Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML118W (NGL3)8.850ON50550526530.0
Smik_13.168.850ON50249719160.0
Suva_13.258.850ON50247919130.0
Skud_13.238.850ON49849819070.0
KLTH0C03608g8.850ON49547410521e-138
TDEL0B001908.850ON49247510071e-131
NCAS0B002708.850ON47646910021e-131
TBLA0B029008.850ON52047510031e-130
Kwal_27.102048.850ON4944489951e-130
YMR285C (NGL2)8.850ON5154759841e-128
Smik_13.5018.850ON5154759831e-127
Suva_13.4758.850ON5154759781e-127
CAGL0I02684g8.850ON4934729751e-127
Kpol_237.18.850ON5034829761e-127
NDAI0E002608.850ON4984819711e-126
Skud_13.4588.850ON5144759701e-125
TPHA0I003208.850ON5294569681e-125
NCAS0C003108.850ON5564739671e-124
KAFR0L019608.850ON5114749401e-121
SAKL0D01166g8.850ON5054509391e-121
KNAG0K006508.850ON4824989281e-120
ZYRO0C14872g8.850ON4964729291e-120
ABL118W8.850ON5044739221e-118
KLLA0C06248g8.850ON5164769191e-118
NDAI0K003708.850ON5684759111e-116
TBLA0D033008.850ON4804838691e-111
CAGL0B02387g8.850ON4714678661e-110
KNAG0G034708.850ON4664788431e-107
Ecym_46198.850ON4874468331e-105
KAFR0A028608.850ON4784878211e-104
Kwal_26.71127.78ON7422711368e-08
Ecym_73547.78ON7852201304e-07
ACR288W7.78ON7362691271e-06
KLTH0D02310g7.78ON7392711233e-06
KNAG0D048407.78ON7792081224e-06
SAKL0B10032g7.78ON7312431181e-05
NDAI0H025207.78ON8982011162e-05
TDEL0H037307.78ON7972171152e-05
TPHA0H026807.78ON8722641153e-05
Suva_1.457.78ON8312751125e-05
ZYRO0D05302g7.78ON8572641125e-05
Skud_1.407.78ON8692471091e-04
CAGL0H06149g7.78ON8732921092e-04
KAFR0K006707.78ON7952121063e-04
TBLA0A046607.78ON8962601045e-04
Kpol_1040.147.78ON784203980.003
Smik_1.457.78ON839205970.003
YAL021C (CCR4)7.78ON837262950.006
KLLA0F07733g7.90ON371235920.011
KLTH0D02574g7.90ON368275920.011
Kwal_26.71707.90ON372270890.026
CAGL0F01001g7.90ON359210850.074
NCAS0F016407.78ON855164850.085
KLLA0F15884g7.78ON790170840.14
TDEL0H036007.90ON366266800.32
YMR027W2.578ON47086800.33
KNAG0L005507.90ON381249780.52
TPHA0L005307.90ON391208780.52
Smik_13.1962.578ON472139780.65
Suva_7.4133.485ON103767751.8
KAFR0D012507.90ON35679732.1
Smik_6.2213.485ON103667742.2
SAKL0G19206g2.644ON256128712.7
YGR125W3.485ON103630723.3
TPHA0A059503.546ON59967723.4
Skud_7.4363.485ON103630723.5
CAGL0G07733g1.286ON54670714.1
Suva_10.352singletonON121583705.4
Kpol_295.41.373ON80253705.4
Smik_2.197na 1ON40660696.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML118W
         (505 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...  1026   0.0  
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   742   0.0  
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   741   0.0  
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   739   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   409   e-138
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   392   e-131
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      390   e-131
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   390   e-130
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   387   e-130
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   383   e-128
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   383   e-127
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   381   e-127
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   380   e-127
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   380   e-127
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   378   e-126
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   378   e-125
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   377   e-125
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      377   e-124
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   366   e-121
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   366   e-121
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   362   e-120
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   362   e-120
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   359   e-118
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   358   e-118
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   355   e-116
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   339   e-111
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   338   e-110
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   329   e-107
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   325   e-105
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   320   e-104
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    57   8e-08
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    55   4e-07
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    54   1e-06
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    52   3e-06
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    52   4e-06
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    50   1e-05
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      49   2e-05
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    49   2e-05
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    49   3e-05
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    48   5e-05
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    48   5e-05
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    47   1e-04
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    47   2e-04
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    45   3e-04
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    45   5e-04
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    42   0.003
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    42   0.003
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    41   0.006
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    40   0.011
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    40   0.011
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    39   0.026
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    37   0.074
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      37   0.085
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    37   0.14 
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    35   0.32 
YMR027W Chr13 (325877..327289) [1413 bp, 470 aa] {ON} Putative p...    35   0.33 
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    35   0.52 
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    35   0.52 
Smik_13.196 Chr13 (320120..321538) [1419 bp, 472 aa] {ON} YMR027...    35   0.65 
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...    33   1.8  
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    33   2.1  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...    33   2.2  
SAKL0G19206g Chr7 (1655715..1656485) [771 bp, 256 aa] {ON} simil...    32   2.7  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...    32   3.3  
TPHA0A05950 Chr1 complement(1346003..1347802) [1800 bp, 599 aa] ...    32   3.4  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...    32   3.5  
CAGL0G07733g Chr7 complement(734157..735797) [1641 bp, 546 aa] {...    32   4.1  
Suva_10.352 Chr10 (614328..617975) [3648 bp, 1215 aa] {ON} YLR25...    32   5.4  
Kpol_295.4 s295 (6161..8569) [2409 bp, 802 aa] {ON} (6161..8569)...    32   5.4  
Smik_2.197 Chr2 complement(348812..350032) [1221 bp, 406 aa] {ON...    31   6.8  

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/505 (97%), Positives = 493/505 (97%)

Query: 1   MDSQVEGKISPSQKESSSTSGLVSPSEDGPAHQKIHRDQLSVDQIKKIREERAQKRQVRR 60
           MDSQVEGKISPSQKESSSTSGLVSPSEDGPAHQKIHRDQLSVDQIKKIREERAQKRQVRR
Sbjct: 1   MDSQVEGKISPSQKESSSTSGLVSPSEDGPAHQKIHRDQLSVDQIKKIREERAQKRQVRR 60

Query: 61  NSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQT 120
           NSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQT
Sbjct: 61  NSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQT 120

Query: 121 LIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELNFWQENFHKLGFDVI 180
           LIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELNFWQENFHKLGFDVI
Sbjct: 121 LIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELNFWQENFHKLGFDVI 180

Query: 181 FKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGIT 240
           FKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGIT
Sbjct: 181 FKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGIT 240

Query: 241 DSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKACSKYNGWHSLLMGDFNTEPE 300
           DSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKACSKYNGWHSLLMGDFNTEPE
Sbjct: 241 DSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKACSKYNGWHSLLMGDFNTEPE 300

Query: 301 EPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQ 360
           EPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNG            KSRGEGHSDQPQ
Sbjct: 301 EPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECDEKSRGEGHSDQPQ 360

Query: 361 NPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENANGSHGEPGLSNWA 420
           NPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENANGSHGEPGLSNWA
Sbjct: 361 NPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENANGSHGEPGLSNWA 420

Query: 421 NTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGE 480
           NTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGE
Sbjct: 421 NTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGE 480

Query: 481 YASDHISLMCQIRLFFGGEKVHSLK 505
           YASDHISLMCQIRLFFGGEKVHSLK
Sbjct: 481 YASDHISLMCQIRLFFGGEKVHSLK 505

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/497 (74%), Positives = 411/497 (82%), Gaps = 1/497 (0%)

Query: 1   MDSQVEGKISPSQKESSSTSGLVSPSEDGPAHQKIHRDQLSVDQIKKIREERAQKRQVRR 60
           M+ Q+E   S + KE  STS + S SED   H+KI  DQ ++D IKKIREERA++RQ  R
Sbjct: 1   MNGQIEHATSTAHKEFFSTSNISSSSEDDITHKKIPADQSTIDHIKKIREERAERRQRCR 60

Query: 61  NSLISQGKDPDFPTPDLQFIERPFLPINHD-NSKGLTPATIQVTQDSLDVKIMTYNTLAQ 119
           NSLISQGKDPDFPTPDLQFIERP L I+ + N+     + IQ T  SLD+KIMTYNTLAQ
Sbjct: 61  NSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQ 120

Query: 120 TLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELNFWQENFHKLGFDV 179
           TLIRRDFFP+SG ALKWHKRSKVLVHELK Y PD+VSLQEVDYNEL FW+ENFHKLGFD+
Sbjct: 121 TLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELKFWRENFHKLGFDL 180

Query: 180 IFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGI 239
            F+R+ GKTHGLLVAWNN+KFQLDN+WMLDYD ILAGNVISARTRTKNIALI+SL FK  
Sbjct: 181 SFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT 240

Query: 240 TDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKACSKYNGWHSLLMGDFNTEP 299
            ++S+ GI+VANTHLFWHPFGVFERLRQSYLVLQKIQEIK   KY+GWHSLLMGDFNTEP
Sbjct: 241 RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHSLLMGDFNTEP 300

Query: 300 EEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQP 359
           EEPPYLAIT +PL L G  RAMVECSLAYRYSKKRNG             SRGE + +QP
Sbjct: 301 EEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDENSRGERNLNQP 360

Query: 360 QNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENANGSHGEPGLSNW 419
           +NPKP+ F ATKEEK LVNQL+ LHNSLHVKG+SLYG+GYGKVHPENAN  HGEP LSNW
Sbjct: 361 KNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENANEGHGEPELSNW 420

Query: 420 ANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEG 479
           ANTWCGLLDYIFYIE D N   +Q++ LN FE NN V +IGYLRMPC QEMPKHSQPFEG
Sbjct: 421 ANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEG 480

Query: 480 EYASDHISLMCQIRLFF 496
           EYASDHISLMCQIRLF+
Sbjct: 481 EYASDHISLMCQIRLFW 497

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/479 (73%), Positives = 404/479 (84%), Gaps = 5/479 (1%)

Query: 27  EDGPAHQKIHRDQLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLP 86
           E+   HQKI R QL+ +Q+KKIREERAQKRQ RRNSLISQGKDPDFPTPDLQFI+RPFL 
Sbjct: 29  EEDLTHQKIPRHQLTKEQVKKIREERAQKRQSRRNSLISQGKDPDFPTPDLQFIKRPFLH 88

Query: 87  INHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHE 146
           ++H+ ++G T    + T +SLDVKIMTYNTLAQTLIRR+FFP+SG ALKWHKRSKVLVHE
Sbjct: 89  LHHEIAQGST----ESTPNSLDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKRSKVLVHE 144

Query: 147 LKKYRPDVVSLQEVDYNELNFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDW 206
           LK Y+PD+VSLQEVDYNEL FWQENF KLGFD+ FKRH+GKTHGLL+AWN+ KFQL+N+W
Sbjct: 145 LKTYKPDIVSLQEVDYNELKFWQENFRKLGFDLTFKRHDGKTHGLLIAWNSGKFQLENEW 204

Query: 207 MLDYDNILAGNVISARTRTKNIALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLR 266
           MLDYDNILAGN I ARTRTKNIALI SL  K I+D S+ G+IVANTHLFWHPFGVFERLR
Sbjct: 205 MLDYDNILAGNAIPARTRTKNIALIASLRLKNISDPSTDGVIVANTHLFWHPFGVFERLR 264

Query: 267 QSYLVLQKIQEIKACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSL 326
           QSYLVL KIQEIKAC KYNGWHS+LMGDFNTEPEEPPYLAIT++P+ L G  R M ECSL
Sbjct: 265 QSYLVLAKIQEIKACPKYNGWHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSL 324

Query: 327 AYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNS 386
           AYRYSKKRNG            +SRGEG  +QPQNPKP+SFTAT E+KALV+QLVALHNS
Sbjct: 325 AYRYSKKRNGEEGGQDDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNS 384

Query: 387 LHVKGVSLYGIGYGKVHPENANGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEP 446
           LHV+GVSLYG+GYGKV PEN++ S+GEP LSNWAN+WCGLLDYIFYIE         + P
Sbjct: 385 LHVRGVSLYGLGYGKVQPENSHESNGEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNP 444

Query: 447 LNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRLFFGGEKVHSLK 505
           ++ FE  NN++++GYL+MP A+EMPKHSQPFEGEYASDH+SLMCQ+R   GG K+ ++K
Sbjct: 445 VDDFENKNNLRVMGYLKMPRAKEMPKHSQPFEGEYASDHVSLMCQLRFLSGG-KISNMK 502

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/498 (72%), Positives = 405/498 (81%), Gaps = 3/498 (0%)

Query: 1   MDSQVEG--KISPSQKESSSTSGLVSPSEDGPAHQKIHRDQLSVDQIKKIREERAQKRQV 58
           M SQ+E    IS  + +S S S     SE+   HQKI R  L+ D IKKIREERAQ+RQ 
Sbjct: 1   MSSQMEDGEPISHGKAQSPSNSVSSYSSENDVTHQKIFRCPLADDHIKKIREERAQRRQS 60

Query: 59  RRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLA 118
           RRNSLISQGKDPDFPTPDLQFIERPFL +  + S+    + +QV   SLDV+IMTYNTLA
Sbjct: 61  RRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLA 120

Query: 119 QTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELNFWQENFHKLGFD 178
           QTLIRRDFFP+SG ALKWHKRSKVLVHELK Y+PD+VSLQEVDYNEL FW ENFHKLGF 
Sbjct: 121 QTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELGFWHENFHKLGFG 180

Query: 179 VIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKG 238
             F+RHEGKTHGL+VAWNN+KFQ DN+WMLDYD ILAGN ISARTRTKNIALI+SL  K 
Sbjct: 181 STFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLSVKN 240

Query: 239 ITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKACSKYNGWHSLLMGDFNTE 298
           +T+ S+ G+IVANTHLFWHPFGVFERLRQS+LVL+KI+EIK C KY GWHSLLMGDFNTE
Sbjct: 241 MTNLSTSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEEIKTCPKYYGWHSLLMGDFNTE 300

Query: 299 PEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQ 358
           PEEPPY+AIT+RPL L G  RAM ECSLAYRYSK RNG            +S GEG  DQ
Sbjct: 301 PEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNG-EESDQDEECDEESTGEGQHDQ 359

Query: 359 PQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENANGSHGEPGLSN 418
           PQNPKP+ F ATKE+K LVNQLVALHNSLHVKG+SLYG+ YGKVHP+N+  +HGEP LSN
Sbjct: 360 PQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDNSKENHGEPELSN 419

Query: 419 WANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFE 478
           WANTWCGLLDYIFYIE + N  + + EP+  FE  NNVKIIGYLRMP A+EMPKHSQPFE
Sbjct: 420 WANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFE 479

Query: 479 GEYASDHISLMCQIRLFF 496
           GEYASDHISLMCQ+RLF+
Sbjct: 480 GEYASDHISLMCQLRLFW 497

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  409 bits (1052), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 211/474 (44%), Positives = 292/474 (61%), Gaps = 36/474 (7%)

Query: 39  QLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPIN-HDNSKGLTP 97
           ++S + I ++R +R   ++ +R  +I++G DPDFP PDLQFI RP L +N  +N+ G   
Sbjct: 38  KVSPEHIAEVRAQREAAKKKKREDMIARGLDPDFP-PDLQFIHRPMLSLNPSENANGFV- 95

Query: 98  ATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSL 157
                       K+MTYN LAQ LIRR  FP SG ALKW KRS+VL++E   Y  DV+ L
Sbjct: 96  -----------FKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCL 144

Query: 158 QEVDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAG 216
           QEVDY +  +FW+E F KLG++  F RH  K HG+ + W    F + +  ++DYD   +G
Sbjct: 145 QEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG 204

Query: 217 NVISARTRTKNIALIISLYF-----KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLV 271
             +  RT TKN+ L I+L F          SS RGIIV  THLFWHPFG FER RQ Y++
Sbjct: 205 -ALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVM 263

Query: 272 LQKIQEI---------KACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322
           L K++E          K  ++ N W+    GDFN++P + PYL+++ +P+  KG  + ++
Sbjct: 264 LNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVI 323

Query: 323 ECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382
           ECS +Y +SK R+G            K  G+G   QP++P PE F+AT+E+K LV  + +
Sbjct: 324 ECSTSYTFSKARDGEECDDEEGGNIEKF-GDG---QPEHPVPEKFSATEEQKGLVESMAS 379

Query: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQD 440
           LHNSL ++G+S+Y +GY  VH ENA  + +  EP +SNWA TW GLLDYIF+I+     D
Sbjct: 380 LHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSD 439

Query: 441 TRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
               E L AF+  N +KI G LRMP A+EMP H QP EGEY SDH+S+MC++ L
Sbjct: 440 KASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  392 bits (1007), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 204/475 (42%), Positives = 285/475 (60%), Gaps = 33/475 (6%)

Query: 37  RDQLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLT 96
           R ++S + + K+R ER   R+ +R  ++++G DPD P P+LQFI+RP L ++ D      
Sbjct: 32  RKEMSPEHVAKVRAEREAARKAKREEMLAKGMDPDHP-PELQFIKRPLLTLHEDEPI--- 87

Query: 97  PATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVS 156
                   + L  K++TYN LAQ LIRR  FP+SG +LKW +RSKVL +E K Y  DV+ 
Sbjct: 88  --------EGLSFKLLTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLC 139

Query: 157 LQEVDYNELN-FWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILA 215
           LQE+DY +   FW++   KLG+D  F +   K HG+ +AW    FQL +  ++DYD   +
Sbjct: 140 LQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESS 199

Query: 216 GNVISARTRTKNIALIISLYFKGITDSSS-----RGIIVANTHLFWHPFGVFERLRQSYL 270
           G  I  RT T N  LI++L F      S       GI+V  +HLFWHPFG +ER RQ Y+
Sbjct: 200 GK-IEKRTLTHNSGLILALKFTDAAKQSCPHIRKSGILVGTSHLFWHPFGTYERTRQCYV 258

Query: 271 VLQKIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAM 321
           VL+K++E    +      N      W     GDFN++P + PYL++T +P+   G  + +
Sbjct: 259 VLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTV 318

Query: 322 VECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLV 381
           VECS +Y +SK RNG            +  G+   DQPQ P PE+F AT E++ LV ++ 
Sbjct: 319 VECSTSYTFSKLRNGEEDAEDEEGGNIEKFGK---DQPQTPVPETFDATPEQQKLVEEMQ 375

Query: 382 ALHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQ 439
            LHNS+ ++ +SLY +GYG+VHPEN+  +   GEP +SNWANTW GLLDYI  I    + 
Sbjct: 376 ELHNSIDMRAISLYAVGYGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWDSS 435

Query: 440 DTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
           D ++ + L  FE  N++K+ G LRMP A EM  H QP EGEYASDH+S+MC I L
Sbjct: 436 DRKKVDSLETFEKENSLKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIEL 490

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  390 bits (1002), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 208/469 (44%), Positives = 290/469 (61%), Gaps = 28/469 (5%)

Query: 41  SVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATI 100
           S + I +IR++RA K Q  R S + QG DPD P P+LQF  RPFL + HDN         
Sbjct: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIP-PELQFQRRPFLTL-HDNEPD------ 70

Query: 101 QVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEV 160
              +   +  I+TYN LAQ LI RD FPESG ALKW +RSK +++ELK Y PD++ LQE+
Sbjct: 71  -NGESKHEFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEI 129

Query: 161 DYNELN-FWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVI 219
           D+  +  FW   F  LG+   F + E K HG+++AW +  F+  +   +D+D +LAG+ I
Sbjct: 130 DFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGD-I 188

Query: 220 SARTRTKNIALIISLYFKGITDSS----SRGIIVANTHLFWHPFGVFERLRQSYLVLQKI 275
             RT+T+NI LI++L F    +++    S GI+VA THLFWHPFG FER RQ YL+L ++
Sbjct: 189 PPRTKTRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEM 248

Query: 276 QE----IKACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYS 331
            +    +   S    W+  L GDFN++P++ PY+++T +P+     +R ++ECS +Y YS
Sbjct: 249 NKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYS 308

Query: 332 KKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKG 391
           KKRNG            +   E    QP +P+P  F  TKE+ ALVN +  LHNSL  + 
Sbjct: 309 KKRNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRA 368

Query: 392 VSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEG----DHNQDTRQKE 445
           +SLY +GY  VHPEN+  N + GEP  S+W   W GLLDYIFYI+     D N D    E
Sbjct: 369 ISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDV---E 425

Query: 446 PLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
            L  FE  N +KI+G+L++P  +EM  HSQP+EGEY SDH++LMC+++L
Sbjct: 426 TLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  390 bits (1003), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 200/475 (42%), Positives = 295/475 (62%), Gaps = 39/475 (8%)

Query: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNS--KGLTP 97
           +S + I ++R +R   R+ +R++L++QG DPD P  +LQFI+RP L + H+N   KG   
Sbjct: 63  ISPEHIAQVRAKREAARKAKRDALLAQGIDPDCPK-ELQFIKRPILQM-HENEPVKGFK- 119

Query: 98  ATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSL 157
                        +MTYN LAQ LIRR  FPE G ALKWH+RSKVL++E K Y PD++ L
Sbjct: 120 -----------FSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICL 168

Query: 158 QEVDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAG 216
           QE+D+ +  +FW+E F KLG++  F +   K HG+ V W  + F++ +  ++DYD  L+G
Sbjct: 169 QEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSG 228

Query: 217 NVISARTRTKNIALIISLYF-KGITDS-----SSRGIIVANTHLFWHPFGVFERLRQSYL 270
           + I  RT T NIAL++SL F K +T+      +  GI++  THLFWHPFG +ER RQ Y+
Sbjct: 229 D-IEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYI 287

Query: 271 VLQKIQEI---------KACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAM 321
           +L K++E               ++ W+    GDFN++P + PYL++T +P+   G  + +
Sbjct: 288 ILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTV 347

Query: 322 VECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLV 381
           +ECS ++++SKKR+G            K       DQPQ+P P+ + A  E+K LV ++ 
Sbjct: 348 IECSTSFKFSKKRDGEEGDDEEGGNIEK----FGKDQPQHPVPDDYQANDEQKLLVTKMQ 403

Query: 382 ALHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQ 439
            LHNSL ++ +SLY  GY KVHPEN+  +    EP +SNWA+ W GLLDY+FYI+     
Sbjct: 404 ELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFT 463

Query: 440 DTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
             ++ + L  FE  N++KI GYLRMP A+E+P H QPFEGEY SDH+ ++C++ L
Sbjct: 464 PNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVEL 518

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/448 (44%), Positives = 279/448 (62%), Gaps = 33/448 (7%)

Query: 63  LISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLI 122
           ++++G DP+FP PDLQFI RP LP++ + S            +    KIMTYN LAQ LI
Sbjct: 62  MLARGLDPEFP-PDLQFISRPMLPLDSNYSP-----------EGFVFKIMTYNCLAQALI 109

Query: 123 RRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIF 181
           RR  FP SG ALKW KRS+VL++E   Y+ DV  LQE+DY +  +FW+E F KLG+D  F
Sbjct: 110 RRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQF 169

Query: 182 KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF-KGIT 240
            RH  K HG+ + W    F + +  ++DYD   +G+ +  RT TKN+ L+++L F K + 
Sbjct: 170 HRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGS-LKPRTTTKNVGLVLALAFSKKVL 228

Query: 241 D----SSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI--------KACSKYNGWH 288
           D    +S RGI+V  THLFWHPFG FER RQ Y++L K+++            S    W+
Sbjct: 229 DKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWY 288

Query: 289 SLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGXXXXXXXXXXXX 348
               GDFN +P + PYL+++ +P++ K   + ++ECS +Y +SK R+G            
Sbjct: 289 PFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARDGEECDDEEGGNIE 348

Query: 349 KSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENA- 407
           K  G+G   QP++P P+++ A  E+K LV  +  LHNSL ++ +S+Y + Y  VHPENA 
Sbjct: 349 KF-GDG---QPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAG 404

Query: 408 -NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPC 466
            + +H EP +SNWA TW GLLDYIF+I+  +  D ++ E L  FE  N+VKI+  LRMP 
Sbjct: 405 RDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPP 464

Query: 467 AQEMPKHSQPFEGEYASDHISLMCQIRL 494
           ++EMP H QP EGEY SDH+SLMC+I L
Sbjct: 465 SEEMPNHGQPHEGEYGSDHLSLMCEIEL 492

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 197/475 (41%), Positives = 287/475 (60%), Gaps = 36/475 (7%)

Query: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPAT 99
           ++ + I K+R ER   R+ +R+++++QG DPD P P+L FI RPFL ++        P T
Sbjct: 55  VTPEHIAKVRAEREVMRKAKRDAMLAQGVDPDCP-PELHFIRRPFLSLHE-----AEPVT 108

Query: 100 IQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQE 159
                     K+MTYN LAQ LIRR  FP+SG ALKW++RSKVL++E K Y  DV+ LQE
Sbjct: 109 ------GFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQE 162

Query: 160 VDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218
           +D+ +  +FW++ F KLG+D  + R+  K HG+ + W  + F   +  ++DYD   +   
Sbjct: 163 IDHIQFQSFWKDEFSKLGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDK-ESSES 221

Query: 219 ISARTRTKNIALIISLYFK-------GITDSSSRGIIVANTHLFWHPFGVFERLRQSYLV 271
           IS RT T N+ L+++L F        G   S   GI++  THLFWHPFG +ER RQ Y+V
Sbjct: 222 ISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIV 281

Query: 272 LQKIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322
           L+K++E    +      N      W     GDFN++P + PYL++T +P+  +   + ++
Sbjct: 282 LKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVI 341

Query: 323 ECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382
            CS +Y++SK R+G            +  G+   DQP++P PE F A +E+  LV+++  
Sbjct: 342 GCSTSYKFSKVRDGEEGADDEEGGNIEKYGK---DQPESPVPEKFHANEEQSELVDKMAQ 398

Query: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEG-DHNQ 439
           LHNSL ++ +SLY +GY  VHPENA  +   GEP +SNWANTW GLLDY+FY++  D   
Sbjct: 399 LHNSLDMRAISLYSVGYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQS 458

Query: 440 DTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
           + ++ E L  FE  N VK  G+LRMP   EM KH QP  GEYASDH+S++C + L
Sbjct: 459 NCQEVETLGDFEKENKVKCRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  383 bits (983), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 197/475 (41%), Positives = 295/475 (62%), Gaps = 36/475 (7%)

Query: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPAT 99
           ++ + I KIR ER   R+ +R+++++QG DPD P P+L FI+RPFL ++        P T
Sbjct: 55  VTPEHIAKIRAERDAMRKAKRDAMLAQGVDPDCP-PELHFIKRPFLVLHEKE-----PVT 108

Query: 100 IQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQE 159
                     K+MTYN LAQ LIRR  FP+SG ALKW++RS+VL++E K Y+ DV+ LQE
Sbjct: 109 ------GFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQE 162

Query: 160 VDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218
           +D+ +  +FW++ F+KLG+D  + R+  K HG+ + W  + FQ  +  ++DYD   + N 
Sbjct: 163 IDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSEN- 221

Query: 219 ISARTRTKNIALIISLYFKGITDSS-------SRGIIVANTHLFWHPFGVFERLRQSYLV 271
           IS RT T N+ L+++L F     S+         GI++  THLFWHPFG +ER RQ Y+V
Sbjct: 222 ISTRTTTNNVGLVLALKFSEKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVV 281

Query: 272 LQKIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322
           L+K++E    +      N      W     GDFN++P + PYL++T +P+  K   + ++
Sbjct: 282 LKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVI 341

Query: 323 ECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382
           ECS ++++SK R+G            +  G+   DQP++P PE++ A +E+  LV+++  
Sbjct: 342 ECSTSFKFSKARDGDESADDEEGGNIEKYGK---DQPESPVPENYHANEEQIELVDKMAQ 398

Query: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEG-DHNQ 439
           LHNSL ++ +SLY +GY  VHPENA  +   GEP +SNWANTW GLLDY+FY++  D   
Sbjct: 399 LHNSLDMRAISLYSVGYRNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRS 458

Query: 440 DTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
           + ++ E L  FE  N +K  G+LRMP  +EM KH QP  GEYASDH+S++C + L
Sbjct: 459 NCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/475 (41%), Positives = 293/475 (61%), Gaps = 36/475 (7%)

Query: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPAT 99
           ++ + I K+R ER   R+ +R+S+++QG DPD P P+L FI+RPFL ++ +      P T
Sbjct: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCP-PELHFIKRPFLSLHEEE-----PVT 108

Query: 100 IQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQE 159
                     K+MTYN LAQ LIRR  FP+SG ALKW++RS+VL++E + Y  DV+ LQE
Sbjct: 109 ------GFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQE 162

Query: 160 VDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218
           +D+ +  +FW+E F KLG++  + R+  K HG+ + W    FQ  +  ++D+D  ++GN 
Sbjct: 163 IDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGN- 221

Query: 219 ISARTRTKNIALIISLYFK-------GITDSSSRGIIVANTHLFWHPFGVFERLRQSYLV 271
           I  RT T N+ L+++L F        G   S   GI++  +HLFWHPFG +ER RQ Y+V
Sbjct: 222 IPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIV 281

Query: 272 LQKIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322
           L+K++E    +      N      W     GDFN++P + PYL++T +P+  +   + ++
Sbjct: 282 LKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVI 341

Query: 323 ECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382
           ECS ++++SK R+G            +  G+   DQP++P P+ F A +E+  LV+++  
Sbjct: 342 ECSTSFKFSKVRDGEEGADEEEGGNIEKFGK---DQPESPVPKDFHANEEQIELVDEMAQ 398

Query: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEG-DHNQ 439
           LHNSL ++ VSLY + Y  VHPENA  +   GEP +SNWANTW GLLDY+FYI+  D   
Sbjct: 399 LHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRS 458

Query: 440 DTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
           + ++ + L+ FE +N +K  G+LRMP   EM KH QP  GEYASDH+S++C I L
Sbjct: 459 NCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  380 bits (975), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 199/472 (42%), Positives = 284/472 (60%), Gaps = 37/472 (7%)

Query: 43  DQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQV 102
           ++I +IR ER   R+ +R  ++ +G DPD P P+LQFI R  L ++ +      P     
Sbjct: 38  EEIARIRAEREAMREAKRQEMLERGVDPDCP-PELQFIRRNMLKLHEEE-----PV---- 87

Query: 103 TQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDY 162
             + L +KIM+YN LAQ LIRR  FP+SG ALKW++RS+VL++E K Y PDV+ LQE+DY
Sbjct: 88  --EGLKIKIMSYNCLAQALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDY 145

Query: 163 NEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISA 221
            +  +FW+E F KLG+   F R   K HG+ + W ++KF++ +  ++D+D+  +G+ I  
Sbjct: 146 IQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGD-IEP 204

Query: 222 RTRTKNIALIISLYF--------KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQ 273
           RT T N ALI++L F        K + D  S GI+V  THLFWHPFG +ER RQ Y+VL 
Sbjct: 205 RTTTNNAALILALKFTQKVKMMGKKLLDDKS-GILVGTTHLFWHPFGTYERTRQCYVVLN 263

Query: 274 KIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVEC 324
           K++E    +      N      W+    GDFN++P + PYL++T +P+      + ++EC
Sbjct: 264 KMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIEC 323

Query: 325 SLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALH 384
           S ++++SKKR              +  G+   DQPQ P PE F A  E+  LV+Q+  LH
Sbjct: 324 STSFKFSKKRESGEDAEDEEGGNIEKFGK---DQPQTPVPEKFVANDEQTKLVSQMEELH 380

Query: 385 NSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTR 442
           NSL ++ VSLY + Y KVHPEN+  +   GEP +SNWA+TW GLLDY+F I      D  
Sbjct: 381 NSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRT 440

Query: 443 QKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
           + + L  FE +NN+KI G LRMP   EM  H QP  GEY SDH+ L+ ++ L
Sbjct: 441 EIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  380 bits (976), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 196/482 (40%), Positives = 291/482 (60%), Gaps = 34/482 (7%)

Query: 33  QKIHRDQLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNS 92
           +K  R + S ++I++ R ERA  ++ +R  L+++G DPD+P P+LQFI+RP L ++ D  
Sbjct: 38  KKKGRSKPSPEEIERKRAERAAAKEQKRKELLAKGLDPDYP-PELQFIKRPMLHLHQDE- 95

Query: 93  KGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRP 152
               P T        +  +MTYN LAQ LIRR  FP+SG A+KW +RSKVL++E + Y  
Sbjct: 96  ----PVT------GFNFTLMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNS 145

Query: 153 DVVSLQEVDYNELN-FWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYD 211
           DV+ LQE+D+ +   FW+  F KLG++  F R   K HG+ + W  + F++ +  ++D+D
Sbjct: 146 DVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFD 205

Query: 212 NILAGNVISARTRTKNIALIISLYFKGIT------DSSSRGIIVANTHLFWHPFGVFERL 265
              + + I  RTRT N  LI+SL F          ++ + GII+  THLFWHPFG +ER 
Sbjct: 206 KETSSD-IPPRTRTNNTGLILSLKFSDKILSTLPKNTKTTGIIIGTTHLFWHPFGTYERT 264

Query: 266 RQSYLVLQKIQEI--KACSKYNG-------WHSLLMGDFNTEPEEPPYLAITKRPLILKG 316
           RQ Y++L K++E   +     NG       W     GDFN++P + PYL++T +P+    
Sbjct: 265 RQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTE 324

Query: 317 PIRAMVECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKAL 376
             + +++CS +Y++SK RNG            +  G+   DQPQ P PE+F A +E+ AL
Sbjct: 325 RAKTVIQCSTSYKFSKLRNGEEDVDDEEGGNIEKFGK---DQPQTPVPETFIANEEQTAL 381

Query: 377 VNQLVALHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIE 434
           V ++  +HN L ++  SLY +GY  VH ENA  + + GEP +SNWANTW GLLDYIF++ 
Sbjct: 382 VERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVN 441

Query: 435 GDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
                + +  + L  FE  N++++ G+LRMP   EMPKH QP EGEYASDH+S++C I L
Sbjct: 442 TWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIEL 501

Query: 495 FF 496
             
Sbjct: 502 LL 503

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  378 bits (971), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 200/481 (41%), Positives = 291/481 (60%), Gaps = 36/481 (7%)

Query: 37  RDQLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNS-KGL 95
           R  L+ + I KIR ER +KR++ R   +  G +PD P+ +LQFI+RP L ++ D+  KG 
Sbjct: 31  RMMLNTEYITKIRAEREKKRELEREYRMKHGFEPDIPS-ELQFIKRPLLTLHDDDPVKGT 89

Query: 96  TPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVV 155
                        +KIMTYN LAQ+LI+RD FP SG ALKW +RSKVL++ELK Y  D++
Sbjct: 90  M------------LKIMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLL 137

Query: 156 SLQEVDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNIL 214
           SLQE+D+ +   +W+    KLG+D  F +  GK HG+L+AW    F       +D+D  L
Sbjct: 138 SLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETL 197

Query: 215 AGNVISARTRTKNIALIISLYF--KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVL 272
           +G  I  RTRTKN+ L+I+L F  K  +    +G+I+  THLFWH FG FER RQ Y+++
Sbjct: 198 SG-TIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMM 256

Query: 273 QKIQE-IKACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYS 331
            ++ + +K       W+    GDFN++P++ PY++IT +P+  +   + ++ECS AY+YS
Sbjct: 257 DQMDKFMKKLGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYS 316

Query: 332 KKR--------------NGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALV 377
           KKR              +             + + E   +QP N +P  FT T+E+  LV
Sbjct: 317 KKRNGEEEEKNEGKEKQHEIDSSDSSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELV 376

Query: 378 NQLVALHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIE- 434
           +QL ALHNSL+++ +SLY +GY KV PENA  N   GEP LS WA  W GLLDYIF+++ 
Sbjct: 377 SQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQH 436

Query: 435 GDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
            D   +  + + L  FE  NNVK+ G L+MP ++EM +H+ P++GEY SDH+ +M Q+ L
Sbjct: 437 WDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496

Query: 495 F 495
            
Sbjct: 497 L 497

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  378 bits (970), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 197/475 (41%), Positives = 288/475 (60%), Gaps = 36/475 (7%)

Query: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPAT 99
           ++ + I K+R ER   R+ +R+++++ G DPD P P+L FI+RP L +         P T
Sbjct: 54  VTPEHIAKVRAEREAMRKAKRDAMLAHGVDPDCP-PELHFIQRPLLSLGEGE-----PVT 107

Query: 100 IQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQE 159
                     K+MTYN LAQ LIRR  FP+SG ALKW +RSKVL++E K Y  DV+ LQE
Sbjct: 108 ------GFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQE 161

Query: 160 VDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218
           VD+ +  +FW+  F+K+G+D  + R+  K HG+ + W    FQ  +  ++DYD   +G++
Sbjct: 162 VDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSI 221

Query: 219 ISARTRTKNIALIISLYFKGITDSSSR-------GIIVANTHLFWHPFGVFERLRQSYLV 271
           ++ RT T N+ L+++L F     S          GI++  THLFWHPFG +ER RQ Y+V
Sbjct: 222 LT-RTTTNNVGLVLALKFSKEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVV 280

Query: 272 LQKIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322
           L+K++E    +      N      W     GDFN++P + PYL++T +P+  K   + ++
Sbjct: 281 LRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVI 340

Query: 323 ECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382
           ECS ++++SK R+G            +  G+   DQP++P PE+F A  E+  +V+ +V 
Sbjct: 341 ECSTSFKFSKVRDGEEGADDEEGGNIEKFGK---DQPESPVPENFHANDEQIEIVDDMVQ 397

Query: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQD 440
           LHNSL ++ +SLY +GY  VHPENA  +   GEP +SNWANTW GLLDY+FYI+    Q 
Sbjct: 398 LHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQS 457

Query: 441 TRQK-EPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
            RQ+ E L+ FE  N +K  G+LRMP A EM KH QP  GEY SDH+S++C + L
Sbjct: 458 NRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  377 bits (968), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 191/456 (41%), Positives = 281/456 (61%), Gaps = 35/456 (7%)

Query: 59  RRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLA 118
           ++  +++ G DPD P P+LQFI RP L ++ D             + S    +MTYN LA
Sbjct: 87  KQKKMLANGLDPDCP-PELQFIRRPLLTLHDDEP-----------EKSFTFTLMTYNCLA 134

Query: 119 QTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGF 177
           Q LIRR  FP+SG A+KW++RS+VL++E K Y PD++ LQE+D+ +  +FWQE F K+G+
Sbjct: 135 QALIRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGY 194

Query: 178 DVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFK 237
              F R   K HG+ + W N  F+L +  ++D+D  L+G+++  RT+T N  LI+SL + 
Sbjct: 195 ASQFHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDIL-PRTKTNNTGLILSLKYS 253

Query: 238 G--------ITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKA--------- 280
                    + +++  GII+  THLFWHPFG +ER RQ +++L K++E K          
Sbjct: 254 DSVLAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNN 313

Query: 281 CSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGXXXX 340
               + W +   GDFN++P + PYL+IT +P+  K   + ++ECS +Y YSK RNG    
Sbjct: 314 DGNMDHWTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDE 373

Query: 341 XXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYG 400
                     +     DQPQ P P+S+T T E+  LV+++ +LHNSL++K  SLY +GY 
Sbjct: 374 AEDEEGGNIEKF--GKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYK 431

Query: 401 KVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKI 458
           KVHPEN+  +   GEP +SNWA++W GLLDYIFY++     D ++ E    FE  N++K+
Sbjct: 432 KVHPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKL 491

Query: 459 IGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
            GYLRMP A EM K+ QP +GEY SDH+S+MC+I L
Sbjct: 492 RGYLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  377 bits (967), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 285/473 (60%), Gaps = 40/473 (8%)

Query: 43  DQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQV 102
           ++I KIR ER    Q ++ + ++QG DP+   PDLQFI+RP L ++ +      P T   
Sbjct: 104 EEIAKIRAER----QAKKEAALAQGLDPN-ALPDLQFIQRPILHLHEEE-----PVT--- 150

Query: 103 TQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDY 162
                 + IMTYN LAQ LIRR  FP+SG ALKW KRSKVL +E K Y PDV+ LQE+D+
Sbjct: 151 ---GFKISIMTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDH 207

Query: 163 NEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISA 221
            +  +FW+  F K+G++  F R + K HG+ + W  + F L +  ++D+D   +G  I  
Sbjct: 208 LQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGE-IPP 266

Query: 222 RTRTKNIALIISLYF------KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKI 275
           RT T N  L +SL F      K    +S  GIIV  THLFWHPFG +ER RQ Y+VL K+
Sbjct: 267 RTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKM 326

Query: 276 QE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSL 326
           +E    I      N      W+    GDFN++P + PYL++T +P+  KG  + ++ECS 
Sbjct: 327 KEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECST 386

Query: 327 AYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNS 386
           +Y++SKKR+G            +  G+   DQPQ P P+ F A +E+K LV  +  LHNS
Sbjct: 387 SYKFSKKRDGEEDADEEEGGNIEKFGK---DQPQTPVPDHFIANEEQKKLVKNMELLHNS 443

Query: 387 LHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQK 444
           L ++ +SLYG+GY KVHPENA  +   GEP +SNWA+TW GLLDYI +I+     D +  
Sbjct: 444 LDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHV 503

Query: 445 EPLNAFEGNNNVKIIGYLRMPCAQEMPK--HSQPFEGEYASDHISLMCQIRLF 495
           + L  FE  N++K+ GYLRMP + EM K  H QP  GEY SDH+S++C++ L 
Sbjct: 504 DTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  366 bits (940), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 193/474 (40%), Positives = 276/474 (58%), Gaps = 35/474 (7%)

Query: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPAT 99
           L  + I K+R ER   R+ ++ ++++QG DPD P P+LQFI RP L ++   S       
Sbjct: 52  LDPEHIAKVRAEREAMRKSKQEAMLAQGLDPDLP-PELQFIRRPLLALSKAESTA----- 105

Query: 100 IQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQE 159
                   + KIMTYN LAQ LIRR  FP+SG A+KW +RSKVL++E K Y  DV+ LQE
Sbjct: 106 ------GFEFKIMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQE 159

Query: 160 VDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218
           VD  +   FW+E F KLG+D  F     K HG+ + W    F + +  ++DYD  ++GN 
Sbjct: 160 VDRIQFQTFWKEEFDKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGN- 218

Query: 219 ISARTRTKNIALIISLYF-----KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQ 273
           I  RT T N+ L+++L F     +   ++   GIIV  THLFWHPFG +ER RQ Y+VL 
Sbjct: 219 IPPRTTTNNVGLVLALKFSPKVLERFPNTRKSGIIVGTTHLFWHPFGTYERTRQCYIVLN 278

Query: 274 KIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVEC 324
           K +E    +      N      W++   GDFN++P + PYL++T +P+      + ++EC
Sbjct: 279 KTKEFMHRVNVLQNNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIEC 338

Query: 325 SLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALH 384
           S +Y +SK R+G            +  G+   DQP  P P  F A+ E+++LV  +  LH
Sbjct: 339 STSYTFSKSRDGEEDAEDEEGGNIEKFGK---DQPATPVPSFFDASSEQQSLVANMEKLH 395

Query: 385 NSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTR 442
           NSL ++ +SLY +GYG VH ENA  + + GEP +SNWA+ W GLLDY+F I+     D  
Sbjct: 396 NSLDMRAISLYSVGYGTVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDKI 455

Query: 443 QKEPLNAFEGNNNVKIIGYLRMPCAQEMPK--HSQPFEGEYASDHISLMCQIRL 494
           Q + L  FE  N +K+  +L+MP   EM K  H QP  GEY SDH+S++C++ L
Sbjct: 456 QVDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLEL 509

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  366 bits (939), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 195/450 (43%), Positives = 272/450 (60%), Gaps = 36/450 (8%)

Query: 63  LISQGKDPDFPTPDLQFIERPFLPINHDNS-KGLTPATIQVTQDSLDVKIMTYNTLAQTL 121
           +++ G DP+ P PDLQFI+RP L ++ +   KG               KIMTYN LAQ L
Sbjct: 72  MLAHGLDPNVP-PDLQFIKRPLLCLHEEEPVKGF------------KFKIMTYNALAQAL 118

Query: 122 IRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELN-FWQENFHKLGFDVI 180
           IRR  FP SG A+KW KRSKVL++E K Y  DV  LQE+D+ +   FW+E F KLG+   
Sbjct: 119 IRRKLFPSSGNAVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQ 178

Query: 181 FKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKG-- 238
           F R   K HG+ + W    F + +  ++DYD   +G+ I  RT TKN  LI++L F    
Sbjct: 179 FHRIGTKNHGVAIVWRCSLFTMVDTMLVDYDKEPSGD-IPPRTTTKNAGLILALKFTDKV 237

Query: 239 ---ITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI---------KACSKYNG 286
                 +   GI++  THLFWHPFG FER RQ Y+VL K++E+              Y+ 
Sbjct: 238 LNQFPGTKKSGILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSH 297

Query: 287 WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGXXXXXXXXXX 346
           W+  + GDFN++P + PYL++T +P+  +G  + ++ECS ++ +SK R+G          
Sbjct: 298 WYPFICGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLRDGEEGEDEEGGN 357

Query: 347 XXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPEN 406
             K  G+G   QP++P P+ F AT+E+ ALV Q+ +LHNSL ++ +SLY +GY  VHPEN
Sbjct: 358 IEKF-GKG---QPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPEN 413

Query: 407 A--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRM 464
           A  +   GEP +SNWA TW GLLDYIF+++  +  D    + ++ FE  N +KI G LRM
Sbjct: 414 AGLDNDSGEPEISNWAETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGLLRM 473

Query: 465 PCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
           P  +EM KH QP EGEY SDH+S+MC+I L
Sbjct: 474 PPGEEMTKHGQPHEGEYPSDHLSMMCEIEL 503

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  362 bits (928), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 203/498 (40%), Positives = 287/498 (57%), Gaps = 44/498 (8%)

Query: 16  SSSTSGLVSPSEDGPAHQKIHRDQLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTP 75
           SSS +G+  P           R + S ++I +IR ER  KR+    +   QG   D P  
Sbjct: 8   SSSNAGVRPP-----------RGKPSEEEIARIRAERKAKRE----AAALQGAKSDIPA- 51

Query: 76  DLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALK 135
           +L+FIERP L ++ D + G          + L V +MTYN LAQ LIRR  FP+SGPALK
Sbjct: 52  ELRFIERPMLSVHPDGAIG-------AEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALK 104

Query: 136 WHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVA 194
           W++RS+VL+++ K Y PDV+ LQEVD  +  +FW+  F KLG+   F + + K HG+ V 
Sbjct: 105 WYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVV 164

Query: 195 WNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF-----KGITDSSSRGIIV 249
           W +K F + +  ++D+D   +G+V   RT T N  L+I+L F      G  D+   GI+V
Sbjct: 165 WRSKLFTMADKMLIDFDKEQSGDV-PPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILV 223

Query: 250 ANTHLFWHPFGVFERLRQSYLVLQKIQE----IKACSKYNG-----WHSLLMGDFNTEPE 300
             THLFWHPFG FER RQ Y+VL K++E    +      N      W     GDFN++P 
Sbjct: 224 GTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPY 283

Query: 301 EPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQ 360
           + PYL++T +P+   G  R ++ECS +Y +SK+R+G                 G  DQP 
Sbjct: 284 DAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFG-KDQPH 342

Query: 361 NPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPEN--ANGSHGEPGLSN 418
           +P P +F    E+ ALV+Q+  LHNSL ++ VSLY +GY  VHPEN  A+ + GEP +SN
Sbjct: 343 HPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISN 402

Query: 419 WANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPK--HSQP 476
           WA+TW GLLDY+FY+     +D    + L  FE ++ V +   LRMP  QEM +  H QP
Sbjct: 403 WAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQP 462

Query: 477 FEGEYASDHISLMCQIRL 494
             GEY SDH++++C + L
Sbjct: 463 HTGEYPSDHLAMVCDLEL 480

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  362 bits (929), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 197/472 (41%), Positives = 285/472 (60%), Gaps = 33/472 (6%)

Query: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINH-DNSKGLTPA 98
           +S + I K+R ER   R  ++ ++++QG DPDFP P+LQFI+RP LP++  +N +G    
Sbjct: 39  VSPEHIAKVRAEREAARAAKKEAMMAQGIDPDFP-PELQFIKRPILPLHKGENVEGFK-- 95

Query: 99  TIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQ 158
                      K+MTYN LAQ LIRR  FP SG ALKW++RSKVL++E K Y  DV+ LQ
Sbjct: 96  ----------FKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQ 145

Query: 159 EVDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGN 217
           E+DY +  +FW++   KLG+D  F R   K HG+ + W  + F + +  ++D+D   +G+
Sbjct: 146 EIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGD 205

Query: 218 VISARTRTKNIALIISLYFKGIT----DSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQ 273
            I  RT T N  LI+SL F        +    GIIV  THLFWHPFG FER RQ Y+VL 
Sbjct: 206 -IPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLN 264

Query: 274 KIQEI--KACSKYNG-------WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVEC 324
           K++E   +     NG       W+    GDFN++P + PYL++T++P+      + ++EC
Sbjct: 265 KVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIEC 324

Query: 325 SLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALH 384
           S +Y +SK R+G              +    +DQP +P P+ + A   E+ LV Q+ +LH
Sbjct: 325 STSYTFSKMRDGEEDDAEEEEGGNIEKFG--TDQPDHPVPQHYEAKDHERELVEQMQSLH 382

Query: 385 NSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTR 442
           NSL ++ VSLY + Y KVHPENA  +   GEP +SNWA+TW GLLDY+F+I      D +
Sbjct: 383 NSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCK 442

Query: 443 QKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
           + + L +FE  N++KI G LR+P  +EM +H QP  GEY SDH+ ++C++ L
Sbjct: 443 EIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  359 bits (922), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 187/473 (39%), Positives = 273/473 (57%), Gaps = 44/473 (9%)

Query: 41  SVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATI 100
           S ++I+KIR +R  K++        QG +      D+ FI+RP L  N D +KG      
Sbjct: 59  SAEEIEKIRAQRKAKKEAAGK----QGGE------DVGFIKRPLLVCNGDEAKGFV---- 104

Query: 101 QVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEV 160
                    ++MTYN LAQ LIRR  FP SG ALKW KRSKVL+ EL+ Y PDV+ LQE+
Sbjct: 105 --------FRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEI 156

Query: 161 DYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVI 219
           D+ +  +FW +     G+   F R  GK HG+ + W    F   ++ ++D+D   +G  I
Sbjct: 157 DHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGE-I 215

Query: 220 SARTRTKNIALIISLYF-----KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQK 274
             RT TKN+ LI++L +     +    S+  GI+V  +HLFWHPFG +ER RQ Y++L +
Sbjct: 216 ERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYERARQCYIILSR 275

Query: 275 IQ---------EIKACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECS 325
           ++         E  +C   + WH    GDFN++P + PYL++  +P+I +G  R ++ECS
Sbjct: 276 MKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECS 335

Query: 326 LAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHN 385
            +Y++S  R+G            K  G G   QP+ P P+SF  T E++ALV+ + +LHN
Sbjct: 336 TSYKFSSLRDGCAADEEEGGNIEKF-GAG---QPETPVPDSFDGTPEQRALVDAMQSLHN 391

Query: 386 SLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQ 443
           +L ++ +SLY + Y  VHPENA  + + GEP +SNWA+ W GLLDYI Y+      D  +
Sbjct: 392 ALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVMPWDFSDNTE 451

Query: 444 KEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRLFF 496
            + +  F+ N +V +   LR+P A EMP H QP EGEY SDH+SLMC++ L  
Sbjct: 452 VDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELELLM 504

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  358 bits (919), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 187/476 (39%), Positives = 285/476 (59%), Gaps = 30/476 (6%)

Query: 38  DQLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTP 97
           ++++ + I ++R +R   +  ++ +LI+QG DP  P  DL+FI+RP L +  D+S     
Sbjct: 54  NEITPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPA-DLRFIKRPMLAVPRDSSG---- 108

Query: 98  ATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSL 157
              Q T++   + IMTYN LAQ LIRR  FP SG A+KW KRS+VL++E K Y  DV+ L
Sbjct: 109 ---QSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCL 165

Query: 158 QEVDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAG 216
           QE+D  +  +FW+  F KLG+   F  +  K HG+L+AW    F + +  ++DYD    G
Sbjct: 166 QEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTG 225

Query: 217 NVISARTRTKNIALIISLYFKGIT-----DSSSRGIIVANTHLFWHPFGVFERLRQSYLV 271
             I  RT TKN+ +++SL FK        D+   GII+  THLFWHPFG +ER RQ Y+V
Sbjct: 226 -AIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIV 284

Query: 272 LQKIQEIK-----ACSKYNG----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322
           L+K++E +       ++ +G    W +   GDFN++P + PYL+IT +P+   G  + ++
Sbjct: 285 LKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVI 344

Query: 323 ECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382
           ECS ++ +SK R+G            K  G+G   QP+ P PESF+  +E+K L   +  
Sbjct: 345 ECSTSFTFSKLRDGDEGEGEEGGNIEKF-GKG---QPETPVPESFSGNEEQKQLCENMKT 400

Query: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQD 440
           LHN + ++ +SLY I Y KVHPEN+  +    EP +SNWA+ W GLLDY++Y+      D
Sbjct: 401 LHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCD 460

Query: 441 TRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRLFF 496
             + + L+ FE N  V+++  LR+P A+EM +H QP EGEY SDH+ ++ ++ +  
Sbjct: 461 CTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGIIM 516

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  355 bits (911), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 190/475 (40%), Positives = 277/475 (58%), Gaps = 44/475 (9%)

Query: 41  SVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATI 100
           S ++I K+R ER   ++ +        K+     P+LQFI+RP L ++ +      P   
Sbjct: 118 SPEEIAKLRAERKLLKEAK--------KEVSVIPPELQFIKRPILYLHEEE-----PV-- 162

Query: 101 QVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEV 160
                     +MTYN LAQ LIRR  FP+SG ALKW++RSKVL++E   Y PD++ LQEV
Sbjct: 163 ----QGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFTYYSPDIICLQEV 218

Query: 161 DYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVI 219
           D+ +  +FW+  F KLG+   + R   K HG+ + W    F + +  ++++D   +GNV 
Sbjct: 219 DHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMTDKMLIEFDKESSGNV- 277

Query: 220 SARTRTKNIALIISL--------YFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLV 271
             RT T N+ LI+SL         FK + +++  GII+  THLFWHPFG +ER RQ Y+V
Sbjct: 278 PPRTTTNNVGLILSLKFTPEAKAQFKNV-ETTKTGIIIGTTHLFWHPFGTYERTRQCYVV 336

Query: 272 LQKIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322
           L K++E    +      N      W+    GDFN++P + PYL++ ++P+   G  + ++
Sbjct: 337 LNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSMVRKPVEYSGRAKTVI 396

Query: 323 ECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382
           ECS +Y++SKKR+G            +  G    DQPQ P PE F A  E+  LV  +  
Sbjct: 397 ECSTSYKFSKKRDGEEDVDDEEGGNIEKFG---IDQPQTPVPEEFIANGEQTILVKDMEK 453

Query: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQD 440
           LHNSL+++ +SLYG+GY  VHPENA  +   GEP +SNWA+TW GLLDY+ +++     D
Sbjct: 454 LHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLLDYLLFVKEWTFSD 513

Query: 441 TRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRLF 495
             + E L  FE +N+++I G+LRMP A EM KH QP  GEY SDH+S++C I L 
Sbjct: 514 CTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSMLCSIELL 568

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  339 bits (869), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/483 (39%), Positives = 283/483 (58%), Gaps = 49/483 (10%)

Query: 39  QLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPI---NHDNSKGL 95
           +LS D+I+K RE    K+  R   LI QG+DPD P  +L FI+RP L +    H N KG 
Sbjct: 16  ELSQDEIRKQREIFKSKK--REKKLI-QGEDPDHPI-ELSFIKRPILYLPHHGHSNRKGF 71

Query: 96  TPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVV 155
                          +MTYN LAQ +IRR+ F +SGPALKW +RSKVL++E+  Y PD++
Sbjct: 72  K------------FSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDIL 119

Query: 156 SLQEV-DYNELNFWQENFHK-LGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNI 213
            LQE+ D+   NFW++     L  +  + + + K HG+L+AW    F+  +  ++D+D++
Sbjct: 120 CLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDV 179

Query: 214 LAGNVISARTRTKNIALIISLYFKG--IT----------DSSSRGIIVANTHLFWHPFGV 261
              N I+ RT T+NIA+ ++L F    IT          D +  G I++ THLFWHPFG 
Sbjct: 180 KTSN-IARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGT 238

Query: 262 FERLRQSYLVLQKIQEIKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKG 316
           FER RQ Y++L+K+++              W+  + GDFN+ P + PYL++T +P+   G
Sbjct: 239 FERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTG 298

Query: 317 PIRAMVECSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKAL 376
             + ++ECS AY++SK+RNG            +   +   +QP++  P+SFT T E+  L
Sbjct: 299 REKKVIECSTAYKFSKRRNG------EIGDSDEEEEKKLINQPKDMVPDSFTPTIEQAKL 352

Query: 377 VNQLVALHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIE 434
           V+QL +LHN L ++  SLYG+ Y  V P N   N   GEP  ++WA +W G+LDYI Y++
Sbjct: 353 VHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVD 412

Query: 435 G-DHNQDTRQ-KEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQI 492
             D N+   +  E L  FE NN + I G L+MP  ++MP H+QPFE EY SDHIS++C++
Sbjct: 413 NWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEM 472

Query: 493 RLF 495
            + 
Sbjct: 473 EIL 475

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  338 bits (866), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 185/467 (39%), Positives = 262/467 (56%), Gaps = 36/467 (7%)

Query: 44  QIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVT 103
           +I+  RE R  K+Q  R  L+S+G DPDFP  + QFIERP L + H ++           
Sbjct: 26  EIEAKREARRLKKQKLREELLSRGLDPDFPA-ECQFIERPILLVPHGDNY---------- 74

Query: 104 QDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYN 163
           +  L + IMTYN LAQTLIRR+ FPESGPALKW  RSKVL+HE+K Y  D+  LQE+D  
Sbjct: 75  ERGLPLSIMTYNCLAQTLIRREMFPESGPALKWFVRSKVLLHEIKHYNADICCLQEIDDV 134

Query: 164 ELN-FWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISAR 222
           + + FW E   K G+  I+   + K+HG+++AW  + FQL++   +++D   A   I  R
Sbjct: 135 QYDLFWSEELPKFGYKTIYFHQDSKSHGVMIAWKEELFQLESHMNIEFDK-EAPAGIQPR 193

Query: 223 TRTKNIALIISLYFKGI-------TDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKI 275
           TRT N+ L+++L F            +S  G+I+   HLFWHPFG ++R RQ  ++ +KI
Sbjct: 194 TRTNNVGLLVALAFTDAFRARNNRIRTSRSGVIIGTFHLFWHPFGTYDRTRQCLVIKKKI 253

Query: 276 QEIKACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRN 335
            E     K   +  +  GDFN++P   PYL +T+    L    R  +E S AYRYS++RN
Sbjct: 254 LEFAGTVK-GDYCKMFTGDFNSQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRN 312

Query: 336 -------GXXXXXXXXXXXXKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLH 388
                               +   +  +D    P+P+ F +T+E++ LVN L+   N + 
Sbjct: 313 LGKEYSMEEEEEEEEEEEKREYEYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVP 372

Query: 389 VKGVSLYGIGYGKVHPENANGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLN 448
           +   SLY IGY  V P +    H EP LS+W+  W GLLDYIFY+      + R   P  
Sbjct: 373 LCATSLYSIGYHTVDPTHI-ADHHEPELSSWSTKWAGLLDYIFYV------NQRPSTPA- 424

Query: 449 AFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRLF 495
            FE  NN+ I GYL+MP   +M  HSQP+ GEY SDHIS+MC + ++
Sbjct: 425 TFETANNIAIAGYLQMPTHAQMHNHSQPYTGEYPSDHISMMCALEIY 471

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  329 bits (843), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/478 (39%), Positives = 274/478 (57%), Gaps = 36/478 (7%)

Query: 34  KIHRDQLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSK 93
           K+ R +++ + I++IR  R +KR+  +       ++         FI+RP L + +    
Sbjct: 6   KLPRSEITPEYIERIRALRREKREREKAERADVARE--------IFIKRPLLEVPYVGG- 56

Query: 94  GLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPD 153
                 +      + VKIMTYNTLAQTLIRR  FP++  A+KWH+RS+VL+ EL+ Y  D
Sbjct: 57  ------VPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDAD 110

Query: 154 VVSLQEVDYNELN-FWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQ---LDNDWMLD 209
           VV LQE D  + + FW E F +LG+   F    GK HG+ + W    F+   LD    L 
Sbjct: 111 VVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDK-LPLC 169

Query: 210 YDNILAGNVISARTRTKNIALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSY 269
            D+ +AG+ I+A T T+ +AL ++L  K     +SR II + THLFWH FG FER RQ +
Sbjct: 170 LDDYVAGDDIAATTGTRTVALAVALRLKH--HKTSRPIIFSTTHLFWHLFGTFERTRQLF 227

Query: 270 LVLQKIQEI------KACSKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVE 323
           ++L ++ +         C +    ++   GDFN++P + PYL++T +P+ LKG  ++++E
Sbjct: 228 VILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIE 287

Query: 324 CSLAYRYSKKRNGXXXXXXXXXXXXKSRGEGHSDQ---PQNPKPESFTATKEEKALVNQL 380
           CSL+YRYSK+RN              S  E   D+   PQ+P+P ++ A  E+   V  L
Sbjct: 288 CSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAMPEQVERVQHL 347

Query: 381 VALHNSLHVKGVSLYGIGYGKVHPENAN----GSHGEPGLSNWANTWCGLLDYIFYIEGD 436
             LHN + ++GVSLYGIGY  VHPEN+N      + EP LS+ A  W GLLDYIF I  +
Sbjct: 348 QNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLI-TE 406

Query: 437 HNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494
            +++  +   L A E    +KI GYLRMP  +EM  H++P E EY SDH+++MC I L
Sbjct: 407 WSENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISL 464

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  325 bits (833), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 168/446 (37%), Positives = 247/446 (55%), Gaps = 35/446 (7%)

Query: 66  QGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRD 125
           Q   P+  + +L+FI RP LP+             Q         +MTYN LAQ+LIRR 
Sbjct: 58  QQMAPNITSLNLEFIARPMLPLK----------VTQTVHKGFSFSLMTYNCLAQSLIRRS 107

Query: 126 FFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFKRH 184
            FP SG ALKW KRS VL+ E K Y  DV+ LQE+DY +  +FW      LG+   F R 
Sbjct: 108 LFPTSGRALKWTKRSMVLLKEFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRM 167

Query: 185 EGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF-----KGI 239
           + K+HG+ + W    F   +  ++++DN  +G  I  R  T N+ +I++L F     +  
Sbjct: 168 DNKSHGVAIFWKKDLFIWMDQMLINFDNEDSGE-IEPRKTTNNVGMILALGFSDKVKQSF 226

Query: 240 TDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI---------KACSKYNGWHSL 290
             +   GIIV  +HLFWHPFG +ER RQ Y++L K++E          +  +    W+  
Sbjct: 227 PGTVKSGIIVGTSHLFWHPFGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPF 286

Query: 291 LMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGXXXXXXXXXXXXKS 350
             GDFN++P + PYL+IT +P++  G  + ++ECS AY++     G            + 
Sbjct: 287 FCGDFNSQPFDAPYLSITSKPVLYSGRAKTVIECSAAYKFPDLGAGARGAN-------ED 339

Query: 351 RGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENA--N 408
            G    D+P +P PESF  T E  +LV ++  LHNSL ++ +SLY + Y  VHP+NA  +
Sbjct: 340 GGTVGEDRPVDPVPESFQPTAEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLD 399

Query: 409 GSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQ 468
              GEP +SNWA TW GLLDYI YI      +  + + L +FE  +++ +   LRMP A+
Sbjct: 400 NERGEPEISNWAYTWRGLLDYIMYITPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAK 459

Query: 469 EMPKHSQPFEGEYASDHISLMCQIRL 494
           EM  H QP +GEY SDH+++MC++ +
Sbjct: 460 EMSSHGQPHDGEYPSDHLAMMCKLEV 485

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  320 bits (821), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 175/487 (35%), Positives = 282/487 (57%), Gaps = 36/487 (7%)

Query: 27  EDGPAHQKIHRDQLSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLP 86
           ++ P H K+ + Q++ + I KIR+ R +KR        ++  +P+F      FI+R  L 
Sbjct: 7   QEPPKHIKLPKSQITPEFISKIRKLREKKRAE------NEENNPEFLNSKYDFIKRAILQ 60

Query: 87  INHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHE 146
           +            ++   +S+D+KIMTYNTL+Q+LIRR+ +P++  A+KWH RSKV+++E
Sbjct: 61  L----------PNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNE 110

Query: 147 LKKYRPDVVSLQEVDYNELN-FWQENFHKLGFD-VIFKRHEG-KTHGLLVAWNNKKFQLD 203
           +K Y  D++  QEVD  + + FW     KLG++   +K   G K HG+ + W +  F+  
Sbjct: 111 IKYYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQF 170

Query: 204 NDWMLDYDNILAGNVISARTRTKNIALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFE 263
           +   +++D+I+AGN IS  TRT N+ LI++L FK        GI++  THLFWHPFG FE
Sbjct: 171 DVIKINFDDIVAGNAISKTTRTWNVGLIVALKFKSSNAKFRSGIVIGTTHLFWHPFGTFE 230

Query: 264 RLRQSYLVLQKIQEI-----KACSKYNG----WHSLLMGDFNTEPEEPPYLAITKRPLIL 314
           R RQ  ++L+K +++       C   N     W  +L GDFN++P + PYL+IT +P+  
Sbjct: 231 RTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSKPVSA 290

Query: 315 KGPIRAMVECSLAYRYSKKRNGXXXXXXXXXXXXKSRG-------EGHSDQPQNPKPESF 367
            G  + ++ECS AY++S++R+G            +++        E     P +P+P  F
Sbjct: 291 SGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPRPSHF 350

Query: 368 TATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENANGSHGEPGLSNWANTWCGLL 427
            AT E+K L+ +L  +HNS+++K  SL+GI Y KVH    N    EP LS+ +  W GLL
Sbjct: 351 EATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVHSIGLN-CKNEPELSHTSIFWTGLL 409

Query: 428 DYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHIS 487
           DYIF +E  +  +      L  FE   ++++ G L+MP  +E+PK+ QP +G+Y SDH+S
Sbjct: 410 DYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQYPSDHLS 469

Query: 488 LMCQIRL 494
           ++C + +
Sbjct: 470 MICDLNV 476

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 108/271 (39%), Gaps = 46/271 (16%)

Query: 70  PDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLD-------VKIMTYNTLAQ--- 119
           P+ P P     ER F+ IN D       A++Q +   L+         +++YNTL Q   
Sbjct: 368 PEIPLP----TERKFIDINVDGEVTQEYASLQESDSHLNRETAKKSFTLLSYNTLCQHYA 423

Query: 120 TLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFD 178
           T     F P    AL W  R + L  ++  Y  D++ LQEV+     +FW     + G+ 
Sbjct: 424 TPKMYRFTPSW--ALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFWAPLLREEGYT 481

Query: 179 VIFK----------RHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR---- 224
            IF           +   K  G  + + + +F+L     +D+ ++   +    RT     
Sbjct: 482 GIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHKKFQRTEDYLN 541

Query: 225 ----TKNIALIISLYFKGITDSSSRGIIVANTHLFWHP-FGVFERLRQSYLVLQKIQEIK 279
                 N+AL++ L        S   +  A THL W P F   +  +   L+    + IK
Sbjct: 542 RAMNKDNVALLVKLQHL----KSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIK 597

Query: 280 ACSKYNGWHSL------LMGDFNTEPEEPPY 304
             S YN    L      + GDFN++ +   Y
Sbjct: 598 EHSGYNNSQELKKVPVIICGDFNSQVDSAVY 628

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 88/220 (40%), Gaps = 43/220 (19%)

Query: 70  PDFPTPDLQFIERPFLPINHDNS-----KGLTPATIQVTQDSL--DVKIMTYNTLAQ--- 119
           P+ P P+     R F+ IN D         L  +   V QD+L     +++YNTL Q   
Sbjct: 403 PELPLPE----PRHFIEINADGELTQEHVSLEESNSHVNQDTLKRSFTLLSYNTLCQHYA 458

Query: 120 TLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVD---YNELNFWQENFHKLG 176
           T     F P    AL W  R + L  E+  Y+ DV+ LQEV+   Y E  FW     K G
Sbjct: 459 TPKMYRFVPSW--ALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE--FWLPLLEKQG 514

Query: 177 FDVIFK----------RHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR-- 224
           +  +F           +   K  G  + + N +F       +D+ ++   +    RT   
Sbjct: 515 YSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMKHKKFQRTEDY 574

Query: 225 ------TKNIALIISLYFKGITDSSSRGIIVANTHLFWHP 258
                   NIALI+ L      + S   + V  THL W P
Sbjct: 575 LNRAMNKDNIALIVKLKH----ELSGEHVWVVTTHLHWDP 610

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 108/269 (40%), Gaps = 54/269 (20%)

Query: 70  PDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLD-------VKIMTYNTLAQ--- 119
           P+ P P+     R F+ +N D     T   I+ + + L+         +++YNTL Q   
Sbjct: 356 PEIPLPE----PRRFIEVNADGESVETYRCIEESTNHLNEELLKKSFTLLSYNTLCQHYA 411

Query: 120 TLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVD---YNELNFWQENFHKLG 176
           T     F P    AL W  R + L  E+  Y+ D++ LQEV+   Y E  FW     K G
Sbjct: 412 TPKMYRFVPSW--ALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEE--FWLPILEKQG 467

Query: 177 FDVIF----------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR-- 224
           +  IF           +   K  G  + + N +F       +D+ ++   +    RT   
Sbjct: 468 YSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMKHKKFQRTEDY 527

Query: 225 ------TKNIALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI 278
                   N+ALII L      + +   + V  THL W P     +  Q  ++L  I+  
Sbjct: 528 LNRAMNKDNVALIIKLRH----ERTGEHVWVVTTHLHWDPHFNDVKTFQVAVMLDYIE-- 581

Query: 279 KACSKYNGWHS---------LLMGDFNTE 298
           K   ++ G  S         ++ GDFN++
Sbjct: 582 KLLKQHGGVGSPQDKKKIPLVICGDFNSQ 610

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 107/271 (39%), Gaps = 46/271 (16%)

Query: 70  PDFPTPDLQFIERPFLPINHDNSKGLTPATIQ-----VTQDSL--DVKIMTYNTLAQ--- 119
           P+ P P     ER F+ IN D       +++Q      ++++L     I++YNTL Q   
Sbjct: 366 PEIPLP----TERKFIDINIDGEATQECSSLQESDAHQSRETLKKSFTILSYNTLCQHYA 421

Query: 120 TLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFD 178
           T     F P    AL W  R + L  ++  Y  D+V LQEV+     +FW     + G+ 
Sbjct: 422 TPKMYRFTPSW--ALSWEYRREKLKEQILSYNTDIVCLQEVECKTYEDFWAPLLREKGYS 479

Query: 179 VIF----------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR---- 224
            IF           +   K  G    + + +F+L     +D+ ++   +    RT     
Sbjct: 480 GIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMKHKKFQRTEDYLN 539

Query: 225 ----TKNIALIISLYFKGITDSSSRGIIVANTHLFWHP-FGVFERLRQSYLVLQKIQEIK 279
                 N+AL++ L        S   +  A THL W P F   +  +   L+    + IK
Sbjct: 540 RAMNKDNVALVVKLQHI----KSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDYMEKVIK 595

Query: 280 ACSKYNGWHSL------LMGDFNTEPEEPPY 304
             +  N    L      + GDFN++     Y
Sbjct: 596 EQNNCNNTQELKKVPVVICGDFNSQTNSAVY 626

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 86/208 (41%), Gaps = 24/208 (11%)

Query: 75  PDLQFI-ERPFLPINHDNSKGLTPATIQVTQDSLD-------VKIMTYNTLAQTLIRRDF 126
           P++  + +RPF+ ++ D        ++Q +   +D         +++YNTL Q       
Sbjct: 393 PEIPLVHDRPFVELDIDGEPKHEYESLQESSQGVDHELTKKSFTVLSYNTLCQHYATPKM 452

Query: 127 FPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFK-- 182
           +  +   AL W  R   L  ++  Y  D++ LQEV+     +FW     K G+   F   
Sbjct: 453 YRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFEDFWLPLLEKHGYSGSFHAK 512

Query: 183 --------RHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRT-KNIALI-- 231
                   R   K  G  V +   KF+L     +D+ +    +    RT    N A+   
Sbjct: 513 TRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMKHEKFQRTEDFLNRAMNKD 572

Query: 232 -ISLYFKGITDSSSRGIIVANTHLFWHP 258
            I+LYFK    +S   I VA THL W P
Sbjct: 573 NIALYFKLQHIASGEHIWVATTHLHWDP 600

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 100/243 (41%), Gaps = 41/243 (16%)

Query: 44  QIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNS-----KGLTPA 98
           QI KI  E++         LI   +D     P LQ  +R F+ +N D         L  +
Sbjct: 335 QIIKILTEKS------VTGLIFYLRDNAPEVPLLQ--DRKFIDVNTDGEPTEEFNSLQES 386

Query: 99  TIQVTQDSL--DVKIMTYNTLAQTLIRRDFFPESGP-ALKWHKRSKVLVHELKKYRPDVV 155
           T  +++++L     +++YNTL Q       +  +   AL W  R   L  ++  ++ DVV
Sbjct: 387 TQHLSKETLKRSFTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVV 446

Query: 156 SLQEVDYNEL-NFWQENFHKLGFDVIF----------KRHEGKTHGLLVAWNNKKFQLDN 204
            LQEV+     +FW     K G+  +F           +   K  G  V + N +F+L  
Sbjct: 447 CLQEVECKTFEDFWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVF 506

Query: 205 DWMLDYDNILAGNVISARTR--------TKNIALIISL-YFKGITDSSSRGIIVANTHLF 255
              +D+ ++   +    RT           N+AL + L + K     ++  I V  THL 
Sbjct: 507 KDAVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALFVKLQHLK-----TNEQIWVTTTHLH 561

Query: 256 WHP 258
           W P
Sbjct: 562 WDP 564

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 80/201 (39%), Gaps = 23/201 (11%)

Query: 81  ERPFLPINHD-------NSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGP- 132
           +R F+ IN D       +S  L  A I    +     I++YNTL Q       +  +   
Sbjct: 534 DREFIEINADGEPTRKYDSLQLASANINPDLEKKSFTILSYNTLCQHYATPKMYRYTPSW 593

Query: 133 ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIF---------- 181
           AL W  R + L  ++  Y+ D++ LQEV+      FW     K  +  +F          
Sbjct: 594 ALSWDYRREKLKEQILSYQSDILCLQEVESKTFEEFWGPLLEKYDYQGVFHIKTRAKTMQ 653

Query: 182 KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTK-NIAL---IISLYFK 237
            +   K  G  + +   KF+L     +D+      +    RT    N A+    ++LY K
Sbjct: 654 TKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMKHKKFQRTEDYLNRAMNKDNVALYMK 713

Query: 238 GITDSSSRGIIVANTHLFWHP 258
             + +S   + V  THL W P
Sbjct: 714 LQSITSGETVWVVTTHLHWDP 734

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 83/217 (38%), Gaps = 35/217 (16%)

Query: 111 IMTYNTLAQTLIRRDFFPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFW 168
           +++YNTL Q       +  +   AL W  R + L  ++  Y  DV+ LQEV+      +W
Sbjct: 466 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEEYW 525

Query: 169 QENFHKLGFDVIF----------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218
                K G+  +F           +   K  G  V +   +F+L     +D+  +   + 
Sbjct: 526 APLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQKHK 585

Query: 219 ISARTRTK-NIAL---IISLYFKGITDSSSRGIIVANTHLFWHP---------FGVF--- 262
              RT    N A+    +++Y K     S   + +  THL W P          GV    
Sbjct: 586 KFQRTEDYLNRAMNKDNVAIYLKLQHIKSGESVWIVTTHLHWDPQFNDVKTFQVGVLMDH 645

Query: 263 -ERLRQSYLVLQKIQEIKACSKYNGWHSLLMGDFNTE 298
            E L +     Q  QE K C        +L GD N+E
Sbjct: 646 IENLLKEQSNAQSKQEAKKCP------VILCGDLNSE 676

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 99/264 (37%), Gaps = 50/264 (18%)

Query: 81  ERPFLPINHD-------NSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGP- 132
           +R F+ IN D       ++  L+ + I          +++YNTL Q       +  +   
Sbjct: 505 DRKFITINADEEPQEEFDTMALSDSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSW 564

Query: 133 ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIF---------- 181
            L W  R + L +++   + DV+ LQEV+     +FW     K G+  IF          
Sbjct: 565 VLSWDTRREQLKNQILGIQSDVICLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQ 624

Query: 182 KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR--------TKNIALIIS 233
            +   K  G  + +   +F+L +   +D+  +   +    RT           N+AL + 
Sbjct: 625 SKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALFVK 684

Query: 234 LYFKGITDSSSRGIIVANTHLFWHP---------FGV----FERLRQSYLVLQKIQEIKA 280
           L       +S   + V  THL W P          GV     E L + Y      QEI+ 
Sbjct: 685 LEHI----NSGESVWVVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKDYNNASSKQEIRK 740

Query: 281 CSKYNGWHSLLMGDFNTEPEEPPY 304
           C        ++ GD N+  +   Y
Sbjct: 741 CP------VIICGDLNSHLQSAVY 758

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 107/275 (38%), Gaps = 36/275 (13%)

Query: 81  ERPFLPINHDNS-----KGLTPATIQVTQD--SLDVKIMTYNTLAQTLIRRDFFPESGP- 132
           ER F+ IN D         L  +T  +T D       +++YNTL Q       +  +   
Sbjct: 464 ERRFIEINTDGEPQREYDSLQQSTEHLTADLAKRSFTVLSYNTLCQHYATPKMYRYTPSW 523

Query: 133 ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIF---------- 181
           AL W  R   L  ++  Y  DV+ LQEV+     ++W     K G+  +F          
Sbjct: 524 ALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFEDYWVPLLEKHGYTGVFHAKARAKTMH 583

Query: 182 KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTK-NIAL---IISLYFK 237
            +   K  G  + +   +F++ N   +D+      +    RT    N A+    ++L+ K
Sbjct: 584 SKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLK 643

Query: 238 GITDSSSRGIIVANTHLFWHP-FGVFERLRQSYLVLQKIQEIKACSKYNGWHS------L 290
               SS   I V  THL W P F   +  +   L+      +K  + +N          L
Sbjct: 644 LQHVSSGDTIWVVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEDTTHNSRQDIKKSPVL 703

Query: 291 LMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECS 325
           + GDFN+      Y+      LI  G ++A  E S
Sbjct: 704 ICGDFNS------YINSAVYELISTGRVQAHQEGS 732

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 106/264 (40%), Gaps = 37/264 (14%)

Query: 75  PDLQFI-ERPFLPINHDNSKGLTPATIQVTQDSLD-------VKIMTYNTLAQTLIRRDF 126
           P++  I +R F+ IN D        ++    D+L+         IM+YN L Q       
Sbjct: 482 PEVPLIKDREFIEINTDGEVSEVYDSLSNATDNLNKEVAKRSFTIMSYNILCQHYATPKM 541

Query: 127 FPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVD---YNELNFWQENFHKLGFDVIF- 181
           +  +   AL W  R + L  E+  Y  D+V LQEV+   Y E   W     K G+  +F 
Sbjct: 542 YRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE--HWAPLMLKQGYSGVFH 599

Query: 182 ---------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISART-----RTKN 227
                     +   K  G  V +   +F+L     +D+ +    +    RT     R  N
Sbjct: 600 AKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMKHKKFQRTEDYLNRAMN 659

Query: 228 IALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI-----KACS 282
              ++ +Y K     S   + +A THL W P     +  Q  +++  ++E+        S
Sbjct: 660 KDNVV-IYIKLNHLKSGESVWIATTHLHWDPQFNDVKTFQVGILMDHLEELIKEHGSPSS 718

Query: 283 KYNGWHS--LLMGDFNTEPEEPPY 304
           + +   S  ++ GDFN++ +   Y
Sbjct: 719 RQDPKKSPVIICGDFNSQKDSAVY 742

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 96/247 (38%), Gaps = 30/247 (12%)

Query: 81  ERPFLPINHDNSKGLTPATIQVTQDSLDV-------KIMTYNTLAQTLIRRDFFPESGP- 132
           ER F+ IN D        ++Q + + L          +++YNTL Q       +  +   
Sbjct: 502 ERKFIEINTDGEPQKEYDSLQQSTEHLSADLAKKTFSVLSYNTLCQHYATPKMYRYTPSW 561

Query: 133 ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIF---------- 181
           AL W  R   L  ++  Y  DV+ LQEV+     ++W     K G+  IF          
Sbjct: 562 ALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFEDYWVPLLDKHGYTGIFYAKARAKTMH 621

Query: 182 KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTK-NIAL---IISLYFK 237
            +   K  G  + +   +F+L     +D+      +    RT    N A+    ++L+ K
Sbjct: 622 SKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLK 681

Query: 238 GITDSSSRGIIVANTHLFWHP-FGVFERLRQSYLVLQKIQEIKACSKYNGWHS------L 290
               SS   I V  THL W P F   +  +   L+      +K  + +N          L
Sbjct: 682 LQHVSSGDTIWVVTTHLHWDPKFNDVKTFQVGVLLDHLESLLKEDTTHNSRQDIKKSPVL 741

Query: 291 LMGDFNT 297
           + GDFN+
Sbjct: 742 ICGDFNS 748

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 109/292 (37%), Gaps = 54/292 (18%)

Query: 70  PDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLD-------VKIMTYNTLAQTLI 122
           P+ P P     +R F+ IN D        T+Q  + +L          +++YNTL Q   
Sbjct: 496 PEVPYPH----DRKFIEINADGEPEKEYDTVQEAERNLSSDMQKKSFTMLSYNTLCQHYA 551

Query: 123 RRDFFPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVI 180
               +  +   AL W  R + L  ++  +  D++ LQEV+     +FWQ    K G+  +
Sbjct: 552 TPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFEDFWQPLLEKHGYTGL 611

Query: 181 F----------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR------ 224
           F           +   K  G    +   KF++     +D+  +   +    RT       
Sbjct: 612 FHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMKHKKFQRTEDYLNRA 671

Query: 225 --TKNIALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKACS 282
               N+A+++ L        S   + +  THL W P     +  Q  ++L  ++ +    
Sbjct: 672 MNKDNVAIVMKLQHI----QSGEIMWLVTTHLHWDPKFNDVKTFQVGVLLDHMETLLK-- 725

Query: 283 KYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKR 334
                            E+ P   + K PL++ G + + +  S+   +S  R
Sbjct: 726 -----------------EQNPKQDVKKYPLVICGDLNSYLSSSVYELFSTGR 760

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 81/212 (38%), Gaps = 27/212 (12%)

Query: 70  PDFPTPDLQFIERPFLPINHDNS-----KGLTPATIQVTQDSL--DVKIMTYNTLAQTLI 122
           P+ P P     +R F+ IN D         L  A   V    L     I++YNTL Q   
Sbjct: 424 PEVPLP----ADRKFIEINTDGEPTREFDSLESANTAVEAGLLKKSFTILSYNTLCQHYA 479

Query: 123 RRDFFPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVI 180
               +  +   AL+W  R + L  ++  Y  D++ LQEV+     +FW     K G+   
Sbjct: 480 TPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYEDFWAPLLEKNGYTGY 539

Query: 181 F----------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTK-NIA 229
           F           +   K  G  V +   KF+L     LD+      +    RT    N A
Sbjct: 540 FHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQKHKRFQRTEDYLNRA 599

Query: 230 L---IISLYFKGITDSSSRGIIVANTHLFWHP 258
           +    +++Y K     S   + V  THL W P
Sbjct: 600 MNKDNVAIYMKLQHVQSGEYLWVVTTHLHWDP 631

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 103/260 (39%), Gaps = 43/260 (16%)

Query: 75  PDLQFI-ERPFLPINHDNS-----KGLTPATIQVTQD--SLDVKIMTYNTLAQTLIRRDF 126
           PD+  + +R F+ IN D         +  AT  +++D       +++YNTL Q       
Sbjct: 522 PDIPLMKDRKFIEINTDGEPQTEYDSIEDATSHLSRDLEKRSFTVLSYNTLCQHYATPKM 581

Query: 127 FPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIF--- 181
           +  +   AL W  R   L  ++  ++ D++ LQEV+     +FW+    K G+  IF   
Sbjct: 582 YRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDDFWEPLLQKHGYKGIFHAK 641

Query: 182 -------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTK-NIAL--- 230
                   +   K  G  + +   +F++     +D+  I   +    RT    N A+   
Sbjct: 642 TRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMKHKNFQRTEDYLNRAMNKD 701

Query: 231 IISLYFKGITDSSSRGIIVANTHLFWHP---------FGV----FERLRQSYLVLQKIQE 277
            +++Y K     S     +  THL W P          GV     E L + +  +   Q+
Sbjct: 702 NVAIYMKLQHIKSGEVTWIVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKEHSNIHSKQD 761

Query: 278 IKACSKYNGWHSLLMGDFNT 297
           +K C        ++ GD N+
Sbjct: 762 VKKCP------IIICGDLNS 775

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 81/203 (39%), Gaps = 27/203 (13%)

Query: 81  ERPFLPINHDNSKGLTPATIQVTQDSLD-------VKIMTYNTLAQTLIRRDFFPESGP- 132
           +R F+ IN D         ++V+ + L+         +++YNTL Q       +  +   
Sbjct: 417 DRQFIEINTDGDIQDGYENVEVSNEHLNPELQKKSFTVLSYNTLCQHYATPKMYRYTPSW 476

Query: 133 ALKWHKRSKVLVHELKKYRPDVVSLQEVD---YNELNFWQENFHKLGFDVIF-------- 181
           AL W  R + L  ++  ++ DV+ LQEV+   Y E  FW     K G+   F        
Sbjct: 477 ALSWDYRREKLKDQILSFKSDVICLQEVESKSYEE--FWLPLLQKNGYAGTFYAKTRAKT 534

Query: 182 --KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTK-NIAL---IISLY 235
              +   K  G  + +   +F +     +D+  +   +    RT    N A+    ++LY
Sbjct: 535 MQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALY 594

Query: 236 FKGITDSSSRGIIVANTHLFWHP 258
            K     S   + V  THL W P
Sbjct: 595 MKLEHIKSGESVWVVTTHLHWDP 617

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 77/205 (37%), Gaps = 31/205 (15%)

Query: 81  ERPFLPINHDNSKGLTPATIQVTQDSLDV-------KIMTYNTLAQTLIRRDFFPESGP- 132
           ER F+ IN D        ++Q + + L V        +++YNTL Q       +  +   
Sbjct: 472 ERRFIEINTDGEPQREYDSLQQSTEHLSVDLAKRTFTVLSYNTLCQHYATPKMYRYTPSW 531

Query: 133 ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIF---------- 181
           AL W  R   L  ++  Y  D++ LQEV+     ++W     K G+  IF          
Sbjct: 532 ALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEDYWVPLLDKHGYTGIFHAKARAKTMH 591

Query: 182 KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR--------TKNIALIIS 233
            +   K  G  + +   +F+L     +D+      +    RT           N+AL + 
Sbjct: 592 SKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLK 651

Query: 234 LYFKGITDSSSRGIIVANTHLFWHP 258
           L      D+    I    THL W P
Sbjct: 652 LQHIPSGDT----IWAVTTHLHWDP 672

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 97/262 (37%), Gaps = 42/262 (16%)

Query: 70  PDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDV-------KIMTYNTLAQTLI 122
           P+ P P     ER F+ IN D        ++Q + + L          +++YNTL Q   
Sbjct: 463 PEIPLPH----ERRFIEINTDGEPQREYDSLQQSTEHLATDLAKRTFTVLSYNTLCQHYA 518

Query: 123 RRDFFPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVI 180
               +  +   AL W  R   L  ++  Y  D++ LQEV+      +W     K G+  I
Sbjct: 519 TPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEEYWVPLLDKHGYTGI 578

Query: 181 F----------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR------ 224
           F           +   K  G  + +   +F+L     +D+      +    RT       
Sbjct: 579 FHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRA 638

Query: 225 --TKNIALIISLYFKGITDSSSRGIIVANTHLFWHP-FGVFERLRQSYLVLQKIQEIKAC 281
               N+AL + L      D+    I    THL W P F   +  +   L+      +K  
Sbjct: 639 MNKDNVALFLKLQHIPSGDT----IWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEE 694

Query: 282 SKYN------GWHSLLMGDFNT 297
           + +N       +  L+ GDFN+
Sbjct: 695 TSHNFRQDIKKFPVLICGDFNS 716

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 100/235 (42%), Gaps = 55/235 (23%)

Query: 111 IMTYNTLAQTLIRRDFFPESGPALK-WHKRSKVLVHEL-KKYRPDVVSLQEVDYNELN-F 167
           ++TYN L+   +    +       K W  R ++L HEL  KY+ D++ LQE+  N+ N F
Sbjct: 36  MLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYNEF 95

Query: 168 WQEN-FHKLGFDVIFKRHEGKTH---------GLLVAWNNKKFQ-------LDNDWMLDY 210
           W++   +++ +   F       +         G+ + +N  KF+         ND +  +
Sbjct: 96  WKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLVGTF 155

Query: 211 D----------NIL----AGNVIS-------ARTRTKNIALIISLYFKGITDSSSRGIIV 249
           D          NI     AG+VI        A+ R + + L + L  +     S   I+V
Sbjct: 156 DQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQ-VCLFVMLRHR----ESKSIIVV 210

Query: 250 ANTHLFWHPFGVFERLRQSYLVLQKIQEIKA-------CSKYNGWHSLLMGDFNT 297
            NTHL+W    V  +L Q  ++++K+Q I            Y+    L  GDFN+
Sbjct: 211 INTHLYWKYDEV--KLVQCLIIMRKLQRIIKGLLMGIEGVTYSNVKILFSGDFNS 263

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 110/275 (40%), Gaps = 68/275 (24%)

Query: 82  RPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALK-WHKRS 140
           R  LP+++   K   P  I+ +       +MTYN L+   +    +       K W  R 
Sbjct: 4   RKLLPVSNSALKPSLPE-IRNSVSRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRH 62

Query: 141 KVLVHE-LKKYRPDVVSLQEV---DYNELNFWQENFH-KLGFDVIF---------KRHEG 186
           ++L  E L  YR D++ +QE+   DY    FW+ +F  K+ +   +         KR E 
Sbjct: 63  RLLEREILNLYRADIMCVQELTCKDYE--GFWKNHFKTKMNYGSSYIAKTPPKYWKRPED 120

Query: 187 KTHGLLVAWNNKKFQ-------LDNDWM-------------------------LDYDNIL 214
           +  G+ + +N  KF+         ND +                         +D D++L
Sbjct: 121 EMDGVGIFYNLNKFEHISTSSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLL 180

Query: 215 AGNVISARTRTKNIALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQK 274
             NV+  R +   ++L +SL  K     +    +V NTHL+W    V  +L Q   +++K
Sbjct: 181 --NVLHGRNQ---VSLFVSLLHK----ETRTLFVVVNTHLYWKYDEV--KLCQCLTIMRK 229

Query: 275 IQEIKAC-------SKYNGWHSLLMGDFNTEPEEP 302
           +  +            Y+    L  GD N+ P+ P
Sbjct: 230 LHRVIKSLLMGMEGVTYSKVKILFAGDLNSAPDSP 264

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 107/270 (39%), Gaps = 54/270 (20%)

Query: 80  IERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLI---RRDFFPESGPALKW 136
           + R  +P+++   K   P     T  S     MTYN L+   +      + PE     +W
Sbjct: 6   LTRKLIPVSNAALKASLPEIKNGTSRS-TFTFMTYNMLSPYYMWPQVYTYVPEKYK--EW 62

Query: 137 HKRSKVLVHE-LKKYRPDVVSLQEV---DYNELNFWQENFH-KLGFDVIF---------K 182
             R ++L  E L  YR D++ +QE+   DY+   FW+ +F  K+ +   F         +
Sbjct: 63  SYRHRLLEREILNLYRADIMCVQELTCKDYD--GFWKGHFKSKMNYGSSFISKTPPKYWQ 120

Query: 183 RHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALI----------- 231
           R   +  G+ + +N  KF+  +   +  ++++    IS     K+  +            
Sbjct: 121 RPPDEMDGVGIFYNLDKFEHISTTSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPVDK 180

Query: 232 ------------ISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI- 278
                       +SL+   +   +    +V NTHL+W    V  +L Q   +++K+  + 
Sbjct: 181 DSLLNVLHGRNQVSLFVSLMHKETRTLFVVINTHLYWKYDEV--KLCQCLTIMRKLHRVI 238

Query: 279 ------KACSKYNGWHSLLMGDFNTEPEEP 302
                 +    Y+    L  GD N+ P+ P
Sbjct: 239 KSLLMGREGVTYSKVKILFAGDLNSAPDSP 268

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 94/210 (44%), Gaps = 50/210 (23%)

Query: 111 IMTYNTLAQTLIRRDFFPESGPALK-WHKRSKVLVHEL-KKYRPDVVSLQEV---DYNEL 165
           +++YN L+ + +    +       K W+ R K+L  EL  KYR D++ LQE+   DY+  
Sbjct: 24  LLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS-- 81

Query: 166 NFWQENFH---KLGFDVI-------FKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNIL- 214
           NFW++        G + I       +KR   +  G+ + +N  KF+  +   +  + +L 
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLG 141

Query: 215 --------------------AGNVISART-----RTKN-IALIISLYFKGITDSSSRGII 248
                               AGN +  ++     ++KN +AL +SL  K     +    +
Sbjct: 142 VFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHK----ETGNVFV 197

Query: 249 VANTHLFWHPFGVFERLRQSYLVLQKIQEI 278
           V NTHL+W    V  +L Q  ++++++  I
Sbjct: 198 VINTHLYWKYDDV--KLTQCMIIMRELARI 225

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 67/164 (40%), Gaps = 16/164 (9%)

Query: 111 IMTYNTLAQTLIRRDFFPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFW 168
           +++YNTL Q       +  +   AL W  R + L  ++  Y+ D++ LQEV+      FW
Sbjct: 528 LLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEEFW 587

Query: 169 QENFHKLGFDVIF----------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218
                K  +  IF           +   K  G  + +   KF+L     +D+      + 
Sbjct: 588 SPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMKHK 647

Query: 219 ISARTRTK-NIAL---IISLYFKGITDSSSRGIIVANTHLFWHP 258
              RT    N A+    ++LY K  + +S   + V  THL W P
Sbjct: 648 KFQRTEDYLNRAMNKDNVALYLKLQSLTSGESVWVVTTHLHWDP 691

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 66/170 (38%), Gaps = 28/170 (16%)

Query: 111 IMTYNTLAQTLIRRDFFPESGP-ALKWHKRSKVLVHELKKYRPDVVSLQEVD---YNELN 166
           +++YNTL         +  +   AL W  R + L  +L  +  DV+ LQEV+   Y E  
Sbjct: 456 LLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEE-- 513

Query: 167 FWQENFHKLGFDVIF----------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAG 216
           +W     K  +  +F           +   K  G  + +   +FQL     +D+ +    
Sbjct: 514 YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRS 573

Query: 217 NVISARTR--------TKNIALIISLYFKGITDSSSRGIIVANTHLFWHP 258
           +    RT           N+ALI  L       +++  + V  THL W P
Sbjct: 574 HKKFHRTEDYLNRAMNKDNVALIAELKHL----NTNENVWVVTTHLHWDP 619

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 110/266 (41%), Gaps = 61/266 (22%)

Query: 82  RPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALK-WHKRS 140
           R FLPI    +      + ++  D      MTYN L+   +    +       K W+ R 
Sbjct: 4   RRFLPIKSITNSLPKSGSKRLIDDKF--TFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRH 61

Query: 141 KVLVHE-LKKYRPDVVSLQEV---DYNELNFWQE----NFHKLGFDVIFK-------RHE 185
           K+L  E L  YR D++ LQE+   DY++  +W+E    +FH  G   I K       +  
Sbjct: 62  KLLEKEILNSYRADIMCLQELTASDYHQ--YWEEVIDRDFH-YGSRFIAKPPPQYWQKDA 118

Query: 186 GKTHGLLVAWNNKKFQLDNDWMLDYDNIL---------------------AGNVISART- 223
               G+ + +N  KF   +   +  ++++                     AGN    +T 
Sbjct: 119 KDVDGVGIFYNLNKFDYISSTSIHLNDLIGSFDLDELSYLKSKQVKLTDGAGNPKGEKTL 178

Query: 224 ----RTKN-IALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI 278
               +++N + L ++L  K     ++   +V NTHL+W    V  +L Q  ++++K+ +I
Sbjct: 179 LEILKSRNQVGLFVALKHK----DTNTIFVVINTHLYWKYDEV--KLTQCLIIMRKLAKI 232

Query: 279 -------KACSKYNGWHSLLMGDFNT 297
                  +  + YN    +  GD N+
Sbjct: 233 IRDLLVGEHGTTYNKMKVVFAGDLNS 258

>YMR027W Chr13 (325877..327289) [1413 bp, 470 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and
           cytoplasm; YMR027W is not an essential gene
          Length = 470

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 108 DVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELNF 167
           DV +  ++ L   L  R+FFP   P+ K  +   +   E++K+    VS  ++++ E +F
Sbjct: 292 DVMLKDFDILVHDLRDREFFPSGEPSTKESRALDLFAGEMEKF----VSSGKIEFREDSF 347

Query: 168 WQENFHKLGFDVIFKRHEGKTHGLLV 193
           W         D     +E K HG ++
Sbjct: 348 WTTELDYWNLDA----NETKYHGSIL 369

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 100/249 (40%), Gaps = 62/249 (24%)

Query: 82  RPFLPINH--------DNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLI---RRDFFPES 130
           R F+P+ H            G+ P    + +      ++TYN L+   +      + PE 
Sbjct: 4   RRFIPVKHTVNLLKKPSPGNGVPPLPGALPKHDNRFTLLTYNILSPAYMWPQVYTYVPEQ 63

Query: 131 GPALKWHKRSKVLVHEL-KKYRPDVVSLQEV---DYNELNFWQ---ENFHKLGFDVI--- 180
               +W  R  +L  EL  KY+ D++ +QE+   DY +  FW         +G + I   
Sbjct: 64  --CKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDYQQ--FWSPIASGKCDMGSEFISKT 119

Query: 181 ----FKRHEGKTHGLLVAWNNKKF------------QLD--NDWMLDY------------ 210
               +KR   +  G+ + +N K F             LD  ND  L+Y            
Sbjct: 120 APKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQMLDAFNDHELEYLGQKKLGLTDGA 179

Query: 211 -DNILAGNVISARTRTKNIALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSY 269
            +     N+++       ++L +SL  K    S+    +V NTHL+W    V  +L Q  
Sbjct: 180 GNPTGETNLLNFLKLKNQVSLFVSLQHK----STGMYFVVINTHLYWKYDEV--KLTQCM 233

Query: 270 LVLQKIQEI 278
           ++++++ +I
Sbjct: 234 VIMRELSQI 242

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 42/208 (20%), Positives = 90/208 (43%), Gaps = 46/208 (22%)

Query: 111 IMTYNTLAQTLIRRDFFPESGPALK-WHKRSKVLVHEL-KKYRPDVVSLQEVDYNE-LNF 167
           ++TYN L+   +    +       K W  R K+L  EL +KY+ D++ LQE+ + + +++
Sbjct: 50  MLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDYISY 109

Query: 168 WQENFH-KLGFDVIF---------KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNIL--- 214
           W+   + K+ +   F         ++ + +  G  + +N +KF+  +   L  ++++   
Sbjct: 110 WKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVVGTF 169

Query: 215 ------------------------AGNVISARTRTKNIALIISLYFKGITDSSSRGIIVA 250
                                     N+ +  T    + L +SL  K    +++   +V 
Sbjct: 170 EEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHK----ATNTVFVVI 225

Query: 251 NTHLFWHPFGVFERLRQSYLVLQKIQEI 278
           NTHL+W    V  +L Q  ++++K+  I
Sbjct: 226 NTHLYWKYDEV--KLTQCMIIMRKLSHI 251

>Smik_13.196 Chr13 (320120..321538) [1419 bp, 472 aa] {ON} YMR027W
           (REAL)
          Length = 472

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 11/139 (7%)

Query: 108 DVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELNF 167
           DV +  ++ L + L  R+FFP    + K  K   +  +EL K+    VS  ++++ E +F
Sbjct: 292 DVMLKDFDLLIKDLRDREFFPSGEASTKESKALDLFANELDKF----VSSGKIEFREDSF 347

Query: 168 WQENFHKLGFDVIFKRHEGKT-HGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTK 226
           W         D    ++ G T H  L A N   F+ D    L+Y   L G+    RT TK
Sbjct: 348 WTTELDYWNLDAKEVKYHGSTLHEDLQASNLVIFKGD----LNYRK-LTGDRKWPRT-TK 401

Query: 227 NIALIISLYFKGITDSSSR 245
               I  L   GIT  S R
Sbjct: 402 WETAIGPLSTNGITSLSLR 420

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
           (REAL)
          Length = 1037

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 142 VLVHELKKYRPDVVS-LQEVDYNELNFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKF 200
           +L+  LK+YRPD+VS +Q+V   E+ FW +          F R    +  LL+  +N  F
Sbjct: 885 ILLFALKQYRPDIVSEVQKVREKEIKFWAQ------LCPYFSRRRLASQSLLLHADNVFF 938

Query: 201 QLDNDWM 207
            ++   +
Sbjct: 939 LIETGML 945

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 9/79 (11%)

Query: 111 IMTYNTLAQTLIRRDFFPESGPALK-WHKRSKVLVHE-LKKYRPDVVSLQEV---DYNEL 165
           ++TYN L+Q+ +    +       K W  R K+L +E LK Y  D++ LQE+   DY   
Sbjct: 24  LLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYEY- 82

Query: 166 NFWQENFHKL--GFDVIFK 182
            +W++   K   G D I K
Sbjct: 83  -YWRKKLSKFNKGSDFICK 100

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
           (REAL)
          Length = 1036

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 142 VLVHELKKYRPDVVS-LQEVDYNELNFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKF 200
           +L+  LK+YRPD++S +Q+V   E+ FW +          F R    +  LL+  +N  F
Sbjct: 884 ILLFALKQYRPDIISEIQKVREKEIKFWAQ------LCPYFTRRRLASQSLLLHADNVFF 937

Query: 201 QLDNDWM 207
            ++   +
Sbjct: 938 LVETGML 944

>SAKL0G19206g Chr7 (1655715..1656485) [771 bp, 256 aa] {ON} similar
           to uniprot|Q00873 Saccharomyces cerevisiae YKL087C CYT2
           Cytochrome c1 heme lyase involved in maturation of
           cytochrome c1 which is a subunit of the mitochondrial
           ubiquinol-cytochrome-c reductase links heme covalently
           to apocytochrome c1
          Length = 256

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 25/128 (19%)

Query: 67  GKDPDFPTPDLQFIERPFLPINHDNSK--------GLTPATIQVTQDSLDVKIMTYNTLA 118
           G  P+ P P  Q  E+   P++HD  K           P  I+ + D L V+   YNT  
Sbjct: 37  GLPPNHP-PTQQNGEQQVCPVDHDTRKVWLQKTSGDAVPEAIECSSDQLPVEPQ-YNTNV 94

Query: 119 QTLIRRDF--FPESGPALKWHKRSKVLVHEL---KKYRP------DVV----SLQEVDYN 163
           +  + R+    P +G    W   S+   +E    KK+ P       VV    S+ E  ++
Sbjct: 95  KLPVEREISSIPRTGSGSHWVYPSQKQFYEAMLRKKWDPAADDMKTVVPIHNSVNERVWS 154

Query: 164 ELNFWQEN 171
            +NFW++N
Sbjct: 155 YINFWEKN 162

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
           protein of unknown function; deletion mutant has
           decreased rapamycin resistance but normal wormannin
           resistance; green fluorescent protein (GFP)-fusion
           protein localizes to the vacuole
          Length = 1036

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 142 VLVHELKKYRPDVVS-LQEVDYNELNFWQE 170
           +L+  LK+YRPD++S +Q+V   E+ FW +
Sbjct: 884 ILLFALKQYRPDIISEVQKVREKEIKFWAQ 913

>TPHA0A05950 Chr1 complement(1346003..1347802) [1800 bp, 599 aa]
           {ON} Anc_3.546 YFR039C
          Length = 599

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 11/67 (16%)

Query: 230 LIISLYFKGITDSSSRGIIVANTHL------FWHPFG--VFERLRQSYLV---LQKIQEI 278
           L+  LYFK   DS  R   +A  H+         PFG  V   +R +  V   L K++E+
Sbjct: 89  LVKDLYFKHAHDSVVRYSTIAKAHIDDVHNKVLKPFGRNVARHVRSNQSVQDLLTKVKEL 148

Query: 279 KACSKYN 285
             CSK+N
Sbjct: 149 DLCSKFN 155

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
           (REAL)
          Length = 1036

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 142 VLVHELKKYRPDVVS-LQEVDYNELNFWQE 170
           +L+  LK+YRPD++S +Q V   E+ FW +
Sbjct: 884 ILLFALKQYRPDIISEIQTVREKEIKFWAQ 913

>CAGL0G07733g Chr7 complement(734157..735797) [1641 bp, 546 aa] {ON}
           highly similar to uniprot|P36113 Saccharomyces
           cerevisiae YKR017c
          Length = 546

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 59  RRNSLISQGK----DPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTY 114
           +  SL+SQ      D D+   DL++ E   +PI H+N K L   ++     +L  + +T 
Sbjct: 43  KSKSLVSQSSEFDIDEDYSGDDLEYDELLSVPITHENKKSLNNGSVP----NLQYECLTT 98

Query: 115 NTLAQTLIRR 124
             + Q ++ R
Sbjct: 99  QDIFQKMLNR 108

>Suva_10.352 Chr10 (614328..617975) [3648 bp, 1215 aa] {ON} YLR256W
           (REAL)
          Length = 1215

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 10/83 (12%)

Query: 20  SGLVSPSEDGPAHQKIHRDQ--LSVDQIKKIREERAQKRQVRRNSLISQGKDP---DFPT 74
           SG+V+P E+ PA +K   D        +    E  AQKR    +++ S G  P   + P+
Sbjct: 41  SGMVAPKEESPAPRKCPVDHTMFPSGMVPPREETPAQKRCPIDHTMFSAGMAPPKEETPS 100

Query: 75  PDLQFIERPFLPINHDNSKGLTP 97
           P   +  RP   I+H+N   + P
Sbjct: 101 P---YSTRPI--IDHNNKHSMNP 118

>Kpol_295.4 s295 (6161..8569) [2409 bp, 802 aa] {ON} (6161..8569)
           [2409 nt, 803 aa]
          Length = 802

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 11/53 (20%)

Query: 263 ERLRQSYLVLQKIQEI-KACSK----------YNGWHSLLMGDFNTEPEEPPY 304
           E L +  +VL++IQ+I K C K          YN W  +  GD N  P   P+
Sbjct: 483 EELERKMIVLKEIQDILKVCPKEEKQKTSVSLYNKWIEIFEGDINDNPLSSPF 535

>Smik_2.197 Chr2 complement(348812..350032) [1221 bp, 406 aa] {ON}
           YBR063C (REAL)
          Length = 406

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 71  DFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPES 130
           DF   +  F+   F  ++  +++  T A +Q TQ   D+K +T +TL  +  R DF  E+
Sbjct: 184 DFSQTEKVFVPDDFGRLSLSSNENTTEALVQATQTLSDIKALTNSTLTNS-ARGDFLKET 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,595,803
Number of extensions: 2567419
Number of successful extensions: 7050
Number of sequences better than 10.0: 81
Number of HSP's gapped: 7025
Number of HSP's successfully gapped: 81
Length of query: 505
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 391
Effective length of database: 40,409,475
Effective search space: 15800104725
Effective search space used: 15800104725
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)