Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR238W (DFG5)8.773ON45845824520.0
Suva_13.4228.773ON45845822480.0
Smik_13.4468.773ON45845822480.0
Skud_13.4078.773ON45845822270.0
NDAI0K008408.773ON45945118950.0
CAGL0M05049g8.773ON45345318450.0
Kpol_1030.208.773ON45145018340.0
SAKL0B05412g8.773ON45144918340.0
NCAS0C008108.773ON45145118330.0
KAFR0B034908.773ON45145318170.0
TDEL0B033608.773ON43643417890.0
TBLA0B033208.773ON45045117860.0
TPHA0J016008.773ON46144517140.0
KLLA0F24926g8.773ON45145117100.0
Kwal_55.202668.773ON45746217080.0
KNAG0J007008.773ON46343917070.0
KLTH0E04048g8.773ON45444316820.0
ZYRO0F12210g8.773ON45345316450.0
AFR530W8.773ON45943715420.0
Ecym_14748.773ON45445115290.0
NCAS0A08740singletonON43439914900.0
ACL200WsingletonON46343514690.0
ACL201WsingletonON44843514480.0
NCAS0A08730singletonON63138714210.0
TBLA0C03850singletonON56738213890.0
ACL202WsingletonON45039613390.0
KLTH0D08008g2.570ON44843813051e-178
SAKL0D13574g2.570ON45145113031e-177
KLLA0E07723g2.570ON45045212971e-177
Suva_11.1802.570ON45044912641e-172
YKL046C (DCW1)2.570ON44945812591e-171
Smik_11.2022.570ON44945312581e-171
TPHA0I024702.570ON45245112551e-170
NDAI0B015102.570ON44745112541e-170
Kwal_26.82252.570ON44944912491e-169
Skud_11.1832.570ON44944912461e-169
NDAI0C006802.570ON45245012381e-168
KAFR0I017402.570ON44845912351e-167
NCAS0H029002.570ON45345512161e-164
NCAS0A127502.570ON44744912051e-163
KAFR0A021702.570ON44943512021e-162
TBLA0H02580singletonON44944211961e-161
TBLA0H02590singletonON45045311941e-161
CAGL0L01727g2.570ON44644911681e-157
TDEL0B065802.570ON44745011601e-156
ABR060W2.570ON45143411481e-154
TBLA0H026002.570ON44943511391e-153
Kpol_1056.42.570ON45042911381e-152
KNAG0A071802.570ON46340611211e-150
ZYRO0E06380g2.570ON45344711201e-150
Ecym_45772.570ON45043511181e-149
KAFR0B046902.317ON138049689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR238W
         (458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   949   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   870   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   870   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   862   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   734   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   715   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   711   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   711   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   710   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   704   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   693   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   692   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   664   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   663   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   662   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   662   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   652   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   638   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   598   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   593   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            578   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   570   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   562   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            551   0.0  
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              539   0.0  
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   520   0.0  
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   507   e-178
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   506   e-177
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   504   e-177
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   491   e-172
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   489   e-171
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   489   e-171
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   488   e-170
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   487   e-170
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   485   e-169
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   484   e-169
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   481   e-168
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   480   e-167
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    473   e-164
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   468   e-163
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   467   e-162
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   465   e-161
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   464   e-161
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   454   e-157
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   451   e-156
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   446   e-154
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   443   e-153
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   442   e-152
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            436   e-150
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   436   e-150
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   435   e-149
KAFR0B04690 Chr2 complement(977296..981438) [4143 bp, 1380 aa] {...    31   9.4  

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  949 bits (2452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/458 (100%), Positives = 458/458 (100%)

Query: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60
           MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT
Sbjct: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360
           ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG
Sbjct: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360

Query: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST
Sbjct: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF
Sbjct: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/458 (90%), Positives = 438/458 (95%)

Query: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60
           MIV  S K+ L +CFT LSFFKAT AMDLDTTS TSICDATALIQ GMLDYYEGTRYGGT
Sbjct: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120
           VGMFQSPYYWWHAGEAFGGM+ENW+LC+NDTYQ LLYDALLAQTG++YDYIP+NQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFT+P +G PGWLAMVQAVFNTMYSRWDSE+CGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNT+SNACLFQIAARLGRYTGNTTYL+VAEQVFDWLVDVGYVVLNDTANV+DGA
Sbjct: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300
           EIDTNCTDITKIEWTYNHGIVLGG+AYMYNATNGT EW+TSL ++LNGA SYFFKD IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY 300

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360
           ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFT DTID LIKTSAEAAAKSC+GGTDG
Sbjct: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360

Query: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGL+W+K+TNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST
Sbjct: 361 HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           T+VLQNNLNI KGDRAGAAIITAVILSVL GGAVWMLF
Sbjct: 421 TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/458 (93%), Positives = 439/458 (95%)

Query: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60
           MI+  S +MI  ICFT LSFF+  HAM+LD+TSKTSICDATALIQ GMLDYYEGTRYGG 
Sbjct: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIP+NQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDP DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNT+SNACLFQIAARLGRYTGNTTYL+VAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGT EWETSLTKILNGAKSYFFKDSIMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360
           ESACQDY TCNTDQRTFKSIFSRMLGLTSVMAP+T DTIDDLIKTSAEAAAKSC+GG DG
Sbjct: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360

Query: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGLNW KQTNDGYYGLGEQM+ALEVIQNLLIHDRPAPYKE NGGTSKGDANAGMNSST
Sbjct: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           TNVLQNNLNIK GDRAGAAIITA+ILSVL GGAVWMLF
Sbjct: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/458 (92%), Positives = 439/458 (95%)

Query: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60
           MIV+ S +MI  ICFTFLSF   +HAMDLDTTSKTSICDATALIQ GMLDYY+GTRYGG 
Sbjct: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCEN+TYQELLYDALLAQTGSNYDYIP+NQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDP +GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNTVSNACLFQIAARLGRYTGN+TYL+VAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGT EWET LT+ILNGAK+YFFKD+IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360
           ESACQDY TCNTDQRTFKSIFSRMLGLTSVMAPFT DTIDDLIKTSAEAAAKSCNGGTDG
Sbjct: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360

Query: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGL+W KQT+DGYYGLGEQMSALEVIQNLLIHDRPAPYKE NGGTSKGDANAGMNSST
Sbjct: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           TNVLQNNLNI KG RAGAAIITA+ILSVL GGAVWMLF
Sbjct: 421 TNVLQNNLNITKGGRAGAAIITAIILSVLIGGAVWMLF 458

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/451 (76%), Positives = 397/451 (88%), Gaps = 4/451 (0%)

Query: 12  SICFTFLSFFKATH---AMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68
           S+ F F       H   A+DLD TSK SICDAT+LIQGGM+DYY GT+YGGTVGMFQ PY
Sbjct: 9   SLYFHFFQLLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPY 68

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128
           YWW AGEAFGGM+ENW+LC+NDTY+++L  ALLAQTGSNYDYIP+NQ+MVEGNDDQG+WG
Sbjct: 69  YWWEAGEAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWG 128

Query: 129 ITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           +T+MGA ERNFTDP DG PGWLAM QAVFNTM +RWDS HCGGGLRWQIFTWNSGYNYKN
Sbjct: 129 LTLMGAAERNFTDPDDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKN 188

Query: 189 TVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           T+SNACLFQ+AARLGRYTGNTTYLEVAE+VF WLVDVGYV+L+DTANVFDGAEID+NCTD
Sbjct: 189 TISNACLFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTD 248

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFF-KDSIMYESACQDY 307
           +T+IEWTYNHG+VLGG AYMYNATNG+ +WE+ +TK+L GA +YFF  + IM+E+ACQ+Y
Sbjct: 249 MTQIEWTYNHGVVLGGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQEY 308

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
            TCN DQR+FKSIFSRMLGLTSV+APFT DT+D LIKTSA AAAKSC GGTDGHTCGLNW
Sbjct: 309 NTCNNDQRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNW 368

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427
            K ++DGYYGLGEQM ALEV+QNLLIHDRPAP   + GG+SKGDA AG+NS+TTNVL+N 
Sbjct: 369 AKGSHDGYYGLGEQMCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENK 428

Query: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           + I  GDRAGAAI+TA+IL VLTGGAVWM F
Sbjct: 429 MTITNGDRAGAAIVTAIILGVLTGGAVWMFF 459

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/453 (73%), Positives = 388/453 (85%), Gaps = 3/453 (0%)

Query: 8   KMILSICFTFL--SFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQ 65
           K++ S+    L  + F    A++L   +K SIC ATALIQGGMLDYYEGTRYGGTVGMFQ
Sbjct: 2   KLLFSLQLWVLIGTLFPDAGAINLQD-NKDSICAATALIQGGMLDYYEGTRYGGTVGMFQ 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQG 125
            PYYWW AG AFGGMLENWFLC+NDTY++LL +AL+AQTG NYDYIP+NQT VEGNDDQG
Sbjct: 61  PPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEGNDDQG 120

Query: 126 IWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
           +WG+T++ AVERNF+ P DGKPGWLAM Q +FNTMY+RWD + C GGLRWQIFTWNSGYN
Sbjct: 121 VWGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYN 180

Query: 186 YKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245
           YKNT+SNACLFQIAARLGRYTGNTTYL+VAE+VFDWLV VGY+VL++  NV+DGA+++ N
Sbjct: 181 YKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYIVLSEKGNVYDGAKVEDN 240

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQ 305
           CTDIT IEWTYNHG+VLGGLAYMYNATNG+  W++ LT +L GA +YFF+D IMYESACQ
Sbjct: 241 CTDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVLGGATAYFFQDDIMYESACQ 300

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365
            Y TCN DQR FKSIFSRMLG TSV+APFT DTID L+K SA AAA SC+GGTDGHTCGL
Sbjct: 301 PYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCGL 360

Query: 366 NWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQ 425
           +WQ +TNDGYYGLGEQMSALEVIQ LLIH+RPAPY+ DNGGTS GDA AG+NS+TTNVL+
Sbjct: 361 DWQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADNGGTSVGDAAAGLNSTTTNVLK 420

Query: 426 NNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           NNL I  GDRAGAAI+T ++L ++ GGA WM+F
Sbjct: 421 NNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF 453

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/450 (74%), Positives = 386/450 (85%), Gaps = 1/450 (0%)

Query: 9   MILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68
           ++L++     +F     A+DLD  SK SIC AT+LIQGGMLDYYEGTRYGGTVGMFQ PY
Sbjct: 3   LLLTVLLQAFNFITTVTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQPPY 62

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128
           YWW AGEAFGGM+ENWFLC+NDTY +++YDALLAQTGSNYDY+P+NQT VE    + ++G
Sbjct: 63  YWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-VFG 121

Query: 129 ITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
            TVM A ERNFT P DGKP WLAM QAVFNTMY+RWDS +CGGGLRWQI+TWNSGYNYKN
Sbjct: 122 GTVMDAAERNFTAPSDGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNYKN 181

Query: 189 TVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           TVSNACLFQIAARLGRYTGN TYLEVAE+VFDWLVDV +VVLND ANVFDGA I +NC+ 
Sbjct: 182 TVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNCSA 241

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYG 308
           + K+EW+YNHGIVLGGLAYMYNATNGT +WE+ LTK+LNGAKS FFK++IMYE ACQD+ 
Sbjct: 242 VVKLEWSYNHGIVLGGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQDHN 301

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQ 368
           TCNTDQR+FKSIFSRMLGLTSV+AP+T DTI  LI+ SAE AAKSC+GGTDGHTCGLNW 
Sbjct: 302 TCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGLNWN 361

Query: 369 KQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNL 428
             TNDG YGLGEQM ALE++ NLLI +RPAPY   NGGTS GD +AG+N+++T+VL NNL
Sbjct: 362 LGTNDGKYGLGEQMCALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVLSNNL 421

Query: 429 NIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           +IK+ DRAGAAI+TAVIL VL GG+VWMLF
Sbjct: 422 DIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/449 (73%), Positives = 387/449 (86%), Gaps = 2/449 (0%)

Query: 11  LSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYW 70
           L I   ++S     HA+DLDT+SK SIC AT+LIQ GMLDYYEGT+YGGTVGMFQ PYYW
Sbjct: 4   LLISLIYMSL-NIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYW 62

Query: 71  WHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGIT 130
           W AGEAFGGML+N +LC+N+TY++L+YDA++AQTG NYDYIP+NQ+MVEGNDDQG+WGIT
Sbjct: 63  WQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGIT 122

Query: 131 VMGAVERNFTDP-GDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNT 189
           +MGAVERNFT+P  +G PGWLAMVQAVFNTMY+RWDS+HCGGGLRWQIFTWNSGYNYKNT
Sbjct: 123 IMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNT 182

Query: 190 VSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDI 249
           ++N CLFQIAARLGRYTGN TYLEVA +V+DWL DVG+VVL D ANVFDGA I+ NC+ I
Sbjct: 183 IANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSI 242

Query: 250 TKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGT 309
            KIEWTYNHG+VLGG AYMYNATNG+  W+T LT++L+GA  +FF +SIMYE ACQ  GT
Sbjct: 243 VKIEWTYNHGVVLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGT 302

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQK 369
           CN DQR+FKSIFSRMLGLTSV+APFTRDTID LIK SAE AA+SC GGTDGHTCGL+W  
Sbjct: 303 CNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTL 362

Query: 370 QTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLN 429
             +DGYYGLGEQMSALE++QNLLI D P P+  DNGG+S GD NAG+NSS+ NVL+NNL+
Sbjct: 363 GHHDGYYGLGEQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLS 422

Query: 430 IKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           I   DR GAAIITA++L V+ GG+VWM+F
Sbjct: 423 ITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/451 (73%), Positives = 382/451 (84%), Gaps = 2/451 (0%)

Query: 10  ILSICFTFLSFFKA-THAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68
           +L +  +F+        ++DLD TSK SIC ATALIQ GMLDYYEG RYGG VGMFQ PY
Sbjct: 1   MLHVWISFVLLLPLLVQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPY 60

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128
           YWW+ G AFGGMLEN +LCEN+T++ LL DAL+AQTG NYDYIPSNQ+MVEGNDDQG+WG
Sbjct: 61  YWWNGGVAFGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWG 120

Query: 129 ITVMGAVERNFTDPG-DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           +T+M AVERNFT P   G PGWLAM QAVFNTMY+RWD +HCGGGLRWQIFTWNSGYNYK
Sbjct: 121 LTIMDAVERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYK 180

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NT++NACLFQ+AARLGRYTGN TYL+VAE+VFDW+VD+ Y+VLND ANVFDGA+ID NCT
Sbjct: 181 NTIANACLFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCT 240

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
           DIT +EWTYNHG+VLGG AYMYNATNG+  WET + KIL GA+ YFF+D++M ESACQ Y
Sbjct: 241 DITTLEWTYNHGVVLGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSY 300

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
            TCN DQR FKSIFSRMLG TSV+APFT +TID LIK SAEAAA SC GG DGHTCGL+W
Sbjct: 301 NTCNNDQRCFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDW 360

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427
            K +NDGYYGLGEQM+ALE++ NLLIHDRPAP   + GGTS+GDA+AG+NS+TTNVL+N 
Sbjct: 361 TKGSNDGYYGLGEQMNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENK 420

Query: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           L I +GDRAGAAI+TAVIL +  GGAVWMLF
Sbjct: 421 LKITQGDRAGAAIVTAVILGIFVGGAVWMLF 451

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/453 (73%), Positives = 385/453 (84%), Gaps = 5/453 (1%)

Query: 9   MILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68
           M++++ F  L       A+DLDT+SKTSICDATALIQ GMLDYYEG RYGGTVGMFQSPY
Sbjct: 1   MMITLLFPLL--LTVAKAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPY 58

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128
           YWW AGEAFGGMLENWFLCENDT++E++YDA+LAQTGS+YD++P NQTMVEGNDDQ +WG
Sbjct: 59  YWWEAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWG 118

Query: 129 ITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           +T+M AVERNFTDP DG PGWL M QA+FN M+SRWDS +CGGGLRWQIFTWNSGY+YK+
Sbjct: 119 LTIMDAVERNFTDPTDGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKS 178

Query: 189 TVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYV-VLNDTANVFDGAEIDTNCT 247
           T+SN CLFQ+A+RLGRYTGN TYL+VAE V+DWLVDVG++ V N TA V+DGA+I  NCT
Sbjct: 179 TISNVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCT 238

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
           DIT I+W+YNHGI+LGG AY YNATNG+  WE+ +T I+ GAKS FF D IMYESACQDY
Sbjct: 239 DITTIDWSYNHGILLGGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDY 298

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
            TCN DQR+FKSIFSRMLG TSV+APFT  TID LIK+SA A A SC+GGTDGHTCGLNW
Sbjct: 299 DTCNNDQRSFKSIFSRMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNW 358

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTT--NVLQ 425
           Q +T DG YGLGEQMSALEVIQNLLIHDRPAPY    GG+S GDA+AG+N++T+  +VL+
Sbjct: 359 QDKTCDGNYGLGEQMSALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLE 418

Query: 426 NNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           NNL I   DRAGAAIITAVIL  + GGA+WMLF
Sbjct: 419 NNLTITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/434 (75%), Positives = 377/434 (86%), Gaps = 2/434 (0%)

Query: 27  MDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWFL 86
           +DLD +SK SIC ATALIQ GMLDYYEGTR GGTVGMFQSPYYWW AGEAFGGM++NW+ 
Sbjct: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62

Query: 87  CENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGDGK 146
           CEN T++ L+YD +LAQTG +YDY+P NQTMVEGNDDQG+WG+T+MGAVERNFT+P +G 
Sbjct: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNGA 122

Query: 147 PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYT 206
           PGWLAM QA+FN + SRWD+ +CGGGLRWQIFTWN GYNYKNT+SNACLFQIAARLGRYT
Sbjct: 123 PGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYT 182

Query: 207 GNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLA 266
           GN TYLEVAE VFDWLVDVGYVVL D  NVFDGAEID NCT I K+EW+YNHG+VLGGLA
Sbjct: 183 GNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLA 242

Query: 267 YMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYG--TCNTDQRTFKSIFSRM 324
           +MYNATNG+ EWET +T+IL GA+SYFFKDSIMYES CQ  G  TCN+DQR+FK+IFSRM
Sbjct: 243 FMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRM 302

Query: 325 LGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSA 384
           LGLTSV+ P T+  +DDL+K SA AAA SC+GGTDGHTCGLNW KQ NDGYYGLGEQMSA
Sbjct: 303 LGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMSA 362

Query: 385 LEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAAIITAV 444
           LEV+Q LLIH + AP+ E  GG+S GDANAG+N+S+ NVLQN L+I+  DRAGAAIITAV
Sbjct: 363 LEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITAV 422

Query: 445 ILSVLTGGAVWMLF 458
           IL VL GG++WMLF
Sbjct: 423 ILMVLVGGSIWMLF 436

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/451 (72%), Positives = 384/451 (85%), Gaps = 2/451 (0%)

Query: 9   MILS-ICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSP 67
           MIL+ +  + LSF   T AMDLDT+SK SIC AT+LI  GMLDYY GT+YGGTVGMFQ P
Sbjct: 1   MILNELILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPP 60

Query: 68  YYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIW 127
           YYWW AGEAFGGMLENW+LC+NDTY +LL+DAL AQTG +YDYIP NQTMVEGNDDQ IW
Sbjct: 61  YYWWEAGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIW 120

Query: 128 GITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           G+TVM AVERNFT+P +G PGWLAM QAVFNTM+SRWD+  CGGGLRWQIFTWNSGY+YK
Sbjct: 121 GLTVMDAVERNFTNPTEG-PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYK 179

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NT+SNACLFQ+AARLGRYTGN TYL+VA  VFDWL  VGYV +++ A V+DGA+I  NCT
Sbjct: 180 NTISNACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENCT 239

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
           DITK +W+YN+G +LGG AYMYNATNG+  WET +T++LNGAK+YFF+D IMYESACQ  
Sbjct: 240 DITKYQWSYNNGCMLGGAAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQTA 299

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
            TCN DQR+FKS+FSRMLG TSV+ P TRD ID LI  SA+ AA++CNGGTDGHTCGLNW
Sbjct: 300 KTCNNDQRSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLNW 359

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427
           Q  T+DGYYGLGEQMSALEVIQNLLIHDRPAPY   +GG+S+GDANAG+N ++ NVL N+
Sbjct: 360 QASTHDGYYGLGEQMSALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSND 419

Query: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           L+IK GD+ GAAI+TA +L++L GGA+WMLF
Sbjct: 420 LDIKTGDKVGAAILTAGVLAILVGGAIWMLF 450

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/445 (71%), Positives = 377/445 (84%), Gaps = 13/445 (2%)

Query: 26  AMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWF 85
           A+ LD  SK S+C+ATALIQ GMLDYY+GTRYGGTVGMFQ PYYWW AGEAFGGMLENW+
Sbjct: 18  AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWY 77

Query: 86  LCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGDG 145
           LC+NDT++ L+ DAL+ Q GSNYDYIPSNQT+VEGNDDQG+WG+TV+GAVERN  D  DG
Sbjct: 78  LCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDR-DG 136

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205
            PGWLA+ QAVFNTMY+RWD+ +CGGGLRWQI+TWNSGYNYKNT+SNACLFQIAARLGRY
Sbjct: 137 VPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRY 196

Query: 206 TGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265
           TGN TYLEVAE+VFDW+VDV Y+VL D ANV+DGA  + NC+DI + EW+YNHG+VLGGL
Sbjct: 197 TGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLGGL 256

Query: 266 AYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFSRML 325
           AYMYNATNGT +WET+LT++L+GA +YFFK++IMYESACQ+  TCNTDQR+FKSIFSRML
Sbjct: 257 AYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFSRML 316

Query: 326 GLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSAL 385
           G T V+AP+T  T+D LI+TSA+AAA SC+GGTDG TCGL+W   TNDGYYGLGEQMSAL
Sbjct: 317 GYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMSAL 376

Query: 386 EVIQNLLI------------HDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKG 433
           E+I  LL+                +PY   +GG S GDA+AG+N+++TNVLQNNL+I+  
Sbjct: 377 EIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLNTTSTNVLQNNLDIESK 436

Query: 434 DRAGAAIITAVILSVLTGGAVWMLF 458
           D+AGAA+ TAVIL+VL GG+VWMLF
Sbjct: 437 DKAGAAVATAVILAVLVGGSVWMLF 461

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/451 (70%), Positives = 366/451 (81%), Gaps = 1/451 (0%)

Query: 9   MILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68
           M +S  ++      +  A+DLDT+SK+SIC ATALIQ G+ DYYEG  YGGTVGMF SPY
Sbjct: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128
           YWW AG  FGGM+ENW+LC+N +Y+++LYDAL+AQTGS+YDY+PSNQTMVEGNDDQG+W 
Sbjct: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120

Query: 129 ITVMGAVERNFTDPG-DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           +TVM AVERNFT+P  DG PGWLAMVQAVFN MYSRWDS+HC GGLRWQIFTWNSGYNYK
Sbjct: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NT+SN CLFQ+AARLGRYTGNTTYLEVAE+VFDWLVD+ +VV+ + ANVFDGA ID NCT
Sbjct: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
            I K EW+YNHG+VLGG AYMYNATNG+  W+T   +IL GA S+FF+D IMYES CQ  
Sbjct: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS 300

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
             CNTDQR FK+IFSRMLG TSV+APFT DTI  LI TSA AAAKSC+GGTDGHTCGLNW
Sbjct: 301 NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGLNW 360

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427
                DG YGLGEQ  ALE+I  LL+HD PAP  E  GG+S GDA+AG+N STTNVLQ N
Sbjct: 361 FTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQKN 420

Query: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           +NI  GD+AGA IIT ++L VL  G VWM+ 
Sbjct: 421 INITAGDKAGAGIITTIVLGVLVLGTVWMVL 451

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/462 (67%), Positives = 376/462 (81%), Gaps = 9/462 (1%)

Query: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60
           M++ + A   L   FT         A+DLDT+SK SICDAT+LIQ G++DYYEG R+GGT
Sbjct: 1   MVLQLMALGALGAVFT-----SQVSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGT 55

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120
           VGMFQ PYYWW AGE FGGM+ENWFLC+NDTY++ LYDA++AQ G +YD++PSNQ+MVEG
Sbjct: 56  VGMFQQPYYWWEAGEVFGGMMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEG 115

Query: 121 NDDQGIWGITVMGAVERNFTDPGD-GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFT 179
           NDDQG+WG+T+M AVERNFT+P + G PGWLAMVQ VFNTM+SRWDS+HCGGGLRWQIFT
Sbjct: 116 NDDQGVWGLTLMSAVERNFTNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFT 175

Query: 180 WNSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDT--ANVF 237
           WNSGYNYKNTVSNACLFQ+AARLGRYTGN TYL  AE V++WLVD+G+V  N++  ANV+
Sbjct: 176 WNSGYNYKNTVSNACLFQLAARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVY 235

Query: 238 DGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNAT-NGTGEWETSLTKILNGAKSYFFKD 296
           DGA ID NCTDI +IEW+YN GIVLGG AYMYNAT NGT +WE+ L +I+ G+   FF++
Sbjct: 236 DGATIDKNCTDIVEIEWSYNQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRN 295

Query: 297 SIMYESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNG 356
            IMYE+ CQD G CN DQR+FKSIFSRML LT  +AP+T D ID L+K SAE AAKSC G
Sbjct: 296 KIMYEATCQDSGKCNQDQRSFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTG 355

Query: 357 GTDGHTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGM 416
           GTDGHTCGLNW+K  +DG+YGLGEQ  ALE IQ+ L   RPAPY  DNGGTS GD  AG+
Sbjct: 356 GTDGHTCGLNWEKGEHDGWYGLGEQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGL 415

Query: 417 NSSTTNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           N ++TNVL ++LNI + D+ GA+IITAV+L+VL GG++WM+F
Sbjct: 416 NKTSTNVLHSDLNITQKDKVGASIITAVLLAVLVGGSIWMIF 457

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/439 (71%), Positives = 365/439 (83%), Gaps = 6/439 (1%)

Query: 21  FKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGM 80
           F    A+ LD      +C ATAL+  G+LDYY GTRYGGTVGMFQ PYYWWHAGEAFGGM
Sbjct: 30  FTGASALSLD-----PVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGM 84

Query: 81  LENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFT 140
           +ENWFLC+N TY+ LL DA +AQTG+NYDYIP NQTMVEGNDDQGIWG+T+M AVERNFT
Sbjct: 85  IENWFLCQNSTYETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFT 144

Query: 141 DP-GDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIA 199
            P  DG PGWLAM QAVFNTM++RWD++HCGGGLRWQIFTWNSGYNYKNT+SNACLF +A
Sbjct: 145 KPTKDGVPGWLAMSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLA 204

Query: 200 ARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHG 259
           ARLGRYTGN+TYL+VA+QVFDW+V VGYVVL DTANVFDGA I+ NCT IT  EW+YNHG
Sbjct: 205 ARLGRYTGNSTYLDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHG 264

Query: 260 IVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKS 319
           +VLGG A+MYNATNG+  WE  + +IL GA +YFF+DSIM+ESACQD G CN DQRTFK+
Sbjct: 265 VVLGGTAFMYNATNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFKA 324

Query: 320 IFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLG 379
           IFSRML  T+V+ P T  TID L+++SA+AAA+SC+GGTDGHTCGLNWQ    DG YGLG
Sbjct: 325 IFSRMLSFTAVLVPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLG 384

Query: 380 EQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAA 439
           EQMSALEV+  LL+HDRPAPY    GG+S GDA+AG+NS+ TNV  N+LNI+  D+AGAA
Sbjct: 385 EQMSALEVMNYLLVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGAA 444

Query: 440 IITAVILSVLTGGAVWMLF 458
           I+T VIL  L GG++WMLF
Sbjct: 445 IVTTVILGTLAGGSIWMLF 463

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/443 (68%), Positives = 362/443 (81%), Gaps = 4/443 (0%)

Query: 20  FFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGG 79
             +    +DLDT+  +SICDAT+LIQGG++DYY GTR GGTVGMFQ PYYWW AGE FGG
Sbjct: 12  LLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGG 71

Query: 80  MLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNF 139
           MLENWFLC+NDTY +++YDA++ Q G +YD++PSNQ+MVEGNDDQG+WG+TVM A ERNF
Sbjct: 72  MLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNF 131

Query: 140 TDP-GDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQI 198
           T+P  DG PGWLAM Q VFNTM+ RWDSEHCGGG+RWQIFTWNSGYNYKNTVSNAC+FQ+
Sbjct: 132 TNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQL 191

Query: 199 AARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDITKIEWTY 256
           AARLGRYTGN TYL  AE V+DWLVDVG+VVLN+   ANV+DGA ID NCTDI K EW+Y
Sbjct: 192 AARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSY 251

Query: 257 NHGIVLGGLAYMYNAT-NGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQR 315
           N GIVLGG AYMYNAT N T  W++ L +I+ G+  +FFKD +MYES CQD  TCN DQR
Sbjct: 252 NQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQR 311

Query: 316 TFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGY 375
           +FKSIFSRML LT  +AP+T +TID L++ SAE AAKSC GGTDGHTCGLNWQ   +DGY
Sbjct: 312 SFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGY 371

Query: 376 YGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDR 435
           YGLGEQ  ALE IQ+L+   RPAPY  DNGG+S GD  A +NS++TNVLQ+++ I   D+
Sbjct: 372 YGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDK 431

Query: 436 AGAAIITAVILSVLTGGAVWMLF 458
            GA+IITAVIL+VL GG++WM+F
Sbjct: 432 VGASIITAVILAVLVGGSIWMIF 454

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/453 (67%), Positives = 358/453 (79%), Gaps = 3/453 (0%)

Query: 9   MILSICFTFLSF-FKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSP 67
           M+L     +L F      A+DL    K S+C ATALIQ GMLDYY G +YGG +GMFQ P
Sbjct: 1   MLLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPP 60

Query: 68  YYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIW 127
           YYWW AGEAFGGM++NW  C+N+T++EL+ +A+L Q G +YDY+P NQTMVEGNDDQG+W
Sbjct: 61  YYWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVW 120

Query: 128 GITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           G+TVM AVERNFTDPGDGKPGWLAM QAVFN +  RWD + C GG+RWQIFTWNSGYNYK
Sbjct: 121 GLTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYK 180

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NT+SN C FQ+AARLGRYT N TYLEVAE+VFDWL DVG+VVL D  NVFDGA  D NCT
Sbjct: 181 NTISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCT 240

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQ-- 305
            +T++EWTYNHGI+LGG AYMYNATNG+ +WE  + +ILNGA  YFF+D++MYES CQ  
Sbjct: 241 QVTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHG 300

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365
           D   CN DQR+FKSIFSRMLGLTSV+ P   D +D L+  SAE AAKSC+GG DGHTCGL
Sbjct: 301 DSSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGL 360

Query: 366 NWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQ 425
           NW K + D  YGLGEQMSALEVIQN LIH+   PY+E  GG+SKGD+ AG+N++TTNVLQ
Sbjct: 361 NWFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQ 420

Query: 426 NNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
             L I+  DRAGAAIIT V+L V+ GG+VWMLF
Sbjct: 421 KKLKIQSKDRAGAAIITGVVLMVVVGGSVWMLF 453

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/437 (62%), Positives = 340/437 (77%), Gaps = 2/437 (0%)

Query: 24  THAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLEN 83
           + A+DLD +S+  +C  T  IQ G++DYY G++YGG VGMFQ PYYWW AGE FGGMLEN
Sbjct: 23  SRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLEN 82

Query: 84  WFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDP- 142
           W+LC+N  Y+ +L ++++AQTG  +DYIP+NQ+  EGNDDQG+W + +MGAVERNF DP 
Sbjct: 83  WYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPE 142

Query: 143 GDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARL 202
            +G PGWL MVQ VFN M +RWD+E+CGGGLRWQIF WN+GY YKNT++N CLFQ+AARL
Sbjct: 143 KEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARL 202

Query: 203 GRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVL 262
           GRYTGN TYL+VA +VF WLVDV Y+VL D A VFDGA I  NC+DI  IEW+YNHGI+L
Sbjct: 203 GRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIIL 262

Query: 263 GGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFS 322
            G AYMYNAT G+ EWE+ +TKIL GA  ++F+D IMYE ACQDY TC+ DQR+FKSIFS
Sbjct: 263 AGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFS 322

Query: 323 RMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQM 382
           RML +TSV+APFTR TID+LI  SA AA+KSC  GT G+TCGLNW K T DG YGLGEQ 
Sbjct: 323 RMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQA 382

Query: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNS-STTNVLQNNLNIKKGDRAGAAII 441
           SALE+IQN+LIH +  P   D GG S+G+ +AG++  S   +L+   NI   DR GA++I
Sbjct: 383 SALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLI 442

Query: 442 TAVILSVLTGGAVWMLF 458
           TA+ L ++ G A+WM+F
Sbjct: 443 TAISLGLMLGCALWMIF 459

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/451 (63%), Positives = 342/451 (75%), Gaps = 7/451 (1%)

Query: 9   MILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68
           ++L IC            + LD  SK SIC AT  IQ G++DYY G+  GG VGMF  PY
Sbjct: 10  LLLLICV------PVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPY 63

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128
           YWW AG  F GMLENW+LC+N  Y   LY++++AQTG+NYDYIPSNQ+M EGNDDQGIWG
Sbjct: 64  YWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWG 123

Query: 129 ITVMGAVERNFTDPGDGK-PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           + +MGAVERNF D   G  PGWL M QAVFNTMY+RWDS+HCGGGLRWQIFTWN GY+YK
Sbjct: 124 LFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYK 183

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NT++N CLFQ+AARLGRYTGN+TYL++A + F WLVDV +VVL D ANVFDGA I  NC 
Sbjct: 184 NTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQ 243

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
           DI  IEWTYNHG++LGG AYMYNATNG   WET L +IL GA+++FF+++IMYE ACQD 
Sbjct: 244 DIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN 303

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
             CN DQR+FKSIFSRML +TSV+APFTR+TID L++ SA AAA SC+GG DG TCGL+W
Sbjct: 304 KICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCGLDW 363

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427
              + DGYYGLGEQ SALEVIQNLLIH +  P  ++ GGTS GD  AG+ +   NVL + 
Sbjct: 364 TTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSR 423

Query: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           LNI   DR  AA+ITAV L +L G A+WM+ 
Sbjct: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/399 (68%), Positives = 321/399 (80%), Gaps = 10/399 (2%)

Query: 26  AMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWF 85
           ++ L+ TS TSICDAT++I  G+LDYYEGTR+ GTVGMFQ PYYWW AG AFGGMLENW+
Sbjct: 26  SIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLENWY 85

Query: 86  LCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDP-GD 144
           LC+NDT++ LL DA+L Q G +YDY+P NQTMVE NDDQG+WG+T+MGAVERNFTDP G 
Sbjct: 86  LCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQGK 145

Query: 145 GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGR 204
             PGWLAM Q++FN MYSRWD+  CGGGLRWQI+ WN GYNYKNT+S ACLFQ+AARLGR
Sbjct: 146 DVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARLGR 205

Query: 205 YTGNTTYLEVAEQVFDWLVDVGYVVLNDTA-NVFDGAEIDTNCTDITKIEWTYNHGIVLG 263
           YTGN+TYL+VA++ F W+VD+GY+ LN ++  VFDGA I++NC+DITK+EW+YNHGIVLG
Sbjct: 206 YTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHGIVLG 265

Query: 264 GLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQ--DYGTCNTDQRTFKSIF 321
           G AYMYNAT  + EW  +  KILNGA +YFF++  M E+ACQ  D   CN DQRTFKSIF
Sbjct: 266 GCAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKSIF 324

Query: 322 SRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQ 381
           SRMLGLTSVMAPFT + ID LI  SAEAAA SC GG D  TCGLNW +  NDGYYGLGEQ
Sbjct: 325 SRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLGEQ 384

Query: 382 MSALEVIQNLLIHDRPAPY-----KEDNGGTSKGDANAG 415
           +SALEVIQNLLIH RP PY     K   GG SKGD  AG
Sbjct: 385 LSALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/435 (61%), Positives = 326/435 (74%), Gaps = 3/435 (0%)

Query: 24  THAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLEN 83
           ++A+D+D  S  SICDAT LIQ G+LDYYEG R GG VG FQ PYYWW AGEAFGGM+EN
Sbjct: 28  SNALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYYWWMAGEAFGGMVEN 87

Query: 84  WFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTD-P 142
           W+LC N  YQ+LL DA+++Q G N DY+PS+Q M+EGNDDQGIWG+ VMGA ERNF D P
Sbjct: 88  WYLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGLLVMGAAERNFPDAP 147

Query: 143 GDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARL 202
            +  PGWLA+ QAVFNTM++RWD E+CGGGLRWQIF WN+GY+YKNT+SNACLFQIAARL
Sbjct: 148 PERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKNTISNACLFQIAARL 207

Query: 203 GRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVL 262
            R+TGN+TY +VAE VFDWLVD   V L + A V DGA I   C D +K+EWTYNHG+VL
Sbjct: 208 ARFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERCEDHSKLEWTYNHGVVL 267

Query: 263 GGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFS 322
            G AYMYN TNG+  W   L K+LNG+   FF + I+YE ACQD   CN DQR+F+SIFS
Sbjct: 268 AGCAYMYNITNGSAVWGDRLNKVLNGSL-LFFPNGILYERACQDVQKCNDDQRSFRSIFS 326

Query: 323 RMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQM 382
           RML LTSV+AP T+  I+  I+ SAEAAAKSC+GG DGHTCG+ W+  T DG YGLGEQ+
Sbjct: 327 RMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQL 386

Query: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQ-NNLNIKKGDRAGAAII 441
           SALE+IQN LIH +P P   + G  SKGD +AG+  ++ N++  +   I   DR GA  +
Sbjct: 387 SALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLSTRQIGLKDRVGAGFM 446

Query: 442 TAVILSVLTGGAVWM 456
           T V+L     G++WM
Sbjct: 447 TVVLLIPFITGSIWM 461

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/435 (60%), Positives = 321/435 (73%), Gaps = 3/435 (0%)

Query: 24  THAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLEN 83
           ++A+D+D  S  SICDAT LIQ G+LDYYEG + GG  G    PYYWW AGEAFGGM+EN
Sbjct: 13  SNALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWMAGEAFGGMVEN 72

Query: 84  WFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTD-P 142
           W+LC N  YQ+LL DA+++Q G N DY+PS+Q MVEGNDDQGIWG+ VMGA ERNF D P
Sbjct: 73  WYLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVMGAAERNFPDAP 132

Query: 143 GDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARL 202
            +  PGWLA+ QAVFNTM++RWD E+CGGGLRWQIF WN GY+YKNT+SNACLFQIAARL
Sbjct: 133 PERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTISNACLFQIAARL 192

Query: 203 GRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVL 262
            R+TGN+TY +VAE VFDWLVDV  V L + A V DGA I   C D +++EWTYNHG+VL
Sbjct: 193 ARFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHSQLEWTYNHGVVL 252

Query: 263 GGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFS 322
           GG AYMYN TNG+  W   L K+LNG+   FF++ I+YE ACQD   CN DQR+F+SIFS
Sbjct: 253 GGCAYMYNITNGSAVWGDRLNKVLNGSL-LFFENGILYERACQDVNKCNDDQRSFRSIFS 311

Query: 323 RMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQM 382
           RML LTSV+AP T+  I+  I+ SAEAAAKSC+GG DGHTCG+ W+  T DG YGLGEQ+
Sbjct: 312 RMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQL 371

Query: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTN-VLQNNLNIKKGDRAGAAII 441
           SALE+IQN LIH +P P   + G  S+GD  AG+  S+ N +      I+  DR GA   
Sbjct: 372 SALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQIRLKDRVGAGFA 431

Query: 442 TAVILSVLTGGAVWM 456
           T V L     G++WM
Sbjct: 432 TVVFLLPFITGSIWM 446

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/387 (63%), Positives = 310/387 (80%), Gaps = 3/387 (0%)

Query: 15  FTFLSFF-KATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHA 73
           F ++S F   T ++ LD TS  SICDAT+L+Q G+LDYYEGT YGGTVGMFQ+PYYWWH+
Sbjct: 16  FIYVSLFIGKTLSLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHS 75

Query: 74  GEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMG 133
           G AFG M+ENW+LC++DTY+ L+ DA+LAQ G NYD++P NQTMVEGNDDQG+WG+ +M 
Sbjct: 76  GCAFGSMIENWYLCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMD 135

Query: 134 AVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNA 193
           A ER F     G+P WL M + +F +M++RWD+ +CGGGLRWQI++WN+GY+YKNTVS  
Sbjct: 136 AAEREFPQV-KGQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTT 194

Query: 194 CLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVL-NDTANVFDGAEIDTNCTDITKI 252
           CLFQ+AARLGRYTGN TY++ A Q FDWL  VG+V+  N+   VFDGA+I TNCT+I K 
Sbjct: 195 CLFQLAARLGRYTGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKY 254

Query: 253 EWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNT 312
           EW+YNHGIVLGG AYMYN T+G+  WET  +++LN A SYFF++ IM+E+ CQ    CN 
Sbjct: 255 EWSYNHGIVLGGAAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNN 314

Query: 313 DQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTN 372
           DQR+F+SIF+RMLG TS+MAPFT +TID L+KT+++AAA +C+GG DGHTCGLNW     
Sbjct: 315 DQRSFRSIFARMLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNF 374

Query: 373 DGYYGLGEQMSALEVIQNLLIHDRPAP 399
           DG YGLGE+MSA+EVIQNLLIH RPAP
Sbjct: 375 DGNYGLGEEMSAMEVIQNLLIHQRPAP 401

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/382 (63%), Positives = 301/382 (78%), Gaps = 2/382 (0%)

Query: 27  MDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWFL 86
           +++DT SK SIC+AT+LIQ G+LDYYEG RYGGTVG+FQ PYYWW +GEAFG +L NW+L
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 87  CENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGDGK 146
           C+NDTY++L+YDA+LAQ G NYD++P NQTMVEGNDDQG++ +T++ A+ERNFT P  G 
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPKGS 136

Query: 147 PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYT 206
           P WL M Q VFN+MY RWD+  C GG+RWQI++WN+GY+YKN VS   LF IAARL RYT
Sbjct: 137 PSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARYT 196

Query: 207 GNTTYLEVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265
           GN +Y +VA+ +FDWL  V YV+ +D    V DGA I+ NCTDIT+IEWTYN GI++ G 
Sbjct: 197 GNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDGC 256

Query: 266 AYMYNATNGTGEWETSLTKILNGAKSYFF-KDSIMYESACQDYGTCNTDQRTFKSIFSRM 324
           AY+YNATNG+ +WE   TK+L GAK  FF K+ IMYE+ACQ    CN DQR+FK++ +R 
Sbjct: 257 AYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLARF 316

Query: 325 LGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSA 384
           LG TSV+AP+T  TI  +I  SA  AAKSCNGG DGHTCGL+WQK TNDGYYG+GEQMSA
Sbjct: 317 LGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMSA 376

Query: 385 LEVIQNLLIHDRPAPYKEDNGG 406
           LE+IQNLLI+D P P    NGG
Sbjct: 377 LEIIQNLLINDYPPPLVAPNGG 398

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/396 (62%), Positives = 298/396 (75%), Gaps = 2/396 (0%)

Query: 25  HAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENW 84
           +A+D++  S  SIC+AT LIQ G+LDYYEG R GG VG FQ PYYWW AG+ FGGM+ENW
Sbjct: 13  NALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDVFGGMVENW 72

Query: 85  FLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTD-PG 143
           +LC+N  Y++LL +A+++Q G N DY+P +Q MVEGNDDQGIWG+ VM A ER+F D P 
Sbjct: 73  YLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAERDFPDAPP 132

Query: 144 DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLG 203
           D  PGWLA+ QAVFNTM++RWD ++C GGL WQI+ WN GY+YKNT+SN  LFQIAARL 
Sbjct: 133 DQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYLFQIAARLA 192

Query: 204 RYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263
           R+TGN+TY  VAE VFDWLVD   V L++ A V DGA + TNCTD T+ EWTYN+G+VLG
Sbjct: 193 RFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTRYEWTYNYGVVLG 252

Query: 264 GLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFSR 323
           G AYMYN TNG+  W   L ++LNGA   FF++ IMYE  CQD   CN DQR FKSIF+R
Sbjct: 253 GCAYMYNFTNGSPVWANRLNRVLNGAL-LFFENGIMYERTCQDVDRCNNDQRFFKSIFTR 311

Query: 324 MLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMS 383
           ML LTSV+AP T+  I+  I+ SAEAAAKSCNGG+DGHTCGL W+  T DG  GLGEQ+ 
Sbjct: 312 MLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWDGKAGLGEQLC 371

Query: 384 ALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSS 419
           ALE+IQN LIH +  P     G  SKGD  AG+NSS
Sbjct: 372 ALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSS 407

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  507 bits (1305), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 316/438 (72%), Gaps = 4/438 (0%)

Query: 21  FKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGM 80
           F+++ A+D D  ++ SI +ATAL+ GG+LDYY G +YG T+GMF +PYYWW AG A+G +
Sbjct: 15  FRSSQALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSI 74

Query: 81  LENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFT 140
           L+ W+  +NDTY  +L +ALL Q G N+DYIP NQ+  EGNDDQ  WG+ VM A ERNFT
Sbjct: 75  LDFWWYTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFT 134

Query: 141 DPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAA 200
           +P + +P WL + QAVFNTM  RWD E CGGGLRWQIFTWNSGY+YKNTVSN  LF +AA
Sbjct: 135 NPPETEPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAA 194

Query: 201 RLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGI 260
           RL RYTGN TY++ AE+VFDW+  +G +  ND + V+DGA++D NC+ ITK+ WTYN G+
Sbjct: 195 RLARYTGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGL 254

Query: 261 VLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSI 320
           ++ G AY+YN T G+  W T   + LN +   FF +SI+YE  CQ+  TCNTDQR+FK+ 
Sbjct: 255 LMSGCAYLYNYT-GSETWHTRTFEFLN-SSDIFFNNSILYERTCQEANTCNTDQRSFKAY 312

Query: 321 FSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGE 380
           FSR LGLT+ + P  R+ I D I+ SA+ AA+SC+GGTDGHTCGLNW     DG +GLGE
Sbjct: 313 FSRFLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGE 372

Query: 381 QMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAAI 440
           QM+ALE++QN+L  DRPAPY    GG+S G+  AG  +S TN+  + L+I  G RA A I
Sbjct: 373 QMAALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGI 430

Query: 441 ITAVILSVLTGGAVWMLF 458
           ITAVI   +    VW++ 
Sbjct: 431 ITAVIGLSIVACTVWLVL 448

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  506 bits (1303), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/451 (53%), Positives = 318/451 (70%), Gaps = 4/451 (0%)

Query: 8   KMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSP 67
           K+I  +C + L  +  T AMDLD     S+ +ATAL+  G++DYY G +YG T+GMF +P
Sbjct: 5   KLINVLCGSLL-LYSPTGAMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNP 63

Query: 68  YYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIW 127
           YYWW AG A+G ML+ W+  ENDTY +++  ALL QTG ++DY+P NQ+  EGNDDQ  W
Sbjct: 64  YYWWEAGGAWGSMLDYWWYMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFW 123

Query: 128 GITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           G+ VM A ERNF++P   +P WL + QAVFNTM  RWD++ CGGGLRWQIFTWNSGY+YK
Sbjct: 124 GLAVMAAAERNFSNPDPDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYK 183

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           N+VSN  LF IAARL RYTGN +Y++ AE+VFDW+ DVG +   D A V DG  ID NCT
Sbjct: 184 NSVSNGALFHIAARLARYTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCT 243

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
            +T  +WTYNHG+++ G AY+YN T G+  W     + L+ +  +F   SI++E+ACQ  
Sbjct: 244 SVTPYQWTYNHGLIMAGSAYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQAS 302

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
            TCNTDQR+FK+ FSR LGLT+ + P +R  I + I++SA+ AA+SC+GG DGHTCG+NW
Sbjct: 303 NTCNTDQRSFKAYFSRFLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINW 362

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427
              + DG+YGLGEQM+ALE+IQN+   DRPAPY    GG+S+GD+ AG  +  TN+    
Sbjct: 363 FNGSWDGFYGLGEQMAALEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNL--TP 420

Query: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           L I  G RAGA IITAVI   +   AVW++ 
Sbjct: 421 LTITAGSRAGAGIITAVIGISIVACAVWLVL 451

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  504 bits (1297), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/452 (55%), Positives = 316/452 (69%), Gaps = 9/452 (1%)

Query: 8   KMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSP 67
           K++LS+   F S    +  +DLD     S+ +AT+L+  G++DYY G +YG T+GMF SP
Sbjct: 5   KLVLSLVTLFSS---VSFGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFASP 61

Query: 68  YYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIW 127
            YWW AG A+G +L+ WF  ENDTY ++L  ALL QTG N+DY+P NQT+ EGNDDQ  W
Sbjct: 62  SYWWQAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAFW 121

Query: 128 GITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           G  VM A ERN+ +P D +P WL + QAVFNTM SRWD + CGGGLRWQIFTWNSGY+YK
Sbjct: 122 GFAVMAAAERNYPNPPDDEPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDYK 181

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTAN--VFDGAEIDTN 245
           N+VSNA LF ++ARL RYTGN++Y E AE+++DW+ D+  +V  +     V+DGA I+ N
Sbjct: 182 NSVSNAALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEEN 241

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQ 305
           CTD  K +WTYN G++L G AY+YN T  +  W       LN +   FF +SIMYE+ACQ
Sbjct: 242 CTDTVKYQWTYNQGLMLSGSAYLYNFTE-SETWHERTKNFLN-SSGIFFNNSIMYEAACQ 299

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365
             G CN DQR+FK+ FSR LGLT+ + P TRDT+  L++ SA+ AA SC+GGTDGHTCGL
Sbjct: 300 GSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTCGL 359

Query: 366 NWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQ 425
           NW     DG YGLGEQM+ALEV+QNL   DRPAPY  D+GGTS G+  AG   S TN+  
Sbjct: 360 NWFYGGWDGKYGLGEQMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTNLAP 419

Query: 426 NNLNIKKGDRAGAAIITAVILSVLTGGAVWML 457
             L I KGD+AGA IITAVI   + G  VW++
Sbjct: 420 --LTIGKGDQAGAGIITAVIGITIIGSVVWLI 449

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  491 bits (1264), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 246/449 (54%), Positives = 310/449 (69%), Gaps = 7/449 (1%)

Query: 10  ILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYY 69
           +LS+ F    F   T+A++LD  +  S+ +AT+LI  G++DYY G +YG TVGMF  PYY
Sbjct: 9   LLSVLFATTRF---TNAVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYY 65

Query: 70  WWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGI 129
           WW AG A+G ML+ WF  ENDTY + +  A++ Q G + DYIP NQ+  EGNDDQ  WGI
Sbjct: 66  WWEAGGAWGCMLDYWFFMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGI 125

Query: 130 TVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNT 189
             M A ERNFT+P   +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKNT
Sbjct: 126 AAMTAAERNFTNPPSDEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNT 185

Query: 190 VSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDI 249
           VSN  LF IAARL RYTGN TY++ AE+V++W+V V  +       V+DG  ID NCT +
Sbjct: 186 VSNGALFHIAARLARYTGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKV 245

Query: 250 TKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGT 309
           T  +WTYN G++L G AY+YN T G+  W T   + LN A   FF D I+YE+ACQ   +
Sbjct: 246 TSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNS 303

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQK 369
           CNTDQR+FK+ F+R LG+T+ + P TR  I   + TSA AAAKSC+GGTDGHTCGLNW  
Sbjct: 304 CNTDQRSFKAYFARFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFN 363

Query: 370 QTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLN 429
            T DG YGLGEQM+ALEV+ N    DRP+PY  DNGG+S GD  AG  +  TN+  + LN
Sbjct: 364 GTWDGMYGLGEQMAALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLN 421

Query: 430 IKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           I KG +AGA IITAVI   +   A+W++F
Sbjct: 422 ITKGSKAGAGIITAVIGISIVACALWLVF 450

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  489 bits (1259), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 248/458 (54%), Positives = 316/458 (68%), Gaps = 9/458 (1%)

Query: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60
           M+VN   K+I  +   F + F  T+A++LD  +  S+ +AT+LI  G++DYY G +YG T
Sbjct: 1   MLVN---KVIGLLGVLFATRF--TNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKT 55

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120
           VGMF  PYYWW AG A+G ML+ WF  +NDTY + +  A++ Q G + DYIP NQ+  EG
Sbjct: 56  VGMFSDPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEG 115

Query: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQ  WGI  M A ERNFT+P + +P WL + QAVFNTM  RWD++ CGGGLRWQIF W
Sbjct: 116 NDDQAFWGIAAMTAAERNFTNPPENEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVW 175

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGY+YKNTVSN  LF IAARL RYTGN TY++ AE+V++W+V V  +       V+DG 
Sbjct: 176 NSGYDYKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGV 235

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300
            ID NCT +T  +WTYN G++L G AY+YN T G+  W T   + LN A   FF D I+Y
Sbjct: 236 SIDDNCTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVY 293

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360
           E+ACQ   +CNTDQR+FK+ F+R LG+T+ + P TR+ I   + TSA AAAKSC+GGTDG
Sbjct: 294 EAACQGPNSCNTDQRSFKAYFARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDG 353

Query: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGLNW   T DG YGLGEQMSALEV+ N    D+PAPY  +NGG+S GD  AG  +  
Sbjct: 354 HTCGLNWFNGTWDGMYGLGEQMSALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQP 413

Query: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           TN+    LNI KG +AGA IITAVI   +   A+W++F
Sbjct: 414 TNLAP--LNITKGSKAGAGIITAVIGISIVACALWLVF 449

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  489 bits (1258), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 245/453 (54%), Positives = 310/453 (68%), Gaps = 7/453 (1%)

Query: 9   MILSICFTFLSFFKATH---AMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQ 65
           M+++    FLS   AT    A++LD  +  S+ +AT+L+  G++DYY G +YG T+GMF 
Sbjct: 1   MLMNKVIGFLSVLFATRFTNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFS 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQG 125
            PYYWW AG A+G ML+ WF  +NDTY + +  A++ Q G + DYIP NQ+  EGNDDQ 
Sbjct: 61  DPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQA 120

Query: 126 IWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
            WGI  M A ERNFT+P +  P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+
Sbjct: 121 FWGIAAMTAAERNFTNPPEDDPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 180

Query: 186 YKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245
           YKNTVSN  LF IAARL RYTGN TY++ AE+V++W+V V  +       V+DG  ID N
Sbjct: 181 YKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDN 240

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQ 305
           CT +T  +WTYN G++L G AY+YN T G+  W T   + LN A   FF D I+YE+ACQ
Sbjct: 241 CTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQ 298

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365
              +CNTDQR+FK+ F+R LG+T+ + P TR  I   + TSA AAAKSC+GGTDGHTCGL
Sbjct: 299 GPNSCNTDQRSFKAYFARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGL 358

Query: 366 NWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQ 425
           NW   T DG YGLGEQMSALEV+ N    DRPAPY  +NGG+S GD  AG  +  TN+  
Sbjct: 359 NWFNGTWDGMYGLGEQMSALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNLAP 418

Query: 426 NNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
             LNI KG +AGA IITAVI   +   A+W++F
Sbjct: 419 --LNITKGSKAGAGIITAVIGISIVACALWLVF 449

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  488 bits (1255), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 245/451 (54%), Positives = 311/451 (68%), Gaps = 7/451 (1%)

Query: 8   KMILSICFTFLSFFKA-THAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQS 66
           K++   C   LS + + T A+ LD  +  S+ +ATAL+  G++DYY G +YG T+GMF  
Sbjct: 7   KLLFVNCI--LSLYSSLTSAVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSD 64

Query: 67  PYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGI 126
           PYYWW AG A+G ML+ WF  ENDTY +++  ALL Q G+  DY+P NQ+  EGNDDQ  
Sbjct: 65  PYYWWEAGGAWGCMLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAF 124

Query: 127 WGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGI  M A ERNFT+P + +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+Y
Sbjct: 125 WGIAAMMAAERNFTNPAEDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDY 184

Query: 187 KNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNC 246
           KN+VSN  LF IAARL RYTGN +Y E AE+V+DW+VDV  +  +    V+DG + + NC
Sbjct: 185 KNSVSNGALFHIAARLARYTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNC 244

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQD 306
           T ITK +WTYN G++L G AY+YN T G+  W T  TK    + S FF D+I+YE+ACQ+
Sbjct: 245 TTITKYQWTYNQGLILSGCAYLYNYT-GSELWHTR-TKNFLSSSSVFFNDTILYEAACQN 302

Query: 307 YGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLN 366
             TCNTDQR+FK+ FSR LG+T+ + P TRD I   I  SA  AA+SC+GGTDGHTCG+N
Sbjct: 303 QETCNTDQRSFKAYFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGIN 362

Query: 367 WQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQN 426
           W     DG YGLGEQM+ALE++ N    DRPAPY   NGG+S GD  AG  +S TN+  +
Sbjct: 363 WFYGGWDGKYGLGEQMAALEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--S 420

Query: 427 NLNIKKGDRAGAAIITAVILSVLTGGAVWML 457
            LNI  G RAGA IITAVI   +   A W++
Sbjct: 421 PLNITAGSRAGAGIITAVIGISIVACACWLV 451

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  487 bits (1254), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 241/451 (53%), Positives = 308/451 (68%), Gaps = 5/451 (1%)

Query: 8   KMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSP 67
           K + +I F  L+F    +A+ LD  +  S+ + TAL+  G++DYY G +YG TVGMF +P
Sbjct: 2   KRVFNILF-LLTFTHRANALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSNP 60

Query: 68  YYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIW 127
           YYWW AG A+G ML+ WF  ENDTY +L+  ALL QTG N DYIP NQ+  EGNDDQ  W
Sbjct: 61  YYWWEAGGAWGTMLDYWFFMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAFW 120

Query: 128 GITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           GI  M A ERNFT+P +  P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+YK
Sbjct: 121 GIAAMTAAERNFTNPPESSPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDYK 180

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           N+VSN  LF +AARL RYTGN +Y++ AE+ +DW+ DVG +       V+DG  I+TNCT
Sbjct: 181 NSVSNGALFHLAARLARYTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNCT 240

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
            IT  +W+YN G++L G AY+YN T G+  W      +L+ A S FF +SIMYE ACQ  
Sbjct: 241 TITSYQWSYNQGLMLAGAAYLYNFT-GSTIWLNRTMDLLD-ATSVFFNNSIMYEVACQPT 298

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
           GTCN DQR+FKS  +R LGLT+ +   T+  I + + TSA A A SC+GGTDGHTCGLNW
Sbjct: 299 GTCNNDQRSFKSYLARFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLNW 358

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427
                DGYYGLGEQMSAL+V+ N  + DRPAPY   NGG+S GD  AG  ++ TN+    
Sbjct: 359 FDNGWDGYYGLGEQMSALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNLAP-- 416

Query: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           L+I KG + GAA ITA I   +   ++W++ 
Sbjct: 417 LHITKGSKVGAAFITAAIGLSIVFTSIWIIL 447

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  485 bits (1249), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 309/449 (68%), Gaps = 5/449 (1%)

Query: 11  LSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYW 70
           L+  FT L   + +  + LD  +  SI +ATAL+ GG+LDYY G +YG T+GMF  PYYW
Sbjct: 5   LTCVFTLLVTLRGSLGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPYYW 64

Query: 71  WHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGIT 130
           W AG A+G +L+ W   +NDTY ++L  ALL Q+G N+DYIP NQ+  EGNDDQ  WG+ 
Sbjct: 65  WEAGGAWGSILDYWHYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWGLV 124

Query: 131 VMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTV 190
           VM A ERNFT+P   +P WL + QAVFNTM  RWD + CGGGLRWQIFTWNSGY+YKNTV
Sbjct: 125 VMAAAERNFTNPPPDQPQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKNTV 184

Query: 191 SNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDIT 250
           SN  LF +AARL RYTGN TY+E AE+VFDW+  +  +   +   V+DGA++D NCT IT
Sbjct: 185 SNGALFHLAARLARYTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTVIT 244

Query: 251 KIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYG-T 309
           K+ WTYN G+++ G AY+YN T G  +W T   + LN +   FF +S++YE ACQ    +
Sbjct: 245 KLIWTYNQGLLMSGSAYLYNYT-GAEKWHTRTFEFLNSSH-IFFNNSVLYERACQGVTVS 302

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQK 369
           CNTDQR+FK+ FSR +GLT+ + P +R  I   I+ SA  AA+SC+GG DGHTCGLNW  
Sbjct: 303 CNTDQRSFKAYFSRFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNWFY 362

Query: 370 QTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLN 429
              DG +GLGEQMSALE++QNLL  DRPAPY  + GG+S G+  AG  +S TN+  + L 
Sbjct: 363 DGWDGKWGLGEQMSALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL--SPLA 420

Query: 430 IKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           I  G RA A IITAVI   +    +W++ 
Sbjct: 421 ITAGSRAAAGIITAVIGLSIVACTIWLVL 449

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  484 bits (1246), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 241/449 (53%), Positives = 312/449 (69%), Gaps = 8/449 (1%)

Query: 10  ILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYY 69
           +LS+ F    F K ++A++LD  +  S+ +AT+LI  G++DYY G +YG T+GMF  PYY
Sbjct: 9   LLSVLF----FTKFSNAVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYY 64

Query: 70  WWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGI 129
           WW AG A+G ML+ WF  +NDTY + +  A++ Q+G + DYIP NQ+  EGNDDQ  WGI
Sbjct: 65  WWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGI 124

Query: 130 TVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNT 189
             M A ERNFT+P   +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKNT
Sbjct: 125 AAMTAAERNFTNPPADEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNT 184

Query: 190 VSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDI 249
           VSN  LF IAARL RYTGN TY++ AE+V++W+V V  +       V+DG  I  NCT +
Sbjct: 185 VSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGDNCTKV 244

Query: 250 TKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGT 309
           T  +WTYN G++L G AY+YN T G+  W T   + LN ++  FF+D I+YE+ACQ   +
Sbjct: 245 TSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLNSSQ-VFFQDGIVYEAACQGPNS 302

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQK 369
           CNTDQR+FK+ F+R LG+T+ + P TR+ I   + TSA AAAKSC+GGTDGHTCGLNW  
Sbjct: 303 CNTDQRSFKAYFARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFN 362

Query: 370 QTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLN 429
            T DG YGLGEQM+ALEV+ N    D+PAPY  D GG+S GD  AG  +  TN+    LN
Sbjct: 363 GTWDGMYGLGEQMAALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNLAP--LN 420

Query: 430 IKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           I KG +AGA IITAVI   +   A+W++F
Sbjct: 421 ITKGSKAGAGIITAVIGISIVACALWLVF 449

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  481 bits (1238), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 244/450 (54%), Positives = 305/450 (67%), Gaps = 5/450 (1%)

Query: 10  ILSICFTF-LSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68
           +LSI  T  L    +T A+++D     S+ +AT+L+  G++DYY G +YG T+GMF  PY
Sbjct: 7   LLSIVTTTTLLLSHSTKALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPY 66

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128
           YWW AG A+G ML+ W+  +NDTY + +  ALL QTG N DY+P NQ+  EGNDDQ  WG
Sbjct: 67  YWWEAGGAWGSMLDYWYYMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWG 126

Query: 129 ITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           I VM A ERNFT+P +  P WL + QAVFNTM  RWD + CGGGLRWQIF WNSGY+YKN
Sbjct: 127 IAVMTAAERNFTNPPEDSPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKN 186

Query: 189 TVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           TVSN  LF +AARL RYTGN +Y++ AE+V+DW+ +VG V    +  V+DG  I  NC+ 
Sbjct: 187 TVSNGALFHMAARLARYTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCST 246

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYG 308
           IT  +WTYNHG+V+ G AY+YN T    E   + TK+L  A + FF +SIMYE+ACQ   
Sbjct: 247 ITPYQWTYNHGLVMAGAAYLYNFTE--NEVWHNRTKMLVDASTVFFNNSIMYEAACQGPN 304

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQ 368
           +CNTDQR+FK+ FSR LG T+ + P TR  I  LI  SA AA KSC+GGTDGHTCGLNW 
Sbjct: 305 SCNTDQRSFKAYFSRFLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWF 364

Query: 369 KQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNL 428
               DG YGLGEQM ALEV+ N     +PAPY   NGG+S GD  AG     TN+    L
Sbjct: 365 IGDWDGMYGLGEQMCALEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHPTNLAP--L 422

Query: 429 NIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           +I KG RAGA IITAVI   +   A+W++F
Sbjct: 423 HITKGSRAGAGIITAVIGISILACALWLVF 452

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  480 bits (1235), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 242/459 (52%), Positives = 315/459 (68%), Gaps = 12/459 (2%)

Query: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60
           M++N    +ILS      +F    ++++LD  S  S+ +ATAL+  G++DYY G +YG T
Sbjct: 1   MVINNLILLILS------TFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKT 54

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120
           VGMF  PYYWW AG A+G M++ W+  +N+TY + +  ALL QTG ++DYIP NQ+  EG
Sbjct: 55  VGMFSDPYYWWEAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEG 114

Query: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQ  WGI VM A ERNFT+P D +P WL + QAVFNTM  RWD   CGGGLRWQIFTW
Sbjct: 115 NDDQAFWGIAVMTAAERNFTNPPDDQPQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTW 174

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTAN-VFDG 239
           NSGY+YKNTVSN  LF +AARL RYTGNT+Y++ AE+V++W+ D  Y++ N T   V+DG
Sbjct: 175 NSGYDYKNTVSNGALFHLAARLARYTGNTSYVDWAEKVYNWMEDT-YLISNGTQMFVYDG 233

Query: 240 AEIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIM 299
           A +  NCT +TK +WTYN G++L G AY+YN T  +  W       LN A   FF +SIM
Sbjct: 234 ASVTDNCTTVTKYQWTYNQGLLLSGSAYLYNFTE-SELWHERTKGFLN-ASVVFFNNSIM 291

Query: 300 YESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTD 359
           YE+ACQ   TCNTDQR+FK+ FSR LG T+ + P TRDT+   + TSA AAA SC+GGTD
Sbjct: 292 YEAACQGPQTCNTDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTD 351

Query: 360 GHTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSS 419
           GHTCG+NW     DGYYGLGEQMSALE++ N     +P PY  +NGG+S GD  AG  ++
Sbjct: 352 GHTCGINWFYGGWDGYYGLGEQMSALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQAT 411

Query: 420 TTNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
            TN+  + LN+  G +A A IITAVI   +    +W+++
Sbjct: 412 ATNL--SPLNVTPGSKAAAGIITAVIGISIFACVLWLIY 448

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  473 bits (1216), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 241/455 (52%), Positives = 304/455 (66%), Gaps = 7/455 (1%)

Query: 4   NISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGM 63
           +IS  ++LS+     S      A+ LD     S+ +AT+L+  G++DYY G +YG TVGM
Sbjct: 6   SISTFLLLSLASILPS---QVSALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVGM 62

Query: 64  FQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDD 123
           F  PYYWW AG A+G ML+ W+   NDTY + +  ALL QTG + DY+P NQ+  EGNDD
Sbjct: 63  FSDPYYWWQAGGAWGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGNDD 122

Query: 124 QGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSG 183
           Q  WGI VM A ERNFT+P + +P WL + QAVFNTM  RWDS+ CGGGLRWQIF WNSG
Sbjct: 123 QAFWGIAVMTAAERNFTNPPEDQPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSG 182

Query: 184 YNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEID 243
           Y+YKNTVSN  LF IA+RL RYTGN +Y++ AE+V+DW+ DV  +       V+DG  I 
Sbjct: 183 YDYKNTVSNGALFHIASRLARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGVNIG 242

Query: 244 TNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESA 303
            NCT +T  +WTYN G++L G AY+YN T G   W    TK L  A   FF +SI+YE+A
Sbjct: 243 DNCTTVTPYQWTYNQGLLLSGCAYLYNFT-GEELWHNR-TKNLLTAAGVFFNNSILYEAA 300

Query: 304 CQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTC 363
           CQ + TCNTDQR+FK+ FSR LG T+ + P TR+ I   I TSA AAA+SC+GGTDGHTC
Sbjct: 301 CQGHNTCNTDQRSFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDGHTC 360

Query: 364 GLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNV 423
           G+NW     DG YGLGEQM+ALE++ N     + APY   NGG+S GD  AG     TN+
Sbjct: 361 GINWFADGWDGMYGLGEQMAALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHPTNL 420

Query: 424 LQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
               L+I KG RAGA IITAVI   +   A+W++F
Sbjct: 421 AP--LHITKGSRAGAGIITAVIGISIVTCALWLVF 453

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  468 bits (1205), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 232/449 (51%), Positives = 304/449 (67%), Gaps = 4/449 (0%)

Query: 10  ILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYY 69
           I+ + FT  SF     A+DL+  S  S+ +AT+L+  G++DYY G +YG TVGMF  PYY
Sbjct: 3   IIYLLFTVSSFSFPIAAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYY 62

Query: 70  WWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGI 129
           WW AG A+G ML+ W+  +NDTY +++  ALL Q G++ +YIP NQ+  EGNDDQ  WGI
Sbjct: 63  WWEAGGAWGTMLDYWYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGI 122

Query: 130 TVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNT 189
           TVM A ERNFT+P + +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKN+
Sbjct: 123 TVMTAAERNFTNPPEDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNS 182

Query: 190 VSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDI 249
           VSN  LF +AARL RYTGN +Y++ AE+V+DW+ DVG +       V+DGA    NCT +
Sbjct: 183 VSNGALFHMAARLARYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNCTVL 242

Query: 250 TKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGT 309
           T  +WTYN G++L G AY+YN T G+  W     ++LN A S FF +SI+YE+ACQ  GT
Sbjct: 243 TTYQWTYNQGLLLSGAAYLYNYT-GSDTWLLRTNQLLN-ASSVFFNNSILYEAACQKSGT 300

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQK 369
           CN DQR+FK+ F R LG T+ +   T+ TI   +  SA AAA+SC+GGTDGHTCGLNW  
Sbjct: 301 CNNDQRSFKAYFLRFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNWFS 360

Query: 370 QTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLN 429
              DG YGLGEQMSALE + N  +   P PY   +GG+S G++ AG     TN+    L+
Sbjct: 361 GGWDGMYGLGEQMSALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNLAP--LH 418

Query: 430 IKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           I  G +A AAIIT+V+   +    VW++ 
Sbjct: 419 ITDGSKAAAAIITSVVGISIVAAGVWLII 447

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  467 bits (1202), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 229/435 (52%), Positives = 308/435 (70%), Gaps = 4/435 (0%)

Query: 24  THAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLEN 83
           + +++LD     S+ +ATAL+  G++DYYEGT+YGGTVGMF SPYYWW AG AFG +L+ 
Sbjct: 19  SQSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSPYYWWEAGGAFGTLLDF 78

Query: 84  WFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPG 143
           W+  +NDTY + +  A++ Q G+++DYIP NQ+  EGNDDQ  WGI  M A ERNFT+P 
Sbjct: 79  WYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPA 138

Query: 144 DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLG 203
             +P WL + QAVFNTM  RWD++ CGGGLRWQIFTWNSGY+YKN+VSN  LF +AARL 
Sbjct: 139 SDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDYKNSVSNGALFHLAARLA 198

Query: 204 RYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263
           RYTGN +Y++ AE+V++W+ D G++   +T  V+DGA  + NC+ +TK +WTYN G++L 
Sbjct: 199 RYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDNCSSVTKYQWTYNQGLILS 258

Query: 264 GLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFSR 323
           G AY+YN +  +  +  ++T +   +   F  +SIM E+ACQ  GTC+TDQR+FK+ F+R
Sbjct: 259 GAAYLYNYSESSLWYNRTMTAL--SSSGVFLNNSIMCEAACQPAGTCDTDQRSFKAYFAR 316

Query: 324 MLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMS 383
            LG+T+ + P TR  I   +  SA A A+SC+GGTDGHTCGLNW   + DGYYGLGEQMS
Sbjct: 317 FLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGLNWFLGSWDGYYGLGEQMS 376

Query: 384 ALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAAIITA 443
           ALEV+ N    D+P PY   NGG+S+GD  AG  ++ TN+    LNI  G +A AAIITA
Sbjct: 377 ALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNLAP--LNITGGSKAAAAIITA 434

Query: 444 VILSVLTGGAVWMLF 458
           VI   L    +W++F
Sbjct: 435 VIGISLIACTLWIIF 449

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  465 bits (1196), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 306/442 (69%), Gaps = 10/442 (2%)

Query: 11  LSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYW 70
           L I  + L+ F     ++L+ TS  S+ +A +L+  G++DYY G +YG T+GMF +PYYW
Sbjct: 7   LIIQISILASFSTAVHLNLNVTS--SLQNAASLVAVGLMDYYNGDQYGQTIGMFSNPYYW 64

Query: 71  WHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGIT 130
           W AG A+G M++ W+  +NDTY +++  ALL QTG   DYIP NQ+  EGNDDQ  WGIT
Sbjct: 65  WEAGGAWGCMIDYWYFMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAFWGIT 124

Query: 131 VMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTV 190
           VM A ERNFT+P   KP WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+YKN+V
Sbjct: 125 VMSAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSV 184

Query: 191 SNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTD 248
           SN  LF +AARL RYTGN +Y++ A +V+DW+   G ++ NDT    V+DGA I+TNCTD
Sbjct: 185 SNGALFHMAARLARYTGNQSYVDWAVKVYDWMEKTG-LISNDTYFKFVYDGASIETNCTD 243

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYG 308
           IT+ +WTYN G++L G AY+YN T  + +W T   + +NG+ + FF +SI+YE+ACQ   
Sbjct: 244 ITQFQWTYNQGLILSGCAYLYNHTEDS-KWLTRTEQFVNGS-AVFFNNSIVYEAACQGSK 301

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQ 368
            C+ DQR+F++ F+R LG+T+ + P T+D I D I TSA AAA++C+GGTDGHTCGLNW 
Sbjct: 302 RCDNDQRSFRAYFARFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCGLNWF 361

Query: 369 KQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNL 428
               DGYYGLGEQM ALE + N    D PAPY   NGG+S G+  AG     TN+    L
Sbjct: 362 NIGWDGYYGLGEQMGALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL--GPL 419

Query: 429 NIKKGDRAGAAIITAVI-LSVL 449
           +I  G +AGA IIT VI LS+L
Sbjct: 420 HITDGSKAGAGIITCVIGLSIL 441

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  464 bits (1194), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 233/453 (51%), Positives = 309/453 (68%), Gaps = 12/453 (2%)

Query: 10  ILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYY 69
           I S+ F        T+A+ +D    +S+ +AT+LI  GM+DYY G  YG  +GMF  PYY
Sbjct: 4   IHSLLFQISLLPLFTNALKIDLDDFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAKPYY 63

Query: 70  WWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGI 129
           WW AG A+G +L+ W+  +NDTY +L+ +ALL QTG   DY+P NQ+  EGNDDQ  WGI
Sbjct: 64  WWEAGGAWGCLLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFWGI 123

Query: 130 TVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNT 189
             + A ERNFT+P   KP WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+YKN+
Sbjct: 124 AAITAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNS 183

Query: 190 VSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTAN----VFDGAEIDTN 245
           VSN  LF IAARL RYTGN +Y+E A++++DW+   G  +++D       V+DGA I+TN
Sbjct: 184 VSNGALFHIAARLARYTGNQSYVEWADKIYDWMFGTG--IISDEYETYKFVYDGANIETN 241

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQ 305
           CTDIT+ +WTYN G+VL G AY+YN T    +W     + LNG+   FF+D+++YE+ACQ
Sbjct: 242 CTDITRYQWTYNQGLVLAGCAYLYNHTQDE-KWLIRTEQFLNGSVV-FFRDNVIYEAACQ 299

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365
               CN DQR+FK+ F+R LG+T+ + P TRDTI   I TSA AAA++C+GGTDGHTCG+
Sbjct: 300 PNKNCNNDQRSFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTCGM 359

Query: 366 NWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQ 425
           +W  +  DGYYGLGEQM+ALE + N    D P PY   NGG+S G   AG     TN+  
Sbjct: 360 DWVWKGWDGYYGLGEQMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTNL-- 417

Query: 426 NNLNIKKGDRAGAAIITAVI-LSVLTGGAVWML 457
           + L+I  G +AGA+IIT ++ +S+LT GA+W++
Sbjct: 418 SPLHITAGSKAGASIITCIVSISILT-GAMWLV 449

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  454 bits (1168), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 239/449 (53%), Positives = 300/449 (66%), Gaps = 8/449 (1%)

Query: 10  ILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYY 69
           +LS   + +S F     ++LD     S+ +ATAL+  G++DYY G +YG TVGMF  PYY
Sbjct: 6   LLSGLVSLVSVF----GLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSDPYY 61

Query: 70  WWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGI 129
           WW AG A+G ML+ W+  +NDTY + +  ALL QTG N DY+P NQ+  EGNDDQ  WGI
Sbjct: 62  WWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGI 121

Query: 130 TVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNT 189
            VM A ER F +P D KP WL + QAVFNTM  RWDSE CGGGLRWQIF WNSGY+YKNT
Sbjct: 122 AVMQAAERKFPNPPDDKPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDYKNT 181

Query: 190 VSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDI 249
           VSN  LF IAARL RYTGN +Y++ AE+V+DW+ DV  +       V+DG  I+ NCT +
Sbjct: 182 VSNGALFHIAARLARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSINDNCTTV 241

Query: 250 TKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGT 309
           TK +WTYN G++L G AY++N T G+  W       LN ++  FF +SI+YE+ACQ   T
Sbjct: 242 TKYQWTYNQGLMLSGSAYLFNMT-GSDLWHERTHAFLNASRV-FFNNSILYEAACQGPNT 299

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQK 369
           CNTDQR+FK+ F+R LG T+ + P TR  I   + TSA AAAKSC+GGTDGHTCGLNW +
Sbjct: 300 CNTDQRSFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGLNWFR 359

Query: 370 QTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLN 429
              DG YGLGEQM+ALEV+ N     R  PY   NGG S GD  AG     TN+    L+
Sbjct: 360 DDWDGMYGLGEQMAALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNLAP--LH 417

Query: 430 IKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           I  G RAGA IITA+I   +   A+W+++
Sbjct: 418 ITGGSRAGAGIITAIIGISIIACALWLVY 446

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  451 bits (1160), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 221/450 (49%), Positives = 296/450 (65%), Gaps = 4/450 (0%)

Query: 9   MILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68
            ++ +     S F   +A+ +D  +  SI +A++L+  G++DYY G +YG T+GMF  PY
Sbjct: 2   FVMRLLAALASTFACANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDPY 61

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128
           YWW AG A+G ML+ W+  +NDTY +++  ALL Q G++ DY+P NQ+  EGNDDQ  WG
Sbjct: 62  YWWEAGGAWGCMLDYWWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFWG 121

Query: 129 ITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           I  M A ERNFT+P   +P WL + QAVFNTM  RWD+  C GGLRWQIF WN+GY+YKN
Sbjct: 122 IAAMTAAERNFTNPPSDQPQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYKN 181

Query: 189 TVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           TVSN  LF +AARL RYTGN +Y++ A++V+DW+  VG +   ++  V+DG  I  NC +
Sbjct: 182 TVSNGALFNLAARLARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNCAN 241

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYG 308
           IT  +W+YNHG++L G AY+YN T    +W     + LN A S F+ +S++YE ACQ   
Sbjct: 242 ITGYQWSYNHGLMLSGCAYLYNMTKDE-KWGNRTFEYLNSA-SIFYNNSVLYEVACQTVN 299

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQ 368
            CNTDQR+FK+ F+R LG+T+ + P  RD     I  SA  AA+SC+GG DGHTCG+NW 
Sbjct: 300 KCNTDQRSFKAYFTRFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGINWF 359

Query: 369 KQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNL 428
               DG YGLGEQMSALE + N    +RP PY   NGG+S GD  AG   S TN+  + L
Sbjct: 360 YDGWDGMYGLGEQMSALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL--SPL 417

Query: 429 NIKKGDRAGAAIITAVILSVLTGGAVWMLF 458
           +I  G RAGA IIT VI   +   A+W++ 
Sbjct: 418 DITAGSRAGAGIITCVIGISILSCALWLIL 447

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  446 bits (1148), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 223/434 (51%), Positives = 288/434 (66%), Gaps = 6/434 (1%)

Query: 27  MDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWFL 86
           ++LD     SI +AT+L+  G++DYY G  YG TVG F  PYYWW AG A+G +L+ W+ 
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 87  CENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGDGK 146
            EN TY +LL D+LL Q G +  Y P N+T  EGNDDQ  WG+ VM A ER   +P   +
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPADQ 141

Query: 147 PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYT 206
           P  LA+ QAVFNTM  RWD E C GGLRWQIF WN GY+YKN+VSN  LF +AARL RYT
Sbjct: 142 PQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYT 201

Query: 207 GNTTYLEVAEQVFDWLVDVGY--VVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGG 264
           GN TYLE AE+V+DW+  VG   +V  +   V+DG +I+ NCT++ K++WTYNHG+++ G
Sbjct: 202 GNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAG 261

Query: 265 LAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFSRM 324
            A++YN T     W     + L+ A+  F  +  +YE+ CQ    CN DQR+FK+ FSR 
Sbjct: 262 CAFIYNHTQDE-LWHQRTLRFLDSAR-IFLSNDTLYEAGCQGGDNCNIDQRSFKAYFSRF 319

Query: 325 LGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSA 384
           LGLT+ + P +R+TI   I+ SA+ AA SC+GG DGHTCGLNW     DG +GLGEQM+A
Sbjct: 320 LGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMAA 379

Query: 385 LEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAAIITAV 444
           LE+IQNL   +RPAPY   NGGTS GD  AG  +   N+    L+IK GDRAGA IITA+
Sbjct: 380 LEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENLPP--LDIKAGDRAGAGIITAL 437

Query: 445 ILSVLTGGAVWMLF 458
           I S      +W++ 
Sbjct: 438 IGSSFLACTLWLII 451

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  443 bits (1139), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 226/435 (51%), Positives = 296/435 (68%), Gaps = 5/435 (1%)

Query: 24  THAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLEN 83
           T+A+ L+    +S+ +A AL+  G++DYY G +YG T+GMF  PYYWW AG A+G ML+ 
Sbjct: 18  TNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYYWWEAGGAWGCMLDY 77

Query: 84  WFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPG 143
           W+  +NDTY +++Y+AL  QTG + DYIP NQ+  EGNDDQ  WGI  + A ERNFT+P 
Sbjct: 78  WYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGIAAITAAERNFTNPP 137

Query: 144 DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLG 203
             KP WL + QAVFNTM  RWDS+ C GGLRWQIF WNSGY+YKN+VSN  LF IAARL 
Sbjct: 138 PDKPQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARLA 197

Query: 204 RYTGNTTYLEVAEQVFDWLVDVGYVVLNDTAN-VFDGAEIDTNCTDITKIEWTYNHGIVL 262
           RYTGN +Y++ +E+V+DW++  G +    T   V DG  I+TNCTDIT  +WTYN G++L
Sbjct: 198 RYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETNCTDITPYQWTYNQGLLL 257

Query: 263 GGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFS 322
            G AY+YN T    +W     + LNG+   FF +S++YE+ACQ    CN DQR+FK+ F+
Sbjct: 258 AGCAYLYNFTQDE-KWLIRTNQFLNGS-GVFFNNSVIYEAACQPNKNCNNDQRSFKAYFA 315

Query: 323 RMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQM 382
           R LG+T+ + P TRDTI   I TSA AAA++C+GGTDGHTCG++W     DGYYGLGEQM
Sbjct: 316 RFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMDWNWNGWDGYYGLGEQM 375

Query: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAAIIT 442
           +ALE + N    D P PY   NGG+S G   AG     TN+    LNI  G +AGA IIT
Sbjct: 376 AALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL--GPLNITAGSKAGAGIIT 433

Query: 443 AVILSVLTGGAVWML 457
            V+   +   ++W++
Sbjct: 434 CVVGISILACSMWLV 448

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  442 bits (1138), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/429 (51%), Positives = 288/429 (67%), Gaps = 7/429 (1%)

Query: 8   KMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSP 67
           K+++S+  T   +F+A HA++LD  +  S+ +AT+L+  G++DYY G +YG T+GMF +P
Sbjct: 5   KVLISLLCTV--WFRAGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNP 62

Query: 68  YYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIW 127
           YYWW AG A+G M++ W+  +NDTY +++  AL  QTG N DY+P NQ+  EGNDDQ  W
Sbjct: 63  YYWWEAGGAWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFW 122

Query: 128 GITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           GI VM A ERNFT+P   +P WL + QAVFNTM  RWD + C GGLRWQIF WNSGY+YK
Sbjct: 123 GIAVMSAAERNFTNPPADRPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYK 182

Query: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNC 246
           N+VSN  LF I ARL R+TGN +Y+E AE+V+DW+  V  +  +   A V+DG  I  NC
Sbjct: 183 NSVSNGALFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVNIGDNC 242

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQD 306
           T +T ++WTYNHG++L G AY+YN T G  +W     + L  A   FF  ++M+E+ACQ 
Sbjct: 243 TKVTNLQWTYNHGLILSGCAYLYNYT-GDAKWYNRTERFLEYAYV-FFNRTVMFEAACQG 300

Query: 307 YGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLN 366
             TC TDQRTFK+ FSR LG+T+ + P T+ TI   +  SA  AA+SC+GG DGHTCG+N
Sbjct: 301 VHTCTTDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGIN 360

Query: 367 WQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQN 426
           W     DGYYGLGEQM ALEV+ N      P PY   NGG+S GD  AG     TN+  +
Sbjct: 361 WFYGGWDGYYGLGEQMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--S 418

Query: 427 NLNIKKGDR 435
            LNI  G R
Sbjct: 419 PLNITSGSR 427

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  436 bits (1121), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 219/406 (53%), Positives = 282/406 (69%), Gaps = 6/406 (1%)

Query: 11  LSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYW 70
           +S+     +      A+D+D  +  SI +AT+LI  G++DYY G +YG TVGMF  PYYW
Sbjct: 13  VSVLLALSAVVSKVAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYW 72

Query: 71  WHAGEAFGGMLE-NWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGI 129
           W AG A+G ML+ +WF+ +NDTY   +  A+L QTG + +YIP NQ+  EGNDDQ  WGI
Sbjct: 73  WEAGGAWGSMLDYSWFM-DNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGI 131

Query: 130 TVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNT 189
             M A ERNFT+P + KP WL + QAVFNTM  RWD+E CGGGLRWQIF WNSGY+YKNT
Sbjct: 132 AAMTAAERNFTNPPEDKPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNT 191

Query: 190 VSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNCTD 248
           VSN  LF +A+RL RYTGN +Y++ AE+V+DW+ DV +V+ N T   V+DG + + NC+ 
Sbjct: 192 VSNGALFHMASRLARYTGNQSYVDWAEKVYDWMWDV-HVISNSTYMFVYDGVDANDNCST 250

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDS-IMYESACQDY 307
           +T+ +WTYNHG++L G AY+YN T G   W     K++  A+ +F   + IMYE+ACQ  
Sbjct: 251 VTQYQWTYNHGLLLAGSAYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQAA 309

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367
            TCN DQR+FK+ FSR LGLT+ + P TR  I   + TSA AA KSC+GG DGHTCGLNW
Sbjct: 310 LTCNNDQRSFKAYFSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNW 369

Query: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDAN 413
            K   DG YGLGEQMSALE I N     +PAPY   NGG+SKG+++
Sbjct: 370 FKDGWDGMYGLGEQMSALECILNTRALMKPAPYTATNGGSSKGESS 415

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  436 bits (1120), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 218/447 (48%), Positives = 297/447 (66%), Gaps = 7/447 (1%)

Query: 15  FTFL-SFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHA 73
           F FL S+F +  A+D+D     ++ +A+AL+  G++DYY G +YG T+GMF  PYYWW A
Sbjct: 9   FGFLASWFPSASALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEA 68

Query: 74  GEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMG 133
           G A+  +++ WF  +NDTY + + +ALL Q+G N+DY+P NQ+ VEGNDDQ  WGI V+ 
Sbjct: 69  GGAWNTLIDYWFYMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLN 128

Query: 134 AVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNA 193
           A ER F +P D +P WL + QAVFNTM  RWD+  CGGGLRWQIFTWN+GY+YKNTVSN 
Sbjct: 129 AAERKFPNPPDDQPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSNG 188

Query: 194 CLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVL--NDTANVFDGAEIDTNCT-DIT 250
            LF IAARL  +TGN++Y++ AE+V+DW+ DV  +    +D   V+DG ++  NC+  +T
Sbjct: 189 ALFHIAARLAYFTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPVT 248

Query: 251 KIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTC 310
           +I WTYNHG+VL G AY+Y  T G   W       L  A   F+ DSI+YE +CQ   TC
Sbjct: 249 RIVWTYNHGLVLSGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEYSCQQSKTC 307

Query: 311 NTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQ 370
           N DQR+FKS +S  L  T+ + P  R+ I  ++  +A AAA++C GG DGHTCG+NW ++
Sbjct: 308 NVDQRSFKSYYSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWNQK 367

Query: 371 TNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNI 430
             DG YGLGEQM+ALE +      ++PAPY   NGG S GD  AG  ++ TN+    L+I
Sbjct: 368 GWDGQYGLGEQMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTNL--KPLHI 425

Query: 431 KKGDRAGAAIITAVILSVLTGGAVWML 457
             G RAGA IIT V+   +    +W++
Sbjct: 426 TAGSRAGAGIITCVVGFSIIASFLWLV 452

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  435 bits (1118), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 216/435 (49%), Positives = 292/435 (67%), Gaps = 9/435 (2%)

Query: 26  AMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWF 85
           A++LD    +S+  AT+LI  G+LDYY G   G T+GMF SPYYWW AG A+G +++ WF
Sbjct: 21  ALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYWWEAGAAWGALIDYWF 80

Query: 86  LCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGDG 145
             ENDTY +++  ALL Q G   DY+P NQ+  EGNDDQ  WGI VM A E+ F +P   
Sbjct: 81  YMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIAVMSAAEKGFPNPDPD 140

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205
           +P WLA+ QAVFNTM  RWDS  C GGLRWQIFTWN+GY+YKN+VSN  LF +AARL RY
Sbjct: 141 QPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNSVSNGALFHLAARLARY 200

Query: 206 TGNTTYLEVAEQVFDWLVDVGYVVLNDTAN---VFDGAEIDTNCTDITKIEWTYNHGIVL 262
           TGN +Y + AE+V+DW+  V   ++N T +   V+DGA I  NC+  + ++W+YNHG++L
Sbjct: 201 TGNQSYADWAEKVYDWMASV--QLINQTGDWTFVYDGAFIHDNCSRPSVLQWSYNHGLIL 258

Query: 263 GGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFS 322
           GG AY+ + T G+  W     ++L  A S FF + ++ E ACQ+ GTCNTDQR+FK+ F 
Sbjct: 259 GGCAYLTDFT-GSDVWHNRTLRLLRSA-SIFFPNGVVTEVACQEAGTCNTDQRSFKAYFM 316

Query: 323 RMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQM 382
           R LGLT+ + P +R+     I+ SA+ AA SC+GG DGHTCG+N+ + + D  YGLGEQ+
Sbjct: 317 RFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYSRGSYDESYGLGEQL 376

Query: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAAIIT 442
           +ALE IQNL   ++ +P     GGTS G+  AG N +   +  + L+I   DRAGA IIT
Sbjct: 377 AALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL--SPLDISNADRAGAGIIT 434

Query: 443 AVILSVLTGGAVWML 457
           A++   L    VW++
Sbjct: 435 ALVGFSLISCIVWLV 449

>KAFR0B04690 Chr2 complement(977296..981438) [4143 bp, 1380 aa] {ON}
           Anc_2.317 YGL150C
          Length = 1380

 Score = 30.8 bits (68), Expect = 9.4,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 77  FGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQG 125
            G  +E   LC+    QE LY  L +Q  SNYD I +      G DD G
Sbjct: 832 LGDKIEIDVLCDLTQRQEKLYKVLKSQVSSNYDAIEN----AAGADDAG 876

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,789,828
Number of extensions: 2339956
Number of successful extensions: 5796
Number of sequences better than 10.0: 55
Number of HSP's gapped: 5836
Number of HSP's successfully gapped: 55
Length of query: 458
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 345
Effective length of database: 40,524,141
Effective search space: 13980828645
Effective search space used: 13980828645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)