Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YMR069W (NAT4)2.532ON28528515380.0
Smik_13.2482.532ON25525510551e-146
Skud_13.2252.532ON2542559071e-123
Suva_13.2442.532ON2572597051e-92
NCAS0D026402.532ON2602673652e-41
KAFR0A018502.532ON2562663591e-40
CAGL0K02981g2.532ON2782693314e-36
NDAI0I022702.532ON2772723226e-35
TDEL0A030602.532ON2442672935e-31
Kpol_1018.342.532ON2922382966e-31
TPHA0C041802.532ON2642022946e-31
SAKL0A09460g2.532ON2402492927e-31
KLTH0D06820g2.532ON2601552581e-25
KNAG0C058202.532ON2712322459e-24
ZYRO0B01980g2.532ON1881612346e-23
TBLA0G022202.532ON2782222381e-22
Kwal_26.80162.532ON2401581604e-12
Ecym_72562.532ON2431751332e-08
KLLA0E18569g2.532ON2151581047e-05
CAGL0H08547g3.331ON18165930.002
YPR051W (MAK3)3.331ON17665920.002
Suva_16.3793.331ON17565910.003
Smik_16.2933.331ON17565900.003
Agos_YGOB_Anc_2.5322.532ON187143880.007
Skud_16.3373.331ON17565860.012
SAKL0B07106g3.331ON17366810.053
KNAG0H008103.331ON17265760.26
ADL308C3.331ON17365750.28
NDAI0A053003.331ON187108740.40
NCAS0A110003.331ON17365740.46
NCAS0C012308.697ON195105730.61
TBLA0B025703.331ON18566730.68
KLTH0E14806g3.331ON17465720.82
Kwal_27.125343.331ON17465701.6
Smik_7.263.554ON91046711.9
TDEL0A067006.257ON189727702.8
Ecym_23758.697ON16635663.7
Ecym_21586.257ON189031693.8
Skud_12.4144.156ON60626684.1
TBLA0C020106.257ON190643676.2
CAGL0E06138g6.257ON188331667.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR069W
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   597   0.0  
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   410   e-146
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   353   e-123
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...   276   1e-92
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   145   2e-41
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   142   1e-40
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   132   4e-36
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   128   6e-35
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   117   5e-31
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   118   6e-31
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   117   6e-31
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   117   7e-31
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   103   1e-25
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    99   9e-24
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    95   6e-23
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    96   1e-22
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    66   4e-12
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    56   2e-08
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    45   7e-05
CAGL0H08547g Chr8 complement(836841..837386) [546 bp, 181 aa] {O...    40   0.002
YPR051W Chr16 (664960..665490) [531 bp, 176 aa] {ON}  MAK3Cataly...    40   0.002
Suva_16.379 Chr16 (671717..672244) [528 bp, 175 aa] {ON} YPR051W...    40   0.003
Smik_16.293 Chr16 (541652..542179) [528 bp, 175 aa] {ON} YPR051W...    39   0.003
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    39   0.007
Skud_16.337 Chr16 (629772..630299) [528 bp, 175 aa] {ON} YPR051W...    38   0.012
SAKL0B07106g Chr2 (615231..615752) [522 bp, 173 aa] {ON} similar...    36   0.053
KNAG0H00810 Chr8 complement(127161..127679) [519 bp, 172 aa] {ON...    34   0.26 
ADL308C Chr4 complement(154426..154947) [522 bp, 173 aa] {ON} Sy...    33   0.28 
NDAI0A05300 Chr1 complement(1194117..1194680) [564 bp, 187 aa] {...    33   0.40 
NCAS0A11000 Chr1 (2192214..2192735) [522 bp, 173 aa] {ON} Anc_3....    33   0.46 
NCAS0C01230 Chr3 complement(227981..228568) [588 bp, 195 aa] {ON...    33   0.61 
TBLA0B02570 Chr2 complement(587631..588188) [558 bp, 185 aa] {ON...    33   0.68 
KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} simil...    32   0.82 
Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR05...    32   1.6  
Smik_7.26 Chr7 (53924..56656) [2733 bp, 910 aa] {ON} YGL233W (REAL)    32   1.9  
TDEL0A06700 Chr1 complement(1169248..1174941) [5694 bp, 1897 aa]...    32   2.8  
Ecym_2375 Chr2 complement(729086..729586) [501 bp, 166 aa] {ON} ...    30   3.7  
Ecym_2158 Chr2 (294821..300493) [5673 bp, 1890 aa] {ON} similar ...    31   3.8  
Skud_12.414 Chr12 (728853..730673) [1821 bp, 606 aa] {ON} YLR330...    31   4.1  
TBLA0C02010 Chr3 complement(469989..475709) [5721 bp, 1906 aa] {...    30   6.2  
CAGL0E06138g Chr5 complement(611835..617486) [5652 bp, 1883 aa] ...    30   7.7  

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/285 (100%), Positives = 285/285 (100%)

Query: 1   MRSSVYSENTYNCIRTSKEHLTERRRVAMAPMFQHFLNLCVEKFPESIEHKDTDGNGNFT 60
           MRSSVYSENTYNCIRTSKEHLTERRRVAMAPMFQHFLNLCVEKFPESIEHKDTDGNGNFT
Sbjct: 1   MRSSVYSENTYNCIRTSKEHLTERRRVAMAPMFQHFLNLCVEKFPESIEHKDTDGNGNFT 60

Query: 61  TAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKSRGDQVLDACVQLIDKHLGAKYRRAS 120
           TAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKSRGDQVLDACVQLIDKHLGAKYRRAS
Sbjct: 61  TAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKSRGDQVLDACVQLIDKHLGAKYRRAS 120

Query: 121 RIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLGAFTSFMLTEETGLVEGDALHEVSVP 180
           RIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLGAFTSFMLTEETGLVEGDALHEVSVP
Sbjct: 121 RIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLGAFTSFMLTEETGLVEGDALHEVSVP 180

Query: 181 VIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLY 240
           VIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLY
Sbjct: 181 VIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLY 240

Query: 241 EALGFYRAPGSPAPASPTIRHTRHGGGRVVVPCDPLYYVYCLHMP 285
           EALGFYRAPGSPAPASPTIRHTRHGGGRVVVPCDPLYYVYCLHMP
Sbjct: 241 EALGFYRAPGSPAPASPTIRHTRHGGGRVVVPCDPLYYVYCLHMP 285

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  410 bits (1055), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 219/255 (85%), Gaps = 1/255 (0%)

Query: 32  MFQHFLNLCVEKFPESIEHKDTDGN-GNFTTAILEREIIYIPEDDTDSIDSVDSLKCINY 90
           MF  FL +C++ FPE++E+ +TDGN G  TT +L+RE+++IPE D++S D+++   C+NY
Sbjct: 1   MFHQFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNY 60

Query: 91  KLHKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD 150
           +LHKSRG+ +LD+CVQLID+HLGAKYRRASR MYGNRKPWKANKLAEMKS  LVYV YWD
Sbjct: 61  RLHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYWD 120

Query: 151 NGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDG 210
           NG L AF SFMLTEETGLVEGDA HEVSVPVIYLYEVHVA  HRGHGIGRRLLE ALC+G
Sbjct: 121 NGALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCEG 180

Query: 211 VARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHGGGRVV 270
           VARH R + + FFGVALTVFSDNTRARRLYEALGFYRAPGSPA  +PT R TRHGG RVV
Sbjct: 181 VARHVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSPAAGAPTTRPTRHGGERVV 240

Query: 271 VPCDPLYYVYCLHMP 285
           VP DPLYYVYCLHMP
Sbjct: 241 VPRDPLYYVYCLHMP 255

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  353 bits (907), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 217/255 (85%), Gaps = 2/255 (0%)

Query: 32  MFQHFLNLCVEKFPESIEHKDTDGNGNF-TTAILEREIIYIPEDDTDSIDSVDSLKCINY 90
           MF+ FL++C+++FPE++E+ +++ N    TT +L+REI+YIPE++ + +DS+D  +C NY
Sbjct: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGE-VDSIDGPQCTNY 59

Query: 91  KLHKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD 150
            LHKS GD VLD+CVQL+D+HLG KYRRASR MYGNR PWKANKLAEMKSAGL+YV YW 
Sbjct: 60  NLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG 119

Query: 151 NGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDG 210
           NG LGAF SFMLTEETGLVEGDA HEVSVPVIYLYE+HVA AHRGHG+GRRLLE ALC+G
Sbjct: 120 NGALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEG 179

Query: 211 VARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHGGGRVV 270
           VAR  RR+  +FFGVALTVF DNTRARRLYEA+GF RAPGSPAPA+P +R TRHG  RVV
Sbjct: 180 VARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRAPGSPAPAAPALRPTRHGRKRVV 239

Query: 271 VPCDPLYYVYCLHMP 285
           V  DPLYYVYCLHMP
Sbjct: 240 VARDPLYYVYCLHMP 254

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score =  276 bits (705), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 155/259 (59%), Positives = 183/259 (70%), Gaps = 9/259 (3%)

Query: 32  MFQHFLNLCVEKFPESIEHKDTDG-NGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINY 90
           MFQ FL++C+E+FP+++++  +D  NG+ TT +L R+++Y+PEDD D      + +C+NY
Sbjct: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGID-TPECMNY 59

Query: 91  KLHKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD 150
           KLHK+ GDQ L +CVQL+D+HLGAKYRRASR MYGNR PWKANKLAEMKSAGLVYVCYW 
Sbjct: 60  KLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWG 119

Query: 151 NG-----VLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEH 205
           N       LGAF SFMLTEETGLVEGD  HE SVPVIYLYEVH    HRG G+GRRLL  
Sbjct: 120 NDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVH--XXHRGRGLGRRLLAK 177

Query: 206 ALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHG 265
           ALC+GVA   RR CD+ FGVALTVF DNTRARRLYE+                       
Sbjct: 178 ALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXXXXX 237

Query: 266 GGRVVVPCDPLYYVYCLHM 284
           G    V  DPLYYVYCL +
Sbjct: 238 GRAAAVARDPLYYVYCLRL 256

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  145 bits (365), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 138/267 (51%), Gaps = 27/267 (10%)

Query: 33  FQHFLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKL 92
           F+ F ++ +E+FP ++E    +         L+R+I+ I  D+  S    +S   +  K 
Sbjct: 4   FEAFSHMILEEFPLTLEVTLQE-----QLKCLKRKILIIEPDNCTS--GKNSQDVVYMKC 56

Query: 93  HKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD-- 150
              +GD++LD  + ++D +LG KY + S+ +Y N +PWK NKL EM+S GLVYV YWD  
Sbjct: 57  STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEE 116

Query: 151 NGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDG 210
           +     F SFMLTEE G  E D L    + V+YLYE+ +  + R   +G RLL   L D 
Sbjct: 117 SDEPMLFLSFMLTEEDGFTEDDKL----LSVVYLYEIQILPSLRNRKLGTRLLAEHLQDA 172

Query: 211 VAR----HTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHGG 266
            +R    +   +     G+ LTVFSDN  A + Y+++G    P SP      +   R  G
Sbjct: 173 CSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRG 232

Query: 267 ---------GRVVVPCDPLYYVYCLHM 284
                    GR +V   P+YY++ L +
Sbjct: 233 MAQNISTSVGRTIVQ-KPIYYLFYLPL 258

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  142 bits (359), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 142/266 (53%), Gaps = 28/266 (10%)

Query: 32  MFQHFLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDS--IDSVDSLKCIN 89
           +F  FL +  ++FP+ +  K  +         L+R+I+YI  +D ++   DSV + +   
Sbjct: 6   IFNGFLKIVSDEFPKELRTKGQN---------LKRKILYIASEDEENKESDSVINEQDDL 56

Query: 90  YKLHKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW 149
            K  +  G ++LD+ ++++D +LG KY + SR +Y N   WK NKL EMKS GL+YV YW
Sbjct: 57  TKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYW 116

Query: 150 ----DNGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLE- 204
               +      F SFMLTEE  +V  D + + S  VIYLYE+ +   +RG  +G RL++ 
Sbjct: 117 KEEAEKKTCALFLSFMLTEEDFVV--DDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIKG 172

Query: 205 -HALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTI--RH 261
              +C  +A+   R      G+ LTVFSDN RA + YE +G     GSP      I  R 
Sbjct: 173 LSNVCQ-IAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRK 231

Query: 262 TRHGGGRVVVPC--DPLYYVYCLHMP 285
           TR    R  +     P+YY+  L++P
Sbjct: 232 TRTSVNRKTLKVVRKPIYYL--LYLP 255

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  132 bits (331), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 83/269 (30%), Positives = 136/269 (50%), Gaps = 34/269 (12%)

Query: 36  FLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKS 95
           FL+  ++ FP+ I  K ++   +     L+R+++ I  DD    +   + + +    H  
Sbjct: 15  FLHHVLDCFPKVITTK-SNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHIK 73

Query: 96  RGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW-----D 150
               +L + ++L+D++LG KY  +S+ MYGN+KPWK NK+ EM + G++YV YW     +
Sbjct: 74  ESKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDE 133

Query: 151 NGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDG 210
           + V   F SFMLTEE  L   D +      VI+LYE+ ++   R  G+G+  L + L   
Sbjct: 134 HTVPLLFLSFMLTEEENLTHNDPVSS----VIFLYEIQISKELRKQGLGQYFLSNCLF-- 187

Query: 211 VARHTRRMCDN--------FFGVALTVFSDNTRARRLYEALGFYRAPGSPAPA------- 255
             +  +R+ DN        F G+ LTVF+DN  A  LY+ LG    P SP          
Sbjct: 188 --QCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTR 245

Query: 256 ----SPTIRHTRHGGGRVVVPCDPLYYVY 280
               +    + ++   R+++   PLYY+Y
Sbjct: 246 RRTRNSRKINNKNESPRILIK-KPLYYMY 273

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  128 bits (322), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 128/272 (47%), Gaps = 32/272 (11%)

Query: 36  FLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKS 95
            LN+  E+FP  ++  D             R I + P  D  SI    S +  N      
Sbjct: 9   LLNIVCEEFPTILQSADG-------VTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQ 61

Query: 96  RGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLG 155
           +   VL+  + ++D +LGAKY + S+ +Y N K WK+NKL EM S GL+YV YWD     
Sbjct: 62  QRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQE 121

Query: 156 A--FTSFMLTEETGLV-------EGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLE-- 204
              F SFMLTE  G +       + +  ++  + VIYLYE+ +    RG GIG +LL   
Sbjct: 122 PLLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVH 181

Query: 205 -HALCDG-VARHTRRMCD-NFFGVALTVFSDNTRARRLYEALGFYRAPGSPAP------- 254
            H  C   V ++ +        G+ LTVFSDN +A   Y+++G    P SP         
Sbjct: 182 LHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEK 241

Query: 255 -ASPTIRHTRHGGGRVV---VPCDPLYYVYCL 282
             +  +R   + G R V   +   P+YY+Y L
Sbjct: 242 RQTRNLRRINNAGTREVTKQIIKKPVYYLYYL 273

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  117 bits (293), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 90/267 (33%), Positives = 128/267 (47%), Gaps = 54/267 (20%)

Query: 46  ESIEHKDTDGNGNFTTAI------LEREIIYIPEDDTDSIDSVDSLKCINYKLHKSRGDQ 99
           ES+       N NF T I      L R+++ I   DT+    V++ +CI+Y       ++
Sbjct: 4   ESLNDVVKYANQNFPTTINAAGIQLTRKLLAI---DTEEY-PVETDQCISYVHSPREAEK 59

Query: 100 VLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLGA--- 156
           +L   ++++D++LG KY  +SR +Y N +PW+ NK  EM + GLVYV Y       A   
Sbjct: 60  LLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQR 119

Query: 157 ---------FTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHAL 207
                    F SFMLTEE GLV  D     +  V+YLYE+ +    R  G+  RL    L
Sbjct: 120 RNAPFSPLLFLSFMLTEEDGLVADDPTEVWT--VLYLYELQLLPRVRRLGLAARL----L 173

Query: 208 CDGVARHTRRMC----------DNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASP 257
            D +A+  R++C            FFG+ LTVF+DN  A RLYE+LG   A  SP     
Sbjct: 174 GDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP----- 228

Query: 258 TIRHTRHGGGRVVVPCDPLYYVYCLHM 284
                       V+  D LY +Y L +
Sbjct: 229 -----------TVLDTDSLYRLYVLQL 244

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  118 bits (296), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 119/238 (50%), Gaps = 12/238 (5%)

Query: 35  HFLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKLHK 94
           H +++    FPE++E  + + + +    +L R++I I +   + ID  +++  ++Y    
Sbjct: 6   HLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAI-DSKNNQIDVRNNV--LSYYKDN 62

Query: 95  SRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVL 154
            + D VL+  + ++D +LG  Y   S  +Y N KPWK NK+ EMKS GL+YV Y D+   
Sbjct: 63  VKCDVVLNKLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITK 122

Query: 155 GA--FTSFMLTEETGLV-----EGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHAL 207
               F SFM+T++  LV     + + L   +  VIYLYE+ +    R   +G  L+ + L
Sbjct: 123 EPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYL 182

Query: 208 CDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPAS--PTIRHTR 263
              +    +    N   + LTVFS+N  A   Y+ +G    P SP      P  R TR
Sbjct: 183 KKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTR 240

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  117 bits (294), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 107/202 (52%), Gaps = 10/202 (4%)

Query: 56  NGNFTTAILEREIIYIPEDDTDSIDSVD--SLKCINYKLHKSRGDQVLDACVQLIDKHLG 113
           N N T  +  ++II +  +  D  +S +  + + + Y  +K   +      + ++D +LG
Sbjct: 22  NKNLTKLV--KKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIEFSKILTILDNNLG 79

Query: 114 AKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW---DNGVLGAFTSFMLTEETGLVE 170
             Y   ++ +YGN KPWK NK+ EMK+ GL+YV Y    +   +  + SF LT+E+G + 
Sbjct: 80  DIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSFTLTKESGFLP 139

Query: 171 GDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVF 230
                +V  PVIYLYE+ +    R +G+G +L+   L D +      +  +  G+ LTVF
Sbjct: 140 D---IDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKDIIGIELTVF 196

Query: 231 SDNTRARRLYEALGFYRAPGSP 252
           SDNT A R YE +G    P SP
Sbjct: 197 SDNTNAIRFYETIGMKLTPDSP 218

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  117 bits (292), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 122/249 (48%), Gaps = 21/249 (8%)

Query: 36  FLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKS 95
            L   ++ FP SI  KD    G+  T    R+++ I   D  S     S +   +   + 
Sbjct: 9   LLPYVLDSFPTSITLKD----GSLAT----RKVLVI---DEPSSGIAPSGQVCTWSGDRQ 57

Query: 96  RGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLG 155
             + +L   ++++D +LG+KYR  S  +YGN + W  NKL EM++ GLVYV Y+      
Sbjct: 58  SSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSPL 117

Query: 156 AFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHT 215
            F SF+LT+E   +         V V+YLYE+ +    +G  +G ++L+  L + V  H+
Sbjct: 118 MFLSFLLTDEPDFLPD------PVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTV--HS 169

Query: 216 RRMCDNFF-GVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTI-RHTRHGGGRVVVPC 273
               D    G+ LTVFSDN  A  LY ++G   APGSP     T  R TRH    +    
Sbjct: 170 LSRLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVS 229

Query: 274 DPLYYVYCL 282
            P YY+  L
Sbjct: 230 RPDYYLMFL 238

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 87/155 (56%), Gaps = 8/155 (5%)

Query: 100 VLDACVQLIDKHLGAKYRRASRIMYG-NRKPWKANKLAEMKSAGLVYVCYWDN-GVLGAF 157
           +LD  + L+  +LG  Y R +R +YG  R+ W A K AEM++ GLVYV Y D+      F
Sbjct: 77  LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHSQPLVF 136

Query: 158 TSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRR 217
            S +LT+E  L +     E++  V+YL+E+HV+   RG G+G  LL   L  G      R
Sbjct: 137 MSLLLTDEPELGQ-----ELAARVLYLFEIHVSDIIRGQGLGTHLLRDCL-GGTLASLSR 190

Query: 218 MCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSP 252
              +  G  LTVFS+N RA RLY ALG + A  SP
Sbjct: 191 ASPSVLGAELTVFSENQRALRLYLALGMHVAAWSP 225

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 99.0 bits (245), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 113/232 (48%), Gaps = 30/232 (12%)

Query: 36  FLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIP---EDDTDSIDSVDSLKCINYKL 92
           FL     +FP  I     D NG  T   L+R I YI    +DD +S + + S       L
Sbjct: 9   FLQTVDRQFPTVI---GCDLNG--TAVSLKRRIHYIEGVGDDDDESHNKIMSYPGGLPPL 63

Query: 93  H-------KSRGDQVLDACV----QLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSA 141
                    ++ D   + C+    +++D +LG  Y R SR +YGN K W+ NK  EM SA
Sbjct: 64  PPTTDDNPTAKEDNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSA 123

Query: 142 GLVYVCYW-DNGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGR 200
            LVYV YW  +     +TSFMLTEE G+    +  E +  V+YLYE+ +  A R   +G+
Sbjct: 124 QLVYVSYWVSDSEPVLYTSFMLTEENGI----SSIESTDRVVYLYEIQLIEAIRRQKLGQ 179

Query: 201 RLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSP 252
            ++ +      A  +  +      VALTVFSDN +A + YE L F     SP
Sbjct: 180 AIVSY--LTECALESPEVA----AVALTVFSDNEKALKFYERLNFTYTIDSP 225

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 94.7 bits (234), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 88/161 (54%), Gaps = 18/161 (11%)

Query: 97  GDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW--DNGVL 154
            D++L+  +QLI+ +LG+ Y + ++ +Y N K W++NK  EM S  L +V YW  ++  L
Sbjct: 17  NDKILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESNEL 76

Query: 155 GAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARH 214
             F S M  EE+ +VEG+  +     +IYLYE+HVA   R    G+ +L +AL       
Sbjct: 77  VCFCSIMPCEES-IVEGEMSN-----IIYLYEIHVAPEWRNQKFGKSIL-NAL------- 122

Query: 215 TRRMCDN--FFGVALTVFSDNTRARRLYEALGFYRAPGSPA 253
             ++C      G+ LTVFS N RA   Y   GF  +  SP+
Sbjct: 123 KEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPS 163

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 96.3 bits (238), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 111/222 (50%), Gaps = 25/222 (11%)

Query: 44  FPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCIN---YKLHKSRGDQV 100
           FP+SI  K            LER+I  I + + +S+ S  +    +   Y   K R +  
Sbjct: 14  FPKSISTK--------QGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNPT 65

Query: 101 LDACV-----QLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD--NGV 153
           ++  +     QLID++LG  Y++ S+ +Y N   W  NK  EM ++ ++Y+ YWD     
Sbjct: 66  VENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYWDCKQNS 125

Query: 154 LGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVAR 213
           +  F S +  EET ++E +   E    V+YLYE+H+   ++  GIG RL++  L + + +
Sbjct: 126 VALFLSILSCEETYILENNDQGE----VLYLYEIHITKEYQRQGIGERLIKDYLIEKLIK 181

Query: 214 --HTRRMCDNFFGVALTVFSDNTRARRLY-EALGFYRAPGSP 252
                R  +NF G+ LTVFS+N  A+  Y   +      GSP
Sbjct: 182 PLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSP 223

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 78/158 (49%), Gaps = 9/158 (5%)

Query: 100 VLDACVQLIDKHLGAKYRRASRIMYGNR-KPWKANKLAEMKSAGLVYVCY----WDNGVL 154
           +L+  + L+D +LG  Y + ++ +YG++   WK  K  EM + GLVYV Y     + G  
Sbjct: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111

Query: 155 GAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARH 214
           G   +F+    T   E   L      V+YL E+HVA   RG G+G  LL   +  G  R 
Sbjct: 112 GLPLAFLSLLLTDEPE---LGPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVA-GTVRG 167

Query: 215 TRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSP 252
            RR      G  LTVF+DN  A RLY  LG   A  SP
Sbjct: 168 ARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSP 205

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 75/175 (42%), Gaps = 36/175 (20%)

Query: 107 LIDKHLGAKYRRASRIMY---GNRKPWKANKLAEMKSAGLVYVCYWDN---GVLGAFTSF 160
           +I++ LG  Y   + ++Y      +PW+A+K AE++  G  +V Y      G +  F S 
Sbjct: 53  IIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSL 112

Query: 161 MLTEETGLVEGD----------------------ALHEVSVP----VIYLYEVHVASAHR 194
           +  +E     G+                      A  E   P    V+Y+ E+HV+ + +
Sbjct: 113 LFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHVSPSFQ 172

Query: 195 GHGIGRRLLEHALCD-GVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRA 248
             G+G  +L   LC   + +H +       G+ LTVF+ N +A  LY   GF  A
Sbjct: 173 NQGLGSCML---LCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTA 224

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 72/158 (45%), Gaps = 20/158 (12%)

Query: 99  QVLDACVQLIDKHLGAKYRRASRIMY---------GNRKPWKANKLAEMKSAGLVYVCYW 149
             L  C+ +I ++L   Y      +Y         GN K W   K  EM    LVY+  +
Sbjct: 47  STLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEMLDKDLVYIVLF 105

Query: 150 --DNGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHAL 207
             D   +  FTS  L++     E D   +++ P ++LYE+H+   ++  G+G  L+ + L
Sbjct: 106 KRDTTKIVGFTSVALSDPLN-PELDH-SKLNRPCLFLYEIHLMGEYQSRGLG-SLIFNGL 162

Query: 208 CDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGF 245
              +AR     C +   + L VF+ N  A R Y+ LGF
Sbjct: 163 LIPLARDL--TCPS---IELCVFTANDVACRWYKRLGF 195

>CAGL0H08547g Chr8 complement(836841..837386) [546 bp, 181 aa] {ON}
           similar to uniprot|Q03503 Saccharomyces cerevisiae
           YPR051w MAK3
          Length = 181

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + VASA+RGHGI +RL++  L     +     CD    V L     N  A  LYE 
Sbjct: 90  YIGMLAVASAYRGHGIAKRLVQITL----EKMAEMQCDE---VMLETEVSNVAALNLYEG 142

Query: 243 LGFYR 247
           +GF R
Sbjct: 143 MGFIR 147

>YPR051W Chr16 (664960..665490) [531 bp, 176 aa] {ON}  MAK3Catalytic
           subunit of N-terminal acetyltransferase of the NatC
           type; required for replication of dsRNA virus
          Length = 176

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V S +RGHGI ++L+E A    + +  R  CD    + L    +N+ A  LYE 
Sbjct: 80  YIGMLAVESTYRGHGIAKKLVEIA----IDKMQREHCDE---IMLETEVENSAALNLYEG 132

Query: 243 LGFYR 247
           +GF R
Sbjct: 133 MGFIR 137

>Suva_16.379 Chr16 (671717..672244) [528 bp, 175 aa] {ON} YPR051W
           (REAL)
          Length = 175

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V S +RGHGI ++L+E A    + +  R  CD    + L    +N  A  LYE 
Sbjct: 80  YIGMLAVESTYRGHGIAKKLVEIA----IDKMQRSRCDE---IMLETEVENVAALNLYEG 132

Query: 243 LGFYR 247
           +GF R
Sbjct: 133 MGFIR 137

>Smik_16.293 Chr16 (541652..542179) [528 bp, 175 aa] {ON} YPR051W
           (REAL)
          Length = 175

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V S +RGHGI ++L+E A+    + H    CD    + L    +N  A  LYE 
Sbjct: 80  YIGMLAVESTYRGHGIAKKLVEIAISKMQSAH----CDE---IMLETEVENVAALNLYEG 132

Query: 243 LGFYR 247
           +GF R
Sbjct: 133 MGFVR 137

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 60/143 (41%), Gaps = 23/143 (16%)

Query: 107 LIDKHLGAKYRRASRIMYGN-RKP--WKANKLAEMKSAGLVYVCYWDN-GVLGAFTSFML 162
           L+   L   YR  +R++Y   R P  W   K AE+     +++ Y D  G L  F S +L
Sbjct: 47  LVAAGLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYRDPAGRLACFISLLL 106

Query: 163 TEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNF 222
                            PV+Y+ E+HVA+  R  G+   LL+ A     A    R+    
Sbjct: 107 PGPAD------------PVLYILELHVAAPFRRRGLAAALLDAATRTARAAGLTRL---- 150

Query: 223 FGVALTVFSDNTRARRLYEALGF 245
               LTVF+ N  A  LY   GF
Sbjct: 151 ---ELTVFTANRPALALYARAGF 170

>Skud_16.337 Chr16 (629772..630299) [528 bp, 175 aa] {ON} YPR051W
           (REAL)
          Length = 175

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V S +RGHGI ++L+E A    + +  +  CD    + L    +N  A  LYE 
Sbjct: 80  YIGMLAVESTYRGHGIAKKLVEIA----IDKMQKAHCDE---IMLETEVENAAALNLYEG 132

Query: 243 LGFYR 247
           +GF R
Sbjct: 133 MGFIR 137

>SAKL0B07106g Chr2 (615231..615752) [522 bp, 173 aa] {ON} similar to
           uniprot|Q03503 Saccharomyces cerevisiae YPR051W MAK3
           Catalytic subunit of N-terminal acetyltransferase of the
           NatC type required for replication of dsRNA virus
          Length = 173

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 7/66 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + VA  HRG GI +RL+  A    + + +   CD    V L    +N  A  LYE 
Sbjct: 78  YIAMLAVAKKHRGQGIAKRLVTLA----IEKMSELGCDE---VMLETEVENMAALYLYEN 130

Query: 243 LGFYRA 248
           +GF R 
Sbjct: 131 MGFIRV 136

>KNAG0H00810 Chr8 complement(127161..127679) [519 bp, 172 aa] {ON}
           Anc_3.331 YPR051W
          Length = 172

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V S++RG GI +RL+       +    R  CD    + L    +N+ A  LYE 
Sbjct: 78  YIGMLAVESSYRGRGIAKRLVTKV----IEIMQREKCDE---IMLETEVENSAALNLYEQ 130

Query: 243 LGFYR 247
            GF R
Sbjct: 131 FGFIR 135

>ADL308C Chr4 complement(154426..154947) [522 bp, 173 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR051W
           (MAK3)
          Length = 173

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V  A+RG GI +RL+  A+    A+     CD    + L     N  A  LYEA
Sbjct: 79  YIAMLVVNDAYRGRGIAKRLITLAIEQMAAQG----CDE---IMLETECSNGAALHLYEA 131

Query: 243 LGFYR 247
           LGF R
Sbjct: 132 LGFVR 136

>NDAI0A05300 Chr1 complement(1194117..1194680) [564 bp, 187 aa] {ON}
           Anc_3.331 YPR051W
          Length = 187

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 23/108 (21%)

Query: 156 AFTSFMLTEETG----------------LVEGDALHEVSVPVIYLYEVHVASAHRGHGIG 199
           AF +F +TEE                  ++  + LH  S    Y+  + V S +RG GI 
Sbjct: 47  AFLAFDVTEEEKNNSNNVDVSDKVPIGCIICKNELHRFSRMRGYIGMLAVESHYRGQGIS 106

Query: 200 RRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYR 247
           ++L+E A    + +     CD    + L    +N  A  LYE +GF +
Sbjct: 107 KKLVEIA----ITQMESNGCDE---IMLETEVENVIALNLYENMGFIK 147

>NCAS0A11000 Chr1 (2192214..2192735) [522 bp, 173 aa] {ON} Anc_3.331
           YPR051W
          Length = 173

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V  ++RG GI ++L+E A    + +     CD    + L    +N  A +LYE 
Sbjct: 81  YIGMLAVEKSYRGRGIAKKLVEIA----INKMIDDGCDE---IMLEAEVENKVALQLYEG 133

Query: 243 LGFYR 247
           +GF R
Sbjct: 134 MGFIR 138

>NCAS0C01230 Chr3 complement(227981..228568) [588 bp, 195 aa] {ON}
           Anc_8.697 YOR253W
          Length = 195

 Score = 32.7 bits (73), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 44/105 (41%), Gaps = 19/105 (18%)

Query: 143 LVYVCYWDNGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRL 202
           L  +C  D+ V GA  + +L    G V            IY+  + VA   R H +G+ L
Sbjct: 80  LTRICVVDDAVAGAVKAKLLLGVNGTVLPRG--------IYIETLVVAKEWRSHRLGKLL 131

Query: 203 LEHALCDGVARHTRRMCDNFF--GVALTVFSDNTRARRLYEALGF 245
           L         +     C N+F   + + V ++N RA + Y + GF
Sbjct: 132 L---------KFIEDECQNYFLHNIIVHVSTNNKRAIKWYFSNGF 167

>TBLA0B02570 Chr2 complement(587631..588188) [558 bp, 185 aa] {ON}
           Anc_3.331 YPR051W
          Length = 185

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V S +RG+GI ++L+  A+   +A      CD    + L    +N  A  LYE 
Sbjct: 79  YIGMLAVESKYRGNGIAKKLVNIAIEKMIADG----CDE---IMLETEVENKAALNLYER 131

Query: 243 LGFYRA 248
           +GF R 
Sbjct: 132 MGFIRV 137

>KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} similar
           to uniprot|Q03503 Saccharomyces cerevisiae YPR051W MAK3
           Catalytic subunit of N-terminal acetyltransferase of the
           NatC type required for replication of dsRNA virus
          Length = 174

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + V   +R  GI ++L+E A    + +     CD    + L    +NT A +LYE 
Sbjct: 77  YIGMLAVDQKYRRRGIAKKLVEQA----IQKMQEIGCDE---IMLETEVENTTALQLYEG 129

Query: 243 LGFYR 247
           +GF R
Sbjct: 130 MGFIR 134

>Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR051W
           (MAK3) - N-acetyltransferase [contig 260] FULL
          Length = 174

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 183 YLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEA 242
           Y+  + VA  +R  GI ++L+E A    + +     CD    V L    +N  A +LYE 
Sbjct: 77  YIGMLAVAQTYRRRGIAKKLVEVA----IEKMQAIGCDE---VMLETEVENKAALKLYEG 129

Query: 243 LGFYR 247
           +GF R
Sbjct: 130 MGFIR 134

>Smik_7.26 Chr7 (53924..56656) [2733 bp, 910 aa] {ON} YGL233W (REAL)
          Length = 910

 Score = 32.0 bits (71), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 21/46 (45%)

Query: 133 NKLAEMKSAGLVYVCYWDNGVLGAFTSFMLTEETGLVEGDALHEVS 178
           NK  E++   L+Y   W     GA+    L   TG   G A HE+S
Sbjct: 333 NKEYELRKTKLIYPLIWKKNKTGAYQMDSLLRGTGTTSGPASHEIS 378

>TDEL0A06700 Chr1 complement(1169248..1174941) [5694 bp, 1897 aa]
           {ON} Anc_6.257 YPL231W
          Length = 1897

 Score = 31.6 bits (70), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 83  DSLKCINYKLHKSRGDQVLDACVQLID 109
           D  K  NYKL KS G+Q+++ C Q+ID
Sbjct: 467 DESKGDNYKLAKSLGEQLIENCKQVID 493

>Ecym_2375 Chr2 complement(729086..729586) [501 bp, 166 aa] {ON}
           similar to Ashbya gossypii AAL102C
          Length = 166

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 22/35 (62%)

Query: 172 DALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHA 206
           D + +  +P +++  + V  A+RG G+G +LLE+ 
Sbjct: 73  DKISKTELPGVHIETLDVLKAYRGKGVGSKLLEYV 107

>Ecym_2158 Chr2 (294821..300493) [5673 bp, 1890 aa] {ON} similar to
           Ashbya gossypii AFL138W
          Length = 1890

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 79  IDSVDSLKCINYKLHKSRGDQVLDACVQLID 109
           I   D     NYKL K+ G Q++D C Q+ID
Sbjct: 457 ISKTDESNGENYKLVKTLGSQLIDNCKQVID 487

>Skud_12.414 Chr12 (728853..730673) [1821 bp, 606 aa] {ON} YLR330W
           (REAL)
          Length = 606

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 42  EKFPESIEHKDTDGNGNFTTAILERE 67
           E+ PE++E+K+TD NG  T  ++E E
Sbjct: 406 EQIPENLENKNTDVNGQTTNVLMETE 431

>TBLA0C02010 Chr3 complement(469989..475709) [5721 bp, 1906 aa] {ON}
           Anc_6.257 YPL231W
          Length = 1906

 Score = 30.4 bits (67), Expect = 6.2,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 79  IDSVDSLKCINYKLHKSRGDQVLDACVQLIDKHLGAKYRRASR 121
           + + D+ K  NY+L K+ G+Q+++ C Q+ID  +   YR  S+
Sbjct: 461 VSNTDTSKGENYQLVKTLGEQLIENCKQVID--IDPVYRDISK 501

>CAGL0E06138g Chr5 complement(611835..617486) [5652 bp, 1883 aa]
           {ON} highly similar to uniprot|P19097 Saccharomyces
           cerevisiae YPL231w FAS2
          Length = 1883

 Score = 30.0 bits (66), Expect = 7.7,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 79  IDSVDSLKCINYKLHKSRGDQVLDACVQLID 109
           +   D  K  NYKL K  GDQ+++ C Q++D
Sbjct: 455 VSKTDVSKGENYKLVKELGDQLIENCKQVLD 485

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,845,848
Number of extensions: 1315205
Number of successful extensions: 2895
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2916
Number of HSP's successfully gapped: 47
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)