLVNHTLYMEQ A
Sbjct: 816 LRQQVLLSNFMYAYLNLVNHTLYMEQAA 843

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 167/305 (54%), Gaps = 42/305 (13%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPA++HPNVKP N++ELVQDTLQ+I +                             ++K
Sbjct: 194 WVPASKHPNVKPQNYIELVQDTLQHIHID----------------------------DSK 225

Query: 212 ENNTINLNRGLSRHG--NASLIRRPSTLRRSYTEFXXXXXXXXXXXSAS---ETVNKVEE 266
            N+  N+N+    H   N SL+RRPS LR+SYTE+           + S   E  N    
Sbjct: 226 SNDNDNINKENDAHSSKNGSLVRRPSRLRKSYTEYEEENYQDDYNRNNSNDEENPNIGNF 285

Query: 267 RISKIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHY- 325
           R S  K R VSL+DITEELTKISN AGLTD+DAITLARTLSM GS+S+  D  +   +Y 
Sbjct: 286 RSSN-KGRSVSLKDITEELTKISNKAGLTDSDAITLARTLSMTGSFSNGTDDMELLSNYS 344

Query: 326 DEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXX 385
           D+ D  F+  +    +D EFASNM + N +T P+RSSLRRS+FNTYR+R           
Sbjct: 345 DQQDNNFNNDEHYNKNDDEFASNMLMKNGLTIPQRSSLRRSKFNTYRVRSSSAPSNIHSK 404

Query: 386 XXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMS-SPGSIGDFQDIYNHYRQS 444
                  + +  K   N+ K  I   KSP  + +  +E ++ SPGSI    D+Y+HY  S
Sbjct: 405 PINSNIKEPKTFKYPYNS-KTSI--KKSPVNRSNNYTEPVTESPGSIS---DLYDHYAYS 458

Query: 445 SGEWE 449
           S + E
Sbjct: 459 SVDEE 463

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (93%)

Query: 19 IASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          + S R+KRKSEVLIAA+S+DNE+R+VKNLKRLSIGSMDLLIDPEL+ K
Sbjct: 25 VESLRNKRKSEVLIAARSIDNEVRNVKNLKRLSIGSMDLLIDPELEYK 72

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
           [3006 nt, 1002 aa]
          Length = 1001

 Score =  186 bits (472), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 82/98 (83%), Positives = 92/98 (93%)

Query: 804 SILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 863
           +ILPPRKLTF DV++ D+PN  + FTDSAFGFPLPLLTVSTVIMFDHRLP+NVERAIYRL
Sbjct: 854 TILPPRKLTFEDVERLDRPNGSMVFTDSAFGFPLPLLTVSTVIMFDHRLPVNVERAIYRL 913

Query: 864 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901
           SHLKLS+S+R LREQVLLSNFMYAYL+LVNH+LYMEQV
Sbjct: 914 SHLKLSDSRRSLREQVLLSNFMYAYLHLVNHSLYMEQV 951

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 91/224 (40%), Positives = 129/224 (57%), Gaps = 29/224 (12%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHP+VKP NF+ELV DTLQN+ L                        ES+S    
Sbjct: 203 WVPANQHPSVKPQNFVELVHDTLQNMSLDDVQT------------------NESESKNEV 244

Query: 212 ENNTIN-LNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISK 270
             + +N  +R ++   N SL+RRPS LR+SYTEF           ++S  +N+  ++  +
Sbjct: 245 SKDLLNTFSRDMNMR-NKSLVRRPSRLRKSYTEFEEETEEEVKPTTSSNNINESNKKNVQ 303

Query: 271 IKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDI 330
            K R VSL+DI +ELT ISN+ GL+++DAI+LAR+LS+AGS     ++ + +   +   I
Sbjct: 304 GK-RAVSLKDIADELTVISNNVGLSNSDAISLARSLSIAGSIGSTSEEEEEDKVLNTSSI 362

Query: 331 GFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR 374
           G S        +  FASN+   N ++ P RSSLRRS+FNTY+IR
Sbjct: 363 GQS--------EEVFASNILAKNGISIPARSSLRRSKFNTYKIR 398

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/64 (65%), Positives = 50/64 (78%), Gaps = 3/64 (4%)

Query: 1  MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
          M N    +M +T + +K    QRDKRKS VLIAAQSLD E+++VKNLKRLSIGSMDLLID
Sbjct: 1  MENNSGGTMEKTRAEEKI---QRDKRKSAVLIAAQSLDQEVQNVKNLKRLSIGSMDLLID 57

Query: 61 PELD 64
          PEL+
Sbjct: 58 PELE 61

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 92/96 (95%)

Query: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865
           LPPRKLTFADV KPD+PNSP++FTDSAFGFPLP LT+STVIMFDHRLPI+VERAIYRLSH
Sbjct: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883

Query: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901
           LKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++Q+
Sbjct: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQI 919

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 90/227 (39%), Positives = 112/227 (49%), Gaps = 45/227 (19%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WV A+QHPNVKP+N+LELVQ+TL+N+ L                       +  QS    
Sbjct: 194 WVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLKTLRKRSMQS---- 249

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXX----XSASETVNKVEER 267
                         GN SL RRPS LR SYTE                +A+ T++     
Sbjct: 250 --------------GN-SLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSS---- 290

Query: 268 ISKIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDE 327
                 R VSL+DITEELTK+SN AGLTD DA+TLARTL +A            E   D 
Sbjct: 291 -----RRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVAD-----------ESTTDS 334

Query: 328 GDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR 374
              G S + A+  ++ EFAS M   +  T P R SLRRS+FNTYRI+
Sbjct: 335 TGQGLSNNLAD--EEEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQ 379

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          S+RDKRKSEVLIAAQSLD E++ VKNLKRLSIGSMDLL+DPEL+ +
Sbjct: 4  SKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYR 49

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  182 bits (461), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%)

Query: 801 KHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAI 860
           +H SILPPRKLTF DVKKP+K N P+Q+TDSAFGFPLPLLTVSTVIM+D RL  NVERAI
Sbjct: 711 QHKSILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMYDCRLATNVERAI 770

Query: 861 YRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           YRLSHLKL N KR LREQVL+SNFMYAYLNLVNHTL+MEQ
Sbjct: 771 YRLSHLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQ 810

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/312 (28%), Positives = 133/312 (42%), Gaps = 51/312 (16%)

Query: 22  QRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFXXXXXXXXXXXXXX 81
           Q+++R S + +AAQSL +E+++V +LKRLS+GS+D+L D   D++F              
Sbjct: 7   QKEQRNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTD--TDVEFSFNKLQRNISAKKT 64

Query: 82  XXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSNKTKQ--------------GNY 127
                         +  Y+  T LE  +G  ++  ES   T+                  
Sbjct: 65  QEILSQKRTSTETESVSYN--TLLEGFYGSDDAEDESEKTTRNTSISETRDKSPSVPARA 122

Query: 128 LGIKKGVHSPS--------RXXXXXXXXXXXXWVPANQHPNVKPDNFLELVQDTLQNIQL 179
            G K G  S S        +            WV A+ HPNVKP+N++ELVQDTL+    
Sbjct: 123 RGRKVGAVSRSSRTANLGKKGGYDKEISKGLLWVSADVHPNVKPENYIELVQDTLEQYNS 182

Query: 180 SXXXXXXXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRR 239
           S                        S+     +   ++  R    H   SL+R+PS LR+
Sbjct: 183 SDYSI--------------------SERLPEDKQVLLSAFRAKKSH---SLVRKPSKLRK 219

Query: 240 SYTEFXXXXXXXXXXXSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDA 299
           SY              + +        R   +    +SL++++EEL KIS+SAGLT +DA
Sbjct: 220 SYISIESNNTPAENNDANAHRKPLGSSRDPVVST--ISLKELSEELAKISSSAGLTKDDA 277

Query: 300 ITLARTLSMAGS 311
           ITLA TL +  S
Sbjct: 278 ITLATTLWLTHS 289

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score =  181 bits (459), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (93%)

Query: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865
           LPPRKL F DVK+P+ PN+P++FTDSAFGFPLP LTVSTVIMFDHRLPINVERAIYRLSH
Sbjct: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867

Query: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901
           LKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++QV
Sbjct: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQV 903

 Score =  172 bits (437), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/399 (33%), Positives = 191/399 (47%), Gaps = 95/399 (23%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHP+VKP+N+LELVQDTLQN+QL                             E+ 
Sbjct: 205 WVPANQHPSVKPENYLELVQDTLQNLQLENGVRD-----------------------ESN 241

Query: 212 ENNTINLNRGLS--------RHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNK 263
           + NT+ L  GL+        + G  SL+RRPS LR+SYTEF             S ++  
Sbjct: 242 KENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYNLPISGNSSSLPS 301

Query: 264 VEERISKIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEG 323
                S    R VSLR+IT+ELTK+SN+AGLTD+DAITLARTLSMA ++         EG
Sbjct: 302 -----SVPTPRSVSLREITDELTKVSNNAGLTDSDAITLARTLSMASTFY--------EG 348

Query: 324 HYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXX 383
              E +   +T +A   ++ EFASNM   N++  P RSSLRRS+FNTYRIR         
Sbjct: 349 SNSEKENQSNTEKA---EEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNE 405

Query: 384 XXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQ 443
                +K    E         ++E+   ++  R  +E    ++SP +I D QDIY+HY  
Sbjct: 406 FAQSNLKVSSTEE----NPQPEIEVAVEETLPRVLEEHI--LNSPSTINDMQDIYDHYDT 459

Query: 444 SSGEWE-----------QEMG---------------------IEKEAEEVPVKVRNDTVE 471
           SS E             Q+ G                     I K  + + V+ ++D+++
Sbjct: 460 SSVEESLPPQNSNYSSAQQDGDNLQDSPDSSDFSTDSSTANAILKSKQSI-VQTKSDSIQ 518

Query: 472 QDLELREGTTDMVKPSATDDNKETKRHRRRNGWTWLNNK 510
           ++          + P       + KR +++ GW+W N K
Sbjct: 519 KEF---------LSPVTESTTADVKRQKKKGGWSWFNKK 548

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 44/47 (93%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          + ++KRKSEVLIAAQSLDNE+++VKNLKRLSIGSMDLL+DPE++ + 
Sbjct: 31 TSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score =  178 bits (451), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 80/99 (80%), Positives = 88/99 (88%)

Query: 804 SILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 863
           S LPPRKLTF DV KPD  N+P++FTDSAFGFPLP++T STVIMFDHRL INVERAIYRL
Sbjct: 815 STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 874

Query: 864 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902
           SHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQV 
Sbjct: 875 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913

 Score =  162 bits (411), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 163/316 (51%), Gaps = 84/316 (26%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPA+QHPNVKP+N+LEL+QDTLQNIQ+S                            ENK
Sbjct: 213 WVPADQHPNVKPENYLELIQDTLQNIQISTNQDID----------------------ENK 250

Query: 212 ---ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERI 268
               NN +  NR   R G  S++RRPS L+ SYT+F              E   +V++RI
Sbjct: 251 LELGNNHVISNR--KRTG--SVVRRPSRLKTSYTKFDDEPPLADK---PQEGEIQVDKRI 303

Query: 269 SK--IKE-RPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHY 325
           S   IK  R VSL++ITEELTKISN+AGLTD+DA+TLAR+LSM+GS+++       E  +
Sbjct: 304 SSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN-------ESLH 356

Query: 326 DEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXX 385
             G+        +T +D EFASNM     +T PERSSLRRS+FNTY+IR           
Sbjct: 357 LNGN--------HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVK 408

Query: 386 XXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSP----------GSIGDFQ 435
              + N                         Q +++  + SSP           S+ DF 
Sbjct: 409 LNSLMN------------------------IQTNDNRRSASSPASYTQVPQEQASLNDFH 444

Query: 436 DIYNHYRQSSGEWEQE 451
           +I++HYR++S +W  E
Sbjct: 445 EIFDHYRRTSTDWSTE 460

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 41/43 (95%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K
Sbjct: 46 EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFK 88

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  177 bits (450), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 90/170 (52%), Positives = 119/170 (70%), Gaps = 17/170 (10%)

Query: 737 QHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPV--QNSAPVQTSAPVEASAQTQX 794
           + S  V+K +T +   QL+ P Q++  +   VQ S+PV  +++A +   AP         
Sbjct: 755 KQSASVEKADT-QPVIQLEEPFQQKQASRKDVQDSSPVDIEDNAGIDPMAPAAGGY---- 809

Query: 795 XXXXXLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPI 854
                      LPPRKLTF+DV KP++PNSP++F+DS+FGFPLP LT+STV+M DHRL I
Sbjct: 810 ----------TLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTI 859

Query: 855 NVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHD 904
           NVERAIYRLSHLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q+  D
Sbjct: 860 NVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEED 909

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 116/314 (36%), Positives = 147/314 (46%), Gaps = 48/314 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPNVKP+N+LELVQDTL  + +                       + +  Y   
Sbjct: 176 WVPANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTV-----------EGNNPYLAS 224

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
            N   + +  L R G  SL+RRPS LR+SYTE            S     N   E  + I
Sbjct: 225 ANTKASPSSQL-RSGQNSLVRRPSGLRKSYTELEDLLQHEIQD-SDENNENAQSELNNII 282

Query: 272 KERP------VSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHY 325
           K RP       SL+DITEELT+ISN AG TD DA+ LARTLSMA SY  ++ Q     + 
Sbjct: 283 KNRPRATSSGSSLKDITEELTRISNKAGFTDGDAVCLARTLSMASSYDGEQSQANQSANT 342

Query: 326 DEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXX 385
           D               D E+AS +   N +  P RSSLRRS+FNTYRIR           
Sbjct: 343 DH------------TPDSEYASTILTKNGLAIPARSSLRRSKFNTYRIRTPNGSSVTSSS 390

Query: 386 XXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSS 445
                  +EER            DP         E S+ + SP S+ DF +IY+HYRQ S
Sbjct: 391 LRSTSLPNEERK-----------DPEG-----YIEKSDRLRSPTSVNDFNEIYDHYRQGS 434

Query: 446 -GEWEQEMGIEKEA 458
            G   +   ++ +A
Sbjct: 435 VGSTSEPHAVDNDA 448

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 51/70 (72%), Gaps = 6/70 (8%)

Query: 4  RDNESMLRTTSSDKAIA------SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDL 57
          RD+ + L     D++++      ++ +KRKSEVLIAAQSLD+E++ VKNLKR+S GSMDL
Sbjct: 5  RDHRASLNNDMRDQSVSGNTRRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDL 64

Query: 58 LIDPELDIKF 67
           +DPE++ + 
Sbjct: 65 PLDPEMEFRM 74

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
           (ZDS1)
          Length = 1018

 Score =  177 bits (450), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%)

Query: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865
           LPPRKL F DV +P+KPNSP++FT SAFGFPLP LTVSTVIMFDHRLPI VERAIYRLSH
Sbjct: 896 LPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSH 955

Query: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDK 905
           LKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q+  DK
Sbjct: 956 LKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDK 995

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 138/296 (46%), Gaps = 46/296 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WV A+QHPNVKP+N+LELV DTL N+++                               +
Sbjct: 234 WVRADQHPNVKPENYLELVHDTLNNLRIGARHGRGDSPV--------------------Q 273

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
           ++NT   N   S     SL+R+ S LR+S+TE              SE       R+S  
Sbjct: 274 QSNTPVANGESSTASARSLVRKQSRLRKSFTEVEAIEESQFTDSIGSEIPVGKRMRVS-- 331

Query: 272 KERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIG 331
                SL++ITEELT+ISN+AGLTD+DAITLARTL +    +D+         + E    
Sbjct: 332 -----SLKEITEELTRISNNAGLTDSDAITLARTLGIGSQSADE------HATFSE---C 377

Query: 332 FSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXMKN 391
             +++A   ++ E+AS++   N +  P RSSLRRS+F TYRIR                +
Sbjct: 378 VPSAEA---EENEYASSILAKNGLAIPARSSLRRSKFTTYRIRSAGSDSSPPENKSTSSS 434

Query: 392 DDEERLKLTKNTIKVEIDPHKSPFRQQDE--DSENMS-SPGSIGDFQDIYNHYRQS 444
                 +    + K++    K+ F+        EN S +P S     DIY+HY  S
Sbjct: 435 SLAAAYERNSRSPKMQ----KAAFKGSHPRLSGENTSLAPQSPNSINDIYDHYNTS 486

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 42/45 (93%)

Query: 23  RDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
           ++KRKSEVLIAAQSLD E+++VKNLKR+SIGSMDLL+DPE++ + 
Sbjct: 70  KEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRM 114

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
           Anc_8.831 YMR273C
          Length = 1049

 Score =  177 bits (448), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 78/98 (79%), Positives = 88/98 (89%)

Query: 804 SILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 863
           S LP RKLTF DV KP++PN P++FTDSAFGFPLP LT STVIMFDHRLP+NVERAIYRL
Sbjct: 883 SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRL 942

Query: 864 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901
           SHLKLS+ KR LREQ+LLSNFMYAYL+LVNH+LY+EQ 
Sbjct: 943 SHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQA 980

 Score =  126 bits (316), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 143/287 (49%), Gaps = 42/287 (14%)

Query: 111 RGNSGIESSNKTKQGNYLGIKKGVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNFLELV 170
           RG SG+ S N+   GN   +K  + +  +            WVPAN+HP VKP+N++EL+
Sbjct: 173 RGLSGVHSLNR---GNSKQLKPKIQNK-QTETEDQITQNLLWVPANKHPGVKPENYVELL 228

Query: 171 QDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRHGNASL 230
           QDTLQNI L+                      +E      +   + +LNR      ++SL
Sbjct: 229 QDTLQNINLNLNETQNNVEDTSNKTSDKMVMDRE---VIRRRRISQDLNRN-----HSSL 280

Query: 231 IRRPSTLRRSYTE----FXXXXXXXXXXXSASE-------------TVNKVEERISKIKE 273
           +RRP+ LR SY+E    F           S  E             T++   +   ++ +
Sbjct: 281 VRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGK 340

Query: 274 RPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKD------QPQPEGHYDE 327
              SL+DITEELTKISN AGL+++DAI+LAR+LS+AGS S   +      Q   +G+ D 
Sbjct: 341 NYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDN 400

Query: 328 GDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR 374
                  S+A       +ASN+ + N +T P R SLRRS+FNTY+IR
Sbjct: 401 KPRSSEVSEAG------YASNILVRNGITMPTR-SLRRSKFNTYKIR 440

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELD 64
          +KRKS VLIAAQSLD E+++VK LKRLS+GSMDLL+DPE +
Sbjct: 15 EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFE 55

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score =  173 bits (438), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 77/99 (77%), Positives = 88/99 (88%)

Query: 804 SILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 863
           SIL P+KLTF DV  P+ PN+P++FTDSAFGFPLP++T STVIMFDHRL INVERAIYRL
Sbjct: 855 SILLPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 914

Query: 864 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902
           SHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQ+ 
Sbjct: 915 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQIG 953

 Score =  161 bits (408), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 115/313 (36%), Positives = 159/313 (50%), Gaps = 79/313 (25%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPA+QHPNVKP+N+LELVQDTLQNIQ++                         Q  + K
Sbjct: 251 WVPASQHPNVKPENYLELVQDTLQNIQITT-----------------------DQDPDEK 287

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
            ++  N +   +R  + S++RRPS L+ SYT+F                  + E+RIS +
Sbjct: 288 NSDLSNNHVFSNRQRSGSIVRRPSHLKTSYTKFDDEPSSVDRQRQGH---GQAEKRISSL 344

Query: 272 KE---RPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEG 328
           +    R VSL++ITEELTKIS++AGLTD+DAITLAR+LSM+GS++++             
Sbjct: 345 ETKSIRCVSLKEITEELTKISDNAGLTDSDAITLARSLSMSGSFTNE------------- 391

Query: 329 DIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXX 388
                 S   T  D EFASNM   + +T PER SLRRS+FNTY+IR              
Sbjct: 392 --SLHLSSNKTDSDNEFASNMFNKSGLTIPER-SLRRSKFNTYKIR-------------- 434

Query: 389 MKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGS----------IGDFQDIY 438
                     L  N +     P+     Q ++D    SSP S          + DFQ+I+
Sbjct: 435 ----------LENNDLLPTGRPNSLMNVQTNDDRRRASSPASYTQPPQDQTPLNDFQEIF 484

Query: 439 NHYRQSSGEWEQE 451
            HYR++S +W  E
Sbjct: 485 EHYRRTSTDWGTE 497

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          +KRKS+VLIAA+SLD EI+ VKNLKRLSIGSMDL+IDPEL+ K
Sbjct: 51 EKRKSDVLIAAKSLDTEIQHVKNLKRLSIGSMDLVIDPELEFK 93

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  172 bits (436), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%)

Query: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865
           LPPR+LTF DV +P+KPNSP++FT SAFGFPLP LT+STVIMFDHRLPI  ERAIYRLSH
Sbjct: 791 LPPRELTFDDVIRPEKPNSPMKFTPSAFGFPLPPLTISTVIMFDHRLPIYAERAIYRLSH 850

Query: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDK 905
           LKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q+  +K
Sbjct: 851 LKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEEK 890

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 127/224 (56%), Gaps = 37/224 (16%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPA+QHPNVK +N+LELV DTL N+QL                         + +Y+  
Sbjct: 131 WVPADQHPNVKLENYLELVTDTLHNLQL---------------VGREQLEKNPNSNYQLS 175

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
           + N+ + +  +      SL+R+PS LR+S+TE            ++ E +N  E  ISK 
Sbjct: 176 QTNSTSAHEAIPSKN--SLVRKPSRLRKSFTE-----AENIDDPNSDEDLN-TETPISK- 226

Query: 272 KERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAG-SYSDKKDQPQPEGHYDEGDI 330
           ++R  SL++ITEELT+ISN+AGLTD+DAITLARTL +   + +D+++       +   D+
Sbjct: 227 RKRVSSLKEITEELTRISNNAGLTDSDAITLARTLGIGTPAATDRRN-------FTNTDV 279

Query: 331 GFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR 374
                 +N   D E+ASN+   N ++  + SSLRRS+F TYRIR
Sbjct: 280 A-----SNDEIDEEYASNILTKNGLSISQGSSLRRSKFATYRIR 318

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score =  172 bits (437), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 86/97 (88%)

Query: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865
           L PRKLTF DV KP  PN+P++FTDSAFGFPLP++T STVIMFDHRL INVERAIYRLSH
Sbjct: 824 LIPRKLTFGDVVKPKYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 883

Query: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902
           LKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQ+ 
Sbjct: 884 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMG 920

 Score =  169 bits (428), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 163/317 (51%), Gaps = 78/317 (24%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPNVKP+N+LEL+QDTLQNIQ+S                         +S    
Sbjct: 213 WVPANQHPNVKPENYLELIQDTLQNIQISTDEDS-------------------GESTLEV 253

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERI--S 269
            NN + LNR  S     S++RRPS L+ SYT+F              E VNK   RI  S
Sbjct: 254 GNNHVILNRKSS----GSIVRRPSRLKTSYTKFDDEISVADKPEVGQEQVNK---RIPSS 306

Query: 270 KIKE-RPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEG 328
           +++  R VSL++ITEELTKISN+AGLT ++A+TLAR+LSM+GS++++             
Sbjct: 307 EVRTIRSVSLKEITEELTKISNNAGLTGSNAVTLARSLSMSGSFTNE------------- 353

Query: 329 DIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXX 388
           ++   ++ A   +D EFASNM   +  T PERSSLRRS+FNTY+IR              
Sbjct: 354 NLLLKSNDAE--NDSEFASNMFNESGRTIPERSSLRRSKFNTYKIRLEGSGLPQAANLKN 411

Query: 389 MKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSP----------GSIGDFQDIY 438
           + N                        R  D D  + SSP          GS+ DFQ+I+
Sbjct: 412 LMN-----------------------MRTSD-DRRSTSSPACYARLPQEQGSLNDFQEIF 447

Query: 439 NHYRQSSGEWEQEMGIE 455
           +HYR++S +W  +   E
Sbjct: 448 DHYRRTSTDWSTDWSTE 464

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/43 (76%), Positives = 40/43 (93%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          +KRKS+V IAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K
Sbjct: 47 EKRKSDVFIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFK 89

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score =  168 bits (426), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 76/99 (76%), Positives = 86/99 (86%)

Query: 804 SILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 863
           S L PRKL F DV KP+ PN+P++FTDSAFGFPLP++  STVIMFDHRL INVERAIYRL
Sbjct: 821 STLLPRKLIFEDVIKPEYPNAPIKFTDSAFGFPLPMIANSTVIMFDHRLNINVERAIYRL 880

Query: 864 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902
           SHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQ+ 
Sbjct: 881 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMG 919

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 112/303 (36%), Positives = 159/303 (52%), Gaps = 58/303 (19%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPNVKP+N+LEL+QDTLQNIQ+S                         Q ++  
Sbjct: 217 WVPANQHPNVKPENYLELIQDTLQNIQISV-----------------------DQEFDES 253

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERI--S 269
           +    N +   +R  + S++R PS L+ SY++F              E V +   RI  S
Sbjct: 254 KLELGNNHAFPNRQRSGSIVRNPSRLKTSYSKFDDEPSLAGQPQQEQEQVER---RIPSS 310

Query: 270 KIKE-RPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEG 328
           + K  R VSL++ITEELTKISN+AGLTD+DA+TLAR+LSM+GS++              G
Sbjct: 311 EFKSMRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFT-------------SG 357

Query: 329 DIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXX 388
           ++  S + A   +D EFASNM        PERSSLRRS+FNTY+IR              
Sbjct: 358 NLHLSNNNAE--NDNEFASNMFNEIGGGIPERSSLRRSKFNTYKIRLEGSGLSQASRPNS 415

Query: 389 MKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGEW 448
           + +     +++++      +    +   QQ          GS+ DFQ+I++HYR++S EW
Sbjct: 416 LMS-----IQISEGRRSASLPASYAQLPQQQ---------GSLNDFQEIFDHYRKTSTEW 461

Query: 449 EQE 451
             E
Sbjct: 462 GTE 464

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (90%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+ DPEL+ K 
Sbjct: 51 EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVFDPELEFKL 94

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109W ZDS2 Protein that interacts with silencing
           proteins at the telomere involved in transcriptional
           silencing paralog of Zds1p
          Length = 1211

 Score =  169 bits (427), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 110/235 (46%), Positives = 134/235 (57%), Gaps = 23/235 (9%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPNVKP+N+LELVQDTL NI+L                              NK
Sbjct: 241 WVPANQHPNVKPENYLELVQDTLHNIRLEGNEDEQTGNDMNTTTAKVEHGT-------NK 293

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASE--TVNKVEER-- 267
           EN     ++G     N SL+R+PS LR+SYTEF             S+  +   VE+   
Sbjct: 294 ENE----DKGYLPRKNNSLVRKPSRLRKSYTEFDEENDDYLDTSGFSKKRSSEDVEDASN 349

Query: 268 --ISKI-KERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSY-SDKKDQPQPEG 323
             IS     R VSLRDIT+ELTKISN+AGLTD+DAITLARTLSMAGS+ SD+ D      
Sbjct: 350 LTISSTNSSRAVSLRDITDELTKISNNAGLTDSDAITLARTLSMAGSFTSDEPDDIIENS 409

Query: 324 HYDEGDIGFSTSQANTL----DDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR 374
              +GD     ++A+ +    DD EFASNM + N    P RSSLRRS+FNTYR+R
Sbjct: 410 RGTQGDDLQYYNEADAMEKKEDDAEFASNMFMKNGFVIPARSSLRRSKFNTYRVR 464

 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 43/44 (97%)

Query: 23 RDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          ++KRKSEV+IAAQSLDNE++SVKNLKR+SIGSMD+L+DPEL+ +
Sbjct: 55 KEKRKSEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYR 98

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%)

Query: 412 KSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKE 457
           KSP +   ED  N++SP +I DFQDIY+HYRQSS +WE+E+  E++
Sbjct: 557 KSPSQFIGEDGSNLTSPSTISDFQDIYDHYRQSSVDWEKELKKERD 602

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  167 bits (424), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 78/99 (78%), Positives = 87/99 (87%), Gaps = 2/99 (2%)

Query: 808  PRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLK 867
            P KL+F+DVK+ DKPN  + FTDSAFGFPLPLLT STVIMFD+RLPI+VERAIYRLSHLK
Sbjct: 968  PHKLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRLPISVERAIYRLSHLK 1027

Query: 868  LSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA--HD 904
            LS  KR LR+QVLLSNFMYAYL+LVNHTLYME+ A  HD
Sbjct: 1028 LSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEKYAKSHD 1066

 Score =  107 bits (267), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 117/249 (46%), Gaps = 50/249 (20%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPA+QHPN KP N   + QD+L N  L                       + ++SY N 
Sbjct: 161 WVPASQHPNAKPKN---INQDSLLNNGL---------VQDSNSDLDTQEELQRNKSYLN- 207

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVN--------- 262
                      SR  N SL+R+PSTLR+SYT+F            A+ + N         
Sbjct: 208 -----------SRRKNNSLVRKPSTLRKSYTDFTDDDSDYNRSREANTSNNSRNTSDNEM 256

Query: 263 ---KVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDK---- 315
              K     S   +   SL DI EEL+KISNSAGLT+ +A TLAR+LS+ G Y ++    
Sbjct: 257 NNLKASHGNSPSADSTFSLNDIKEELSKISNSAGLTETNAATLARSLSITGKYINRELLE 316

Query: 316 KDQPQPEGHYDEGDIGFSTS--QANTLD--------DGEFASNMPINNTMTWPERSSLRR 365
           +D        +      +TS    +TL         DGEFAS++ +   +  P RSSLRR
Sbjct: 317 EDDEASTSDDNNDANDINTSIEDKSTLKQIPDLNEVDGEFASHILLTKNVNVPVRSSLRR 376

Query: 366 SRFNTYRIR 374
            +FNTYR+R
Sbjct: 377 KKFNTYRVR 385

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (82%)

Query: 26 RKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          R+ E+LIAAQ+LD E++SVK LKR SIGS DL+ DPEL+ +
Sbjct: 36 REDELLIAAQTLDFEVQSVKELKRFSIGSNDLVGDPELEFR 76

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 47/118 (39%), Gaps = 44/118 (37%)

Query: 433 DFQDIYNHYRQSSGEWEQEMGI--EKEAEEVPVKVRNDTVEQDLELREGT---------- 480
           D QDIYNHYRQ S + E+ +     K+ EE   K     VE D     G+          
Sbjct: 505 DIQDIYNHYRQPSSDDEEILKYLKSKDNEETTHK----EVETDFSHSSGSQESINISSSP 560

Query: 481 ---TDMVKP------------------------SATDDNKETKRHR-RRNGWTWLNNK 510
              T +  P                        S  D   +++RH+ +R+GW+W++N+
Sbjct: 561 SPETIVTVPDNSIAGLNTNAISNSNISTLKSTISNIDSKLQSRRHKHKRHGWSWVSNQ 618

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 828

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/99 (74%), Positives = 86/99 (86%)

Query: 808 PRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLK 867
           P+KLTF DVKKP++ N+P++FTDSAFGFPLP LT+STVIM DHRL INVERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 868 LSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKE 906
           LS + R LR+QVLLSNFMYAYLNLV HTL +E+   DK+
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQ 794

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 173/389 (44%), Gaps = 71/389 (18%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLI--------------DPELDIKFXX 69
           D   SE L AAQSLD E+++VKNLKRLSIGS+DL+               D   D     
Sbjct: 17  DGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSN 76

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSNKTKQG---- 125
                                   ++ TR    T  +N         ESSN++ +G    
Sbjct: 77  GSFTEEDDTTTEIDGSDADETSASIDRTRVEYLTSYDNTQ-------ESSNESPKGVART 129

Query: 126 -----NY-------LGIKKGVHSPSRX--------XXXXXXXXXXXWVPANQHPNVKPDN 165
                NY       + IK+     SR                    WVPANQHPNVKP+N
Sbjct: 130 RSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNVKPEN 189

Query: 166 FLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRH 225
           +LELV++TL  I+                           +   NKEN  IN N  L   
Sbjct: 190 YLELVKETLNKIR------------DINTDGKEKSENNSEEEVSNKEN--INENGRL--- 232

Query: 226 GNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKIKERPVSLRDITEEL 285
              S++RRPS LR+SYTEF            ++   N++    +    + +SL++IT EL
Sbjct: 233 -RGSIVRRPSKLRKSYTEFSSEDLELLDKALSN---NRIISTRNTTNSKRLSLKEITNEL 288

Query: 286 TKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEF 345
            K SN AGLTD++A+TLARTLS+A S +++ +     G  D+ +      Q+   DD  F
Sbjct: 289 VKHSNKAGLTDDNAVTLARTLSIASSVTNQNET----GRNDQSNTE-QQKQSEDADDDTF 343

Query: 346 ASNMPINNTMTWPERSSLRRSRFNTYRIR 374
           A+ +  N+       SSLRRS+FNTYR++
Sbjct: 344 ATAVVGNSHSLASNTSSLRRSKFNTYRVK 372

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  161 bits (407), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%)

Query: 803  TSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYR 862
            TS LP RKLTFADV    + N PVQF DS FGFPLPLLT ST+IMF++RLPI+VERAIYR
Sbjct: 935  TSTLPLRKLTFADVPPTGRANGPVQFMDSTFGFPLPLLTRSTIIMFENRLPISVERAIYR 994

Query: 863  LSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902
            LSHLKL ++K+ LR+QVLLSNFMYAYL+LVNH+LY+EQ  
Sbjct: 995  LSHLKLGDTKKELRQQVLLSNFMYAYLHLVNHSLYLEQYG 1034

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 139/515 (26%), Positives = 202/515 (39%), Gaps = 133/515 (25%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFXXXXXXXXXXXXXXXX 83
           + R   +L A Q LD EI++V +LKR SIGSMD+LIDPEL+ +                 
Sbjct: 12  ESRNPAMLKAVQYLDREIKNVNHLKRFSIGSMDMLIDPELEYRISNTVTKDIESEKPKRR 71

Query: 84  XXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSN-----------------KTKQG- 125
                     +N    SD  P +      N GI  SN                  T+Q  
Sbjct: 72  SVLL------LNTFASSDDVPTKAHSKAPNIGIMQSNIDYSNDLVNMSIQRRRSSTRQFP 125

Query: 126 NYLGIKKGVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXX 185
            +   K+ V  P              WV A+QHPNV P   L  V   L+N+ +      
Sbjct: 126 TFSKYKESV--PVYNEEKVDSTNAVKWVRADQHPNVSPSKQLNEV---LENLHI------ 174

Query: 186 XXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRSYTE-- 243
                             E +    K+  +I   +  S     S++RRPS LR S  +  
Sbjct: 175 ------------------EDKQVTKKDRLSITYKKNKS-----SIVRRPSKLRHSSNDES 211

Query: 244 ---------FXXXXXXXXXXXSASETVN-KVEERISKIKERP-----------VSLRDIT 282
                    F            +S + N + +  I++   R            +SL++IT
Sbjct: 212 FDSDIEDPSFTKDHDTFSFENESSFSTNDQTDISITRFDSRDTINSNGNSNHRLSLKNIT 271

Query: 283 EELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQAN---- 338
           +ELT+ISN AGL D+DAI LA++L +  SY     Q      YD+ ++    S  N    
Sbjct: 272 DELTRISNDAGLVDSDAINLAQSLGLTSSY-----QNNINDFYDDKNLAIYDSTINESSN 326

Query: 339 --TLDDGEFASNMPINNT---------MTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXX 387
             T ++ +   N+   N+         M  P RSSLRRS+FNTYR               
Sbjct: 327 METFNEQDKILNLNSENSKGGTFAVNGMKVPMRSSLRRSKFNTYRYSRNNQKDSDIPEKK 386

Query: 388 XMKND-------DEERLKLTKNTIKVEIDPHK----SPFRQQDE---------------- 420
            ++N         EE+  +T+  I+V +  ++    SP R  D+                
Sbjct: 387 EIENPYMGSQHISEEKSDVTE--IQVALSNNQNALVSPERNNDKISFKDSQKDYLTKPIE 444

Query: 421 ---DSENMSSPGSIGDFQDIYNHYRQSSGEWEQEM 452
              D++  S    + DFQDIY+HYRQ S EWE E+
Sbjct: 445 EKADADEQSGSSPVSDFQDIYDHYRQPSSEWEDEI 479

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 10/15 (66%), Positives = 10/15 (66%)

Query: 496 KRHRRRNGWTWLNNK 510
           K H RR GW W NNK
Sbjct: 611 KHHYRRGGWAWFNNK 625

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  154 bits (389), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 72/94 (76%), Positives = 82/94 (87%)

Query: 810  KLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLS 869
            KLTFADVK+  +PNS + F +SAFGFPLP LT ST+IM D+RLPINVERAIYRLSHLKLS
Sbjct: 1430 KLTFADVKRNLQPNSSMIFQESAFGFPLPPLTNSTIIMIDNRLPINVERAIYRLSHLKLS 1489

Query: 870  NSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAH 903
            + KR LREQVLLSNFMY+YL+LVNHTLY+EQV  
Sbjct: 1490 DPKRELREQVLLSNFMYSYLHLVNHTLYLEQVTQ 1523

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 150/352 (42%), Gaps = 56/352 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           W   N+  ++KPDN++ELV D +                            ++  SY + 
Sbjct: 370 WSSVNKRSSLKPDNYIELVNDAIN---------SSNNVSVTTNSTPTANKIEQGDSYYDN 420

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
               I  +R +    N++ +RRPS+LR SYT+            + S   N ++E  +  
Sbjct: 421 ----IPDSRKVKYRRNSN-VRRPSSLRNSYTDLDFNLADYEDNLNISNVSNSIDEVSNND 475

Query: 272 KERP-------------------VSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSY 312
            +                     ++L+D+T+ELTK+SN+AGLTD+DAITLA+TLS+    
Sbjct: 476 HQLTPDDSFNFDANVTNNSVASNLTLKDLTDELTKLSNNAGLTDSDAITLAKTLSLNERL 535

Query: 313 SDKKDQPQPEG---HYDEGDIGFSTSQANTL-------------DDGEFASNMPINNTMT 356
            D             Y    I                       DD E+ASN+  ++ + 
Sbjct: 536 LDNTTTVNSNTNVKRYKSNKINLFNEDNINNIPNNMNQDEEIVEDDKEYASNLNYDDNIN 595

Query: 357 WPERSSLRRSRFNTYRIRXXXXXXXX-XXXXXXMKNDDEERLK---LTKNTIKV--EIDP 410
              RS+L+R++F +   R               +K D    +    ++K+TI V   ID 
Sbjct: 596 ISNRSTLKRNKFKSATSRGNSSEESNLQLDLETIKRDPSNNMPNIIISKSTIDVNDSIDN 655

Query: 411 HKSPFRQQDEDSENMSSPGSIG-DFQDIYNHYRQSSGEWEQEMGIEKEAEEV 461
            +S  ++  + +E +++  ++     +IY+HYRQ+SG+W  ++   +E  +V
Sbjct: 656 AESNNKKFLDSNEMLNNQLNVSPSASEIYDHYRQTSGDWTDDLNKAREQFQV 707

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 41/55 (74%)

Query: 11 RTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDI 65
          R+ S ++     R KR S+V IAAQSLD ++++VK LKR SIGS+DLL DP+L++
Sbjct: 20 RSKSQNRKSLLDRQKRNSDVRIAAQSLDLQVQNVKKLKRQSIGSIDLLADPDLEL 74

>Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [222
           bp, 74 aa] {ON} YMR273C (REAL)
          Length = 74

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 45/79 (56%), Gaps = 7/79 (8%)

Query: 232 RRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKIKERPV--SLRDITEELTKIS 289
           RR STLR SYTEF             S+ VNKVEER S+I+E     +L++      KIS
Sbjct: 1   RRSSTLRSSYTEFDDIEDENGQRNKDSKFVNKVEERTSRIRENECHETLKN-----KKIS 55

Query: 290 NSAGLTDNDAITLARTLSM 308
           NSA LTD   I L RTLS+
Sbjct: 56  NSASLTDIGVIALVRTLSI 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,775,512
Number of extensions: 3049627
Number of successful extensions: 11342
Number of sequences better than 10.0: 101
Number of HSP's gapped: 11448
Number of HSP's successfully gapped: 193
Length of query: 915
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 796
Effective length of database: 39,836,145
Effective search space: 31709571420
Effective search space used: 31709571420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 70 (31.6 bits)