Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML117W (NAB6)8.844ON1134113453790.0
Smik_13.178.844ON1131113445790.0
Skud_13.248.844ON1128113443180.0
Suva_13.268.844ON1122113642230.0
TDEL0B005408.844ON1115101918890.0
NCAS0B002808.844ON108191216590.0
CAGL0B02365g8.844ON105097915990.0
KNAG0G034408.844ON1053100815710.0
ZYRO0G14256g8.844ON125979215710.0
KLTH0C03784g8.844ON997112315010.0
TPHA0I002708.844ON103996514960.0
NDAI0E002708.844ON119852711461e-136
Kwal_27.102398.844ON91461111211e-136
KAFR0A028508.844ON104241611201e-134
Kpol_1068.58.844ON103232710251e-121
KLLA0D01485g8.844ON115172810081e-117
TBLA0B032808.844ON136230410181e-117
ABL122C8.844ON10436539741e-113
SAKL0D01364g8.844ON10823859761e-113
Ecym_46158.844ON10674468584e-97
TBLA0B052106.183ON7102144537e-46
AFL061C6.183ON5232174375e-45
Kpol_1002.696.183ON5902134398e-45
NCAS0H010406.183ON6292134382e-44
KNAG0M004306.183ON4432134272e-44
SAKL0A05280g6.183ON5822144353e-44
Ecym_22336.183ON5762134309e-44
TDEL0G016206.183ON5842144282e-43
NDAI0F022606.183ON6802144295e-43
KAFR0B066906.183ON5332144218e-43
CAGL0C01419g6.183ON6392144259e-43
TPHA0J022106.183ON5933074231e-42
KLLA0E19031g6.183ON6522134232e-42
KLTH0H04906g6.183ON5692144104e-41
ZYRO0G08140g6.183ON6322134125e-41
Kwal_27.111586.183ON5672134095e-41
Suva_16.1236.183ON5962144105e-41
YPL184C (MRN1)6.183ON6122144107e-41
Smik_6.3906.183ON6252134071e-40
Skud_16.946.183ON6142134026e-40
SAKL0E07128g2.306ON40192910.036
ZYRO0A02398g2.306ON410215870.11
TDEL0G023602.306ON402211860.14
TBLA0B071702.306ON470207860.18
TPHA0C035202.306ON44275850.19
Ecym_33442.306ON42175830.33
Kpol_1043.342.306ON44275820.55
Suva_14.3302.306ON45775810.61
Skud_14.3122.306ON45975810.66
YNL016W (PUB1)2.306ON45375810.68
TDEL0B010108.797ON210213790.69
NDAI0F01720singletonON474111810.72
Smik_14.3132.306ON45175810.74
KLTH0D11088g8.670ON42259800.82
Kwal_26.87638.670ON42682791.2
KAFR0D016608.797ON21267761.4
ACR135C8.670ON376161771.8
KAFR0G023206.104ON62079781.8
TPHA0G010808.797ON22084761.9
Ecym_24038.670ON375168772.0
Suva_8.2928.670ON370226762.6
Skud_4.478.466ON34377753.2
Suva_4.398.466ON34871753.3
ZYRO0F07238g8.670ON389176753.3
YOR242C (SSP2)8.670ON37156753.4
KLLA0C05522g6.104ON54084745.3
SAKL0F15070g7.482ON58685735.5
Skud_15.4098.670ON37182735.8
NCAS0A061904.344ON89490736.8
Smik_15.4268.670ON371219727.7
NDAI0C056508.566ON42952728.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML117W
         (1134 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...  2076   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...  1768   0.0  
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...  1667   0.0  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...  1631   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   732   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     643   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   620   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   609   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   609   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   582   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   580   0.0  
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     446   e-136
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   436   e-136
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   436   e-134
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   399   e-121
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   392   e-117
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   396   e-117
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   379   e-113
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   380   e-113
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   335   4e-97
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   179   7e-46
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   172   5e-45
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   173   8e-45
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   173   2e-44
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   169   2e-44
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   172   3e-44
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   170   9e-44
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   169   2e-43
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    169   5e-43
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   166   8e-43
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   168   9e-43
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   167   1e-42
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   167   2e-42
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   162   4e-41
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   163   5e-41
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   162   5e-41
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   162   5e-41
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   162   7e-41
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   161   1e-40
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   159   6e-40
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...    40   0.036
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...    38   0.11 
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...    38   0.14 
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...    38   0.18 
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...    37   0.19 
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...    37   0.33 
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...    36   0.55 
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...    36   0.61 
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...    36   0.66 
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...    36   0.68 
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    35   0.69 
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    36   0.72 
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...    36   0.74 
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    35   0.82 
Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {O...    35   1.2  
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    34   1.4  
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    34   1.8  
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    35   1.8  
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    34   1.9  
Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar t...    34   2.0  
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    34   2.6  
Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON} Y...    33   3.2  
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    33   3.3  
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    33   3.3  
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    33   3.4  
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    33   5.3  
SAKL0F15070g Chr6 (1213643..1215403) [1761 bp, 586 aa] {ON} simi...    33   5.5  
Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {...    33   5.8  
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    33   6.8  
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    32   7.7  
NDAI0C05650 Chr3 (1305925..1307214) [1290 bp, 429 aa] {ON} Anc_8...    32   8.2  

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score = 2076 bits (5379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1023/1134 (90%), Positives = 1023/1134 (90%)

Query: 1    MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL 60
            MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL
Sbjct: 1    MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL 60

Query: 61   PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVXXXXXX 120
            PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPV      
Sbjct: 61   PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSNHNGY 120

Query: 121  XXXXXXXXXXXXXXMVTPSNYYRMGXXXXXXXXXXXXXXXXXXXKGCDTRNNSGRRTFAR 180
                          MVTPSNYYRMG                   KGCDTRNNSGRRTFAR
Sbjct: 121  NGNSNSNQNNTNNGMVTPSNYYRMGRNSFSRNNNSTRNVTHNNNKGCDTRNNSGRRTFAR 180

Query: 181  NNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTL 240
            NNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTL
Sbjct: 181  NNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTL 240

Query: 241  ESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLK 300
            ESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLK
Sbjct: 241  ESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLK 300

Query: 301  FVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSP 360
            FVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSP
Sbjct: 301  FVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSP 360

Query: 361  VEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDY 420
            VEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDY
Sbjct: 361  VEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDY 420

Query: 421  LKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAXXXXXXXXXX 480
            LKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTA          
Sbjct: 421  LKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAGNNNDSNNNG 480

Query: 481  XXXXXXXXXITTLNNNSSIGVSVYGHXXXXXXXXXXXXXXNEEIDMLATKLQGVELDGTY 540
                     ITTLNNNSSIGVSVYGH              NEEIDMLATKLQGVELDGTY
Sbjct: 481  NNNKSNMSGITTLNNNSSIGVSVYGHSNMSLTSLSSSVSLNEEIDMLATKLQGVELDGTY 540

Query: 541  LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGA 600
            LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGA
Sbjct: 541  LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGA 600

Query: 601  IIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNI 660
            IIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNI
Sbjct: 601  IIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNI 660

Query: 661  NPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 720
            NPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR
Sbjct: 661  NPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 720

Query: 721  VGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 780
            VGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL
Sbjct: 721  VGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 780

Query: 781  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEE 840
            REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEE
Sbjct: 781  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEE 840

Query: 841  KFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDE 900
            KFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDE
Sbjct: 841  KFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDE 900

Query: 901  KEKAFDKPLNLESLGISLDAHKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSFGGLG 960
            KEKAFDKPLNLESLGISLDAHKD                             TGSFGGLG
Sbjct: 901  KEKAFDKPLNLESLGISLDAHKDNGGGETGTANNTGHENESELEAENENGNETGSFGGLG 960

Query: 961  LAVASSDVKRATSDETDYEDIFNKXXXXXXXXXXVEVIMHSPSDPEYALKSQTLRSSSQT 1020
            LAVASSDVKRATSDETDYEDIFNK          VEVIMHSPSDPEYALKSQTLRSSSQT
Sbjct: 961  LAVASSDVKRATSDETDYEDIFNKSSGSSDSSSDVEVIMHSPSDPEYALKSQTLRSSSQT 1020

Query: 1021 VINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET 1080
            VINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET
Sbjct: 1021 VINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET 1080

Query: 1081 ANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
            ANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE
Sbjct: 1081 ANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
            (REAL)
          Length = 1131

 Score = 1768 bits (4579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 880/1134 (77%), Positives = 941/1134 (82%), Gaps = 3/1134 (0%)

Query: 1    MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL 60
            MSN N +KPVANYAYRQQQDYNGMNAMVGNP++YHPVDF+NGAGQYGPSQHPAYY+NSPL
Sbjct: 1    MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL 60

Query: 61   PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVXXXXXX 120
            PNIPPTPFDTAYGASL PSHLLMGSPFVSSPNMQ GY+ ARSSN KRKAYSRPV      
Sbjct: 61   PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSNHNNY 120

Query: 121  XXXXXXXXXXXXXXMVTPSNYYRMGXXXXXXXXXXXXXXXXXXXKGCDTRNNSGRRTFAR 180
                          MVTPSNYYR+                    KGCD RN+SGRRT  R
Sbjct: 121  NGNNNSNQNNNNNGMVTPSNYYRI-ERNSFSRNNNSTRNSTHNNKGCDNRNSSGRRTSTR 179

Query: 181  NNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTL 240
            NNIFDDI  E+LLQRPF INYK+LPTGDDAYRTRSLLIENVD S DLHSIVKNFVKSNTL
Sbjct: 180  NNIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTL 239

Query: 241  ESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLK 300
            ES Y+I   KSDD KD +T NLSILISFLT+ DCLNFYNNILQRLSEFKTFLKSE+LNLK
Sbjct: 240  ESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLK 299

Query: 301  FVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSP 360
            FVCLNYD KCL TFIE +ALTEN E+ DITN S+MISASLHH++ NKDATRSII+EFKSP
Sbjct: 300  FVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSP 359

Query: 361  VEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDY 420
            ++ ++LF KKLQFLDRS NKRYILESID+VNTDVPSNQFPENYAVLTFLNI MAIEVLDY
Sbjct: 360  LKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDY 419

Query: 421  LKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAXXXXXXXXXX 480
            LKKYSK LGISKCFYVSLAPLV+SS RSSVANIYE KTSTHRLSVPSV            
Sbjct: 420  LKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNNDNNNSN 479

Query: 481  XXXXXXXXXITTLNNNSSIGVSVYGHXXXXXXXXXXXXXXNEEIDMLATKLQGVELDGTY 540
                       T N+N+S   S+YG+              NEEID+L TKLQG++LDGT 
Sbjct: 480  NHKSNISDA-NTHNSNNSTRASLYGNSNVSLASLPSSVSLNEEIDILTTKLQGIQLDGTD 538

Query: 541  LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGA 600
            LEINY DYQTPT+ EHSTHLSNVKISKT ENSRQF  DIPSPLPLNE MFMNDSN SNG+
Sbjct: 539  LEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGS 598

Query: 601  IIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNI 660
            I+PQQL+ATPSPVS  +QMNQRVLPNPITQSLEQNFNVSAKVASSMGSD+GNRTIYIGNI
Sbjct: 599  IVPQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNI 658

Query: 661  NPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 720
            NPRS+AEDICNVVRGGILQSIKY+PEK+ICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR
Sbjct: 659  NPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 718

Query: 721  VGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 780
            VGWGHYSGPLPK ISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL
Sbjct: 719  VGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 778

Query: 781  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEE 840
            REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKEST  NE GE+T K ATE+
Sbjct: 779  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEK 838

Query: 841  KFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDE 900
            KFGGRY+GLLINYGKDRCGNINKNL+AGKNSRFYKKVKRPSYNIRLSKLEE+RRQNE D+
Sbjct: 839  KFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDK 898

Query: 901  KEKAFDKPLNLESLGISLDAHKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSFGGLG 960
            KE+AFDK LNLESLGISLD+HKD                             T   GGLG
Sbjct: 899  KERAFDKALNLESLGISLDSHKD-IGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLG 957

Query: 961  LAVASSDVKRATSDETDYEDIFNKXXXXXXXXXXVEVIMHSPSDPEYALKSQTLRSSSQT 1020
            L VASS+V RA SDETDYED+FNK          +EVIMHSPSDPEYALKSQTLRSSSQT
Sbjct: 958  LGVASSEVNRAASDETDYEDLFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQT 1017

Query: 1021 VINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET 1080
            VINSKRPVK EDEE+AV +SQ N++SSLR APPRAPSTLSYN SK NETP++DI  NGET
Sbjct: 1018 VINSKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGET 1077

Query: 1081 ANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
             +NRKK RGSF RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTH +E
Sbjct: 1078 TSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score = 1667 bits (4318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 851/1134 (75%), Positives = 923/1134 (81%), Gaps = 6/1134 (0%)

Query: 1    MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL 60
            M NSN +KP ANYAYRQQ DYNGMNAMVGN MMYHPVDF+NG GQYG SQHPAYYTNSPL
Sbjct: 1    MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL 60

Query: 61   PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVXXXXXX 120
            PN+PPTPFDTAYGASL PSHLLMGSPFVSSPNMQ GY+ ARSSNLKRKAYSRPV      
Sbjct: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVSNQNGY 120

Query: 121  XXXXXXXXXXXXXXMVTPSNYYRMGXXXXXXXXXXXXXXXXXXXKGCDTRNNSGRRTFAR 180
                          M+TPSNYYR G                   KGCDTRN+SGRR  +R
Sbjct: 121  NGNSSNHNHSGNG-MMTPSNYYRNGRNSSSRNNNSTRNVSHNNNKGCDTRNSSGRRASSR 179

Query: 181  NNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTL 240
            +NIFD+I PE+LLQRPF INYK+LPTGDDAYRTRSLLIENVD S DLHS+VKNFVK NTL
Sbjct: 180  SNIFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTL 239

Query: 241  ESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLK 300
            ESAY ++  K+DD +D ET+NLS+LISFLT+ DCLNFYNNILQRLSEFK FLKS++LNLK
Sbjct: 240  ESAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLK 299

Query: 301  FVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSP 360
            FVCLNY+ +CL TF+E E   E  E+    N S MISASLHH++ NKDATRSIIIEFKS 
Sbjct: 300  FVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSA 359

Query: 361  VEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDY 420
            +EK++LF+K+LQFLD SKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNI MA+EVLDY
Sbjct: 360  LEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDY 419

Query: 421  LKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAXXXXXXXXXX 480
            LKK+SK+L ISKCFYVSL PL+VSS RSSVANIYE KT+T RLSVPSV A          
Sbjct: 420  LKKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAGIKNDNNNNS 479

Query: 481  XXXXXXXXXITTLNNNSSIGVSVYGHXXXXXXXXXXXXXXNEEIDMLATKLQGVELDGTY 540
                     I   NNNSSIG S+YG+              NEEID+L TKLQG+ELDGT 
Sbjct: 480  NKGNISS--INAQNNNSSIGSSIYGNSNISLTSLSSSVSLNEEIDLLTTKLQGIELDGTS 537

Query: 541  LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGA 600
            LEI   DY TPTI EHSTHLSN+KISKT ENSR F QDIPSPLPLNE MFMNDSNQSNGA
Sbjct: 538  LEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGA 597

Query: 601  IIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNI 660
            +IPQQLIA PSP+S NLQ+NQRVLPN ITQSLEQNFNVSAKVASSMGSD+GNRTIYIGNI
Sbjct: 598  VIPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNI 657

Query: 661  NPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 720
            NPRS+AEDICNVVRGGILQSIKYIPEK+I FVTFIEAPSAVQFYANSFIDPIVLHGNMLR
Sbjct: 658  NPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 717

Query: 721  VGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 780
            VGWGHYSGPLPK ISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK+LHETL+LPDAEQL
Sbjct: 718  VGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQL 777

Query: 781  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEE 840
            REDFSTYGDIEQINYLSDSHCCWINFMNISSAI LVEEMNKES   ++ GEV +K A EE
Sbjct: 778  REDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEE 837

Query: 841  KFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDE 900
            KF GRYKGLLINYGKDRCGNINKNL+AGKNSRFYKKVKRPSYNIRLSKLEE+RRQNE D+
Sbjct: 838  KFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDK 897

Query: 901  KEKAFDKPLNLESLGISLDAHKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSFGGLG 960
            KE +FDK LNLESLGISLD HKD                             T   GGLG
Sbjct: 898  KE-SFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTGLGGLG 956

Query: 961  LAVASSDVKRATSDETDYEDIFNKXXXXXXXXXXVEVIMHSPSDPEYALKSQTLRSSSQT 1020
            L VA+ DVKRATSDETDYE++FNK          +EVIMHSPSDPEYALKSQTLRSSSQT
Sbjct: 957  LGVANCDVKRATSDETDYEELFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQT 1016

Query: 1021 VINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET 1080
            VINSKRPVK+EDE++ VG+SQLN+RSSLRQAPPRAPSTLSY+H K +ET  QD   N ET
Sbjct: 1017 VINSKRPVKVEDEDD-VGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQD-SRNAET 1074

Query: 1081 ANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
            ANNR++KRGS  RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN + +E
Sbjct: 1075 ANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score = 1631 bits (4223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 833/1136 (73%), Positives = 917/1136 (80%), Gaps = 16/1136 (1%)

Query: 1    MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL 60
            MSNSNS+KP AN+AYR+Q D+NGMNAMVGNPM+YHPVDF+NGAGQYGPSQHPAYYTNSPL
Sbjct: 1    MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL 60

Query: 61   PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVXXXXXX 120
            PN+PPTPFDTAYGASL PSHLLMGSPFVSSPNMQ GYN  RSS   RKAYSRP+      
Sbjct: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSY 120

Query: 121  XXXXXXXXXXXXXX--MVTPSNYYRMGXXXXXXXXXXXXXXXXXXXKGCDTRNNSGRRTF 178
                            M+TPS+YYR G                   KG +TRN+SGRRT 
Sbjct: 121  NANHNNNNNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYETRNSSGRRTS 180

Query: 179  ARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSN 238
            +R NIFD+I PE LLQ+PF INYK+LP GDDAYRTRSLLIENVD S DLHS+VKNFVKSN
Sbjct: 181  SRINIFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN 240

Query: 239  TLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALN 298
             LESAY++   ++D+ +  ETKNLSILISFLT+GDCLNFYNNILQRLSEFKTFLKS++LN
Sbjct: 241  ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN 300

Query: 299  LKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFK 358
            LKFVCLNYD K LPT +E E L+ + E+A   + STMISASLHH++ NKDATRSIIIEFK
Sbjct: 301  LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK 360

Query: 359  SPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVL 418
            SP+EK++LFK+KLQFLDRSKNKRYILESID+V+TDVPSNQFPENY VLTFLNI MAIEVL
Sbjct: 361  SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL 420

Query: 419  DYLKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAXXXXXXXX 478
            DYLKKYSK LGISKCFYVSL PL+VSSARSSVA+IYE K+S+HRLS PSV A        
Sbjct: 421  DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAGNNNDINN 480

Query: 479  XXXXXXXXXXXITTLNNNSSIGVSVYGHXXXXXXXXXXXXXXNEEIDMLATKLQGVELDG 538
                           NNN SIG S+YG+              NEEI++L TKLQG++LDG
Sbjct: 481  I-----------NNNNNNGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTTKLQGIDLDG 529

Query: 539  TYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSN 598
            T LE+   DY TP I EHS HLSN+KISKT +NSRQF+QDIPSPLPLNEHMFM DSNQSN
Sbjct: 530  TILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSN 589

Query: 599  GAIIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIG 658
            G I+ QQLI  PSP SPN QMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIG
Sbjct: 590  GTIVSQQLITAPSPQSPNPQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIG 649

Query: 659  NINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNM 718
            NINPRS+AEDICNVVRGGILQ+IKYI EK+ICFVTFIEA SAVQFYANSFIDPIVLHGNM
Sbjct: 650  NINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNM 709

Query: 719  LRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAE 778
            LRVGWGHYSGPLPK ISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK+LHETL+LPDAE
Sbjct: 710  LRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAE 769

Query: 779  QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRAT 838
            QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMN+E T  ++SGE+  K AT
Sbjct: 770  QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTAT 829

Query: 839  EEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEI 898
            EEKF GRYKGLLINYGKDRCGNINKNL+AGKNSRFYKKVKRPSYNIRLSKLEE+RRQNE 
Sbjct: 830  EEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEN 889

Query: 899  DEKEKAFDKPLNLESLGISLDAHKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSFGG 958
            D+KE +FDK LNLESLGISLD HK                              T   GG
Sbjct: 890  DKKE-SFDKVLNLESLGISLDPHKG--TDIDEAEAEGTTGAEVENEVEAENGNETVGLGG 946

Query: 959  LGLAVASSDVKRATSDETDYEDIFNKXXXXXXXXXXVEVIMHSPSDPEYALKSQTLRSSS 1018
            LGL V +SDVKRA SDETDY++ FNK          +EVIMHSPSDPEYALKSQTLRSSS
Sbjct: 947  LGLGVVNSDVKRALSDETDYDEFFNKSSRSSDSSSDIEVIMHSPSDPEYALKSQTLRSSS 1006

Query: 1019 QTVINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNG 1078
            QTV+NSKRP K+E+E+  VG+SQ N+RSSL+QAPPRAPSTLS+NHSK N+ P+QD   N 
Sbjct: 1007 QTVLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINA 1066

Query: 1079 ETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
            E  +N+ KKRGSF RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN + DE
Sbjct: 1067 EVTDNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1019 (42%), Positives = 592/1019 (58%), Gaps = 146/1019 (14%)

Query: 193  LQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKSD 252
             + PF + Y+VLP G+D +RTRSLL ENVD SIDLHS V NF     +ES YL +     
Sbjct: 162  FKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKS---- 217

Query: 253  DSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLP 312
                 E  ++SIL+SF +K  CL+FYN++LQRLSE+K+ L S+AL L FV L Y    + 
Sbjct: 218  -----EGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYK---VS 269

Query: 313  TFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSPVEKSDLFKKKLQ 372
               E +   E+  + D  N     + SL +++ N+ ATRSI+I FK+P  K +L  KKL+
Sbjct: 270  DTSEEDIDKEDDSKPDAFN--ITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLE 327

Query: 373  FLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKKYSKNLGISK 432
            FL +  N RY+LESIDLV  D PS  FP+NYAVLTFLNI MA+E+LDY++ +S+ L ISK
Sbjct: 328  FLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISK 387

Query: 433  CFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAXXXXXXXXXXXXXXXXXXXITT 492
            CF++S+ P +    R SV++   G+      S+ S++                    +T+
Sbjct: 388  CFFISIQPQIPDGKRLSVSSASNGR------SMESISGNYRSKNAS-----------VTS 430

Query: 493  LNNNSSIGVSVYGHXXXXXXXXXXXXXXNEEIDMLATKLQGVELDGTYLEINYRDYQTPT 552
            L ++ SI +S+                 ++EID +  KLQ V      LE+   +Y+ P+
Sbjct: 431  LESSGSI-ISL-----------------DQEIDEMTYKLQSVNSKKNILEVTTNNYKDPS 472

Query: 553  IEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDS----NQSNGAIIPQQLIA 608
             E H+ HL+NV +S+      Q +   P  + +NE++  N      N  N A   Q + A
Sbjct: 473  FEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDA 532

Query: 609  TPS---PVS-------------PNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGN 652
             P    P+S             PN++ N   +  PITQSL++ +  SA+VASSMG  IGN
Sbjct: 533  VPPSMVPMSTMPNTPYGCYMPPPNVRQNGN-MTKPITQSLQRQYATSAEVASSMGGGIGN 591

Query: 653  RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
            RT+YIGNI+PRS+ EDICNVVRGGILQ++K++ EK+ICFVTF+EA +AVQFY N+FIDPI
Sbjct: 592  RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651

Query: 713  VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 772
            VLHGNML+VGWGH+SGPLPK I+LAVT+GASRNVYVSLPEFAFK+K+I+DPQY++ ++  
Sbjct: 652  VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711

Query: 773  SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEV 832
             LPD EQLR+DFS YGDIEQINYL+D HCCW+NF NIS+AI LVEE      V+ E G  
Sbjct: 712  RLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEE------VKYEGGGN 765

Query: 833  TLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEK 892
              K       GGRY GL+I YGKDRCGN+NKN IAGKNSRFYKKVK+PS+NIRLSK+EE+
Sbjct: 766  FYKM-----LGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEE 820

Query: 893  RRQNEID---EKEKAFDKPLNLESLGISLDAHKDXXXXXXXXXXXXXXXXXXXXXXXXXX 949
            RRQ+E     ++E   +K L   SLGI++D++                            
Sbjct: 821  RRQHEETLRRQQENNSEKFLQFGSLGITIDSNGKEDPEKVDDVDFEDEVKFDSNSPKKTV 880

Query: 950  XXXTG----------------SFGGLGLAVASSDVKRATSDE----TDYEDIFNKXXXXX 989
               +G                S G  GL +  S  +     E    T      ++     
Sbjct: 881  EQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREKEATKLTRNHSENDETSAKS 940

Query: 990  XXXXXVEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKIEDEEEAVGMSQLNYRSSLR 1049
                 VE+I++SP + E   KS++ R   +   N +R  K+ +  E    S+  ++S+  
Sbjct: 941  DASSDVELIINSPEEEESNFKSKSNRGFRK---NDRR--KLANCAEGAS-SKERFKSTTN 994

Query: 1050 QA------------PPRAPSTLSYNHS-----KNNETPMQDIFTNGETANNRKKKRGSF- 1091
                          PP AP+T+S N+S     + N   ++D    GE+ ++  ++  +F 
Sbjct: 995  DVSSALSSSSLEANPPMAPATISRNYSLMFKQQYNHEKLRDF--EGESFDDESQQESNFD 1052

Query: 1092 ---------------ARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE-DNTHPDE 1134
                              ++IPGSDVMAQYLAQ+QHSTF+YAANILGAS + DN + DE
Sbjct: 1053 FESTQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%)

Query: 51 HPAYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNM 93
           P YY   P+ N PPTPFDTAYG +L PSHLLMGSPFVSSPN+
Sbjct: 44 QPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNL 86

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/912 (41%), Positives = 513/912 (56%), Gaps = 126/912 (13%)

Query: 45  QYGPSQHPAYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSN 104
           QY P+Q P YY  SPLPN+PPTPFDTAYGA+L PSHLLMG     SP + +       S 
Sbjct: 61  QYFPTQQP-YYQTSPLPNVPPTPFDTAYGATLLPSHLLMG-----SPFVATPTTGHSQSA 114

Query: 105 LKRKAYSRPVXXXXXXXXXXXXXXXXXXXXMVTPSNYYRMGXXXXXXXXXXXXXXXXXXX 164
           + ++ Y                        M+TP+                         
Sbjct: 115 IFQQPY------------------------MMTPN------RASFSQIPSMLNVGNPPSA 144

Query: 165 KGCDTRNNSGRRTFARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHS 224
           +    +N+  RR  +  +   +  P+ L  +PF ++YK+LP+GDDAYRTRSLL ENV +S
Sbjct: 145 RRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNS 204

Query: 225 IDLHSIVKNFVKSNTLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQR 284
           I+LH+ +  FV+ + +ES YLI    SD   D +T+  SIL+SFLT+  CL FYNN+LQR
Sbjct: 205 IELHTFMTEFVRFSPIESVYLINHHDSDKPDD-DTECRSILLSFLTREVCLTFYNNVLQR 263

Query: 285 LSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEAD--ITNGSTMISASLHH 342
           L EFK  LKSE L L FV + Y               EN EE    +   S     S++ 
Sbjct: 264 LKEFKAKLKSENLRLSFVSIKYQ-------------DENEEEETNIVDEPSFYTKESVYF 310

Query: 343 NIANKDATRSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPEN 402
            ++N  ATRSI+I+FK+P  + +LF KKL+FL++  N RYILESIDLVN     N+FP++
Sbjct: 311 ELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKH 370

Query: 403 YAVLTFLNISMAIEVLDYLKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHR 462
           YA+LTF+NI MA+E+ DYLK +    GI  C +V + P  VS   S  A+I       + 
Sbjct: 371 YAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASIISKDNDNND 430

Query: 463 LSVPSVTAXXXXXXXXXXXXXXXXXXXITTLNNNSSIGVSVYGHXXXXXXXXXXXXXXNE 522
            ++ S                         L N+S I +                    E
Sbjct: 431 ETLSSQQKKN------------------DILKNSSIISLP---------SAENDQVSDEE 463

Query: 523 EIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIP-- 580
           ++D L+ KL+   ++   L ++   Y  P+   H  HL N  +S ++ +S  F Q +P  
Sbjct: 464 KLDKLSEKLKSTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSS-SSNPFEQQLPYS 522

Query: 581 -------------SPLPLNEHMFMNDSNQSNGAIIPQQLIATPSPV---------SPNLQ 618
                          LP N   F N  N   G I P   +   +P+          P   
Sbjct: 523 YEEDDDQRTNVRSGSLPANPQ-FPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFS 581

Query: 619 MNQRVLPN-----PITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVV 673
           MN     N     PI+++LEQ+   +++V +S+G+D GNRTIYIGNIN RSK EDICNVV
Sbjct: 582 MNNNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVV 641

Query: 674 RGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKL 733
           RGGILQ++KYI  K ICF+TFIEA +A+ FYANSFIDPIVLH + L++GWG+Y  PLPK 
Sbjct: 642 RGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKA 701

Query: 734 ISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQI 793
           ++LAVT+GASRNVYVSLPEFAFK+KFI+DP+Y++ H+   LP A+QLR DFS YG IEQI
Sbjct: 702 VALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQI 761

Query: 794 NYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINY 853
           NYL DSHCCW+NF+NIS+AI LVE+ +             ++    EKF  RY GL+INY
Sbjct: 762 NYLKDSHCCWVNFLNISAAIRLVEDAHN-----------PVESKFSEKFNNRYDGLIINY 810

Query: 854 GKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKR-----RQNEIDEKEKAFDKP 908
           GKDRCGN+NK+L++ KNSRFYKKVK  S N++L +LEEKR     R N + +   +  + 
Sbjct: 811 GKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQL 870

Query: 909 LNLESLGISLDA 920
             L++ GI +D 
Sbjct: 871 SKLDAFGIGIDT 882

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/56 (67%), Positives = 42/56 (75%)

Query: 1079 ETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
            E   N KK   +    R IPGSDVMAQYLAQ+QHSTFMYAANILGASAED ++ DE
Sbjct: 1023 EHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/979 (40%), Positives = 541/979 (55%), Gaps = 136/979 (13%)

Query: 193  LQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSI-VKNFVKSNTLESAYLIEGGKS 251
            L  P  INY+VLP+GDD Y+TRSLL ENV  + ++ S+ ++  +  + +ES Y+ +   +
Sbjct: 166  LISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDT 225

Query: 252  DDSKDVETK--NLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPK 309
              SKD E+      + +SFL++   L+FYNN LQRL +FK  L S  L++ FV  +Y   
Sbjct: 226  P-SKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTD 284

Query: 310  CLPTFIESEALTENAEEADITNGSTMISA-SLHHNIANKDATRSIIIEFKSPVEKSDLFK 368
                  + +    N E+ +I     ++   +L   I + DATRSI IEF S VE+  LF+
Sbjct: 285  EDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFE 344

Query: 369  KKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKKYSKNL 428
            K L FLD   NKRYILE++D+++ +  ++ FP NY +LTF+NI MAIEVLDYLK      
Sbjct: 345  K-LPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTY 403

Query: 429  GISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAXXXXXXXXXXXXXXXXXX 488
             +++CF+VSL P   S   SS   +    ++    SV  V                    
Sbjct: 404  SVNECFFVSL-PGCKSQRESSTTPVLGHISTEGSKSVSEVNLA----------------- 445

Query: 489  XITTLNNNSSIGVSVYGHXXXXXXXXXXXXXXNEEIDMLATKLQGVELDGTYLEINYRDY 548
                 N  +++ +                   + E++ L+ +L  ++L+   L+I   DY
Sbjct: 446  -----NGGNTVMI-------------------DRELESLSDELASLKLEEKCLKIIRSDY 481

Query: 549  QTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGAIIPQQLIA 608
              P I  H  H     I  +T  S     D  +P   N  M+++D+   + +II      
Sbjct: 482  PKPEIRSHDDH-----IPGSTNFSMYIFDDGMNP-EGNSGMYLHDNLTDHSSIIGSPFSN 535

Query: 609  TPSPVSPNLQMNQRVLP------------------------NPITQSLEQNFNVSAKVAS 644
               P   ++ +    LP                          ITQS+E   N SA++A+
Sbjct: 536  YIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAA 595

Query: 645  SMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFY 704
            +MG D  NRT+YIGNINPRSK EDICNVVRGGILQ++K+I +K+ICFVTFIEA +A QF 
Sbjct: 596  AMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFC 655

Query: 705  ANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQ 764
            ANSFIDPIVLHGN LRVGWG+ SGPLPK I+LAVT+GA+RNVYVSLPE+AFK+KFI+DP+
Sbjct: 656  ANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPK 715

Query: 765  YKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKEST 824
            YK+ HE   LP  EQLR+DF+TYG+IEQINYL DSHCCW+NF+NI+SAI LVE++N    
Sbjct: 716  YKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDIN---- 771

Query: 825  VQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNI 884
              + +GE        +KF  RY+GL+INYGKDRCGNINKNLIAGK S+FYKKVK+PSY+I
Sbjct: 772  --HNNGE-----EFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDI 824

Query: 885  RLSKLEEKRRQNE---IDEKEKAFDKPLNLESLGISLDAHKDXXXXXXXXXXXXXXXXXX 941
            R+ K+EEKR+  E   + +K+ +    + L+SLGIS+D                      
Sbjct: 825  RIKKMEEKRKMQEDNLLSQKKNS----IQLDSLGISVD------------------RTFS 862

Query: 942  XXXXXXXXXXXTGSFGGLGLAVASSDVKRATSDETDYEDIFNKXXXXXXXXXXVEVIMHS 1001
                       T   GG+   + S+D K      +D+  I +              I   
Sbjct: 863  NESKLSGGHTTTEENGGVKQDLESNDYK------SDHPQISSNGPIGIGLSSKKSPIFDD 916

Query: 1002 PSDPEYALKSQTLRSSSQTVINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSY 1061
             S  + ++ S    S+S+   +S R  +  +      + + N    L  APPRAPST++ 
Sbjct: 917  ISGSDESVISDFENSASKETSSSDRKYQTTNSRGDTFVPKTN----LSHAPPRAPSTINM 972

Query: 1062 NHSK-------NNETPMQDIFTN-GETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHS 1113
             + K       N + P  D       T NN   ++ +    R IPGSDVMAQYLAQ+QHS
Sbjct: 973  TYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPT----RPIPGSDVMAQYLAQLQHS 1028

Query: 1114 TFMYAANILGASAEDNTHP 1132
            TFMYAANILGAS E    P
Sbjct: 1029 TFMYAANILGASVETEEDP 1047

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/37 (75%), Positives = 32/37 (86%)

Query: 57 NSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNM 93
          NSP  N+PPTPFDTAYGASL PSHLLMGSP +S+ N+
Sbjct: 43 NSPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNL 79

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1008 (39%), Positives = 542/1008 (53%), Gaps = 175/1008 (17%)

Query: 192  LLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKS 251
            L Q PF I+YK+LP GDD YRTRSLL+ N+D  +DLH+ V  FV++N++ES Y+ + G+ 
Sbjct: 155  LFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQ- 213

Query: 252  DDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCL 311
                  + +    L+SFL+   CLNFYNN+LQRL EFK  LK+ +L L FV +    +  
Sbjct: 214  ------QPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSM----RQR 263

Query: 312  PTFIESEALTENAEEADITNGSTMISASLHHNIANK-DATRSIIIEFKSP---VEKSDLF 367
            PT +E +     A +    +G  M  A+LH ++A +  ATRSI IEF      + + +L 
Sbjct: 264  PTKVEGKIYRRFAAD----DGDGM--ANLHFDMAAQTGATRSIAIEFVDKDVILTRDELL 317

Query: 368  KKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKKYSKN 427
             KKL+FL    N RYILE I +  T   +  F +NYA++TFL+I MA+E++DYLK   K 
Sbjct: 318  NKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQ 376

Query: 428  LGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAXXXXXXXXXXXXXXXXX 487
            L ++K FYV +      S  +S    +   T ++R + P  +                  
Sbjct: 377  LHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKKDQEF------------ 424

Query: 488  XXITTLNNNSSIGVSVYGHXXXXXXXXXXXXXXNEEIDMLATKLQGVELDGTYLEINYRD 547
                   NNS + +                    +++D L  KL+ +EL  + L++   D
Sbjct: 425  -----FPNNSMLSLVSSESSTSLA----------DDVDGLVNKLKSIELQESTLKLRVED 469

Query: 548  YQTPTIEEHSTHLSNVKISKTTENSR----------------QFSQDIPSP----LPLNE 587
            Y  P  E+ S H + +  S     +R                 F  DI SP    LPL  
Sbjct: 470  YPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPL-- 527

Query: 588  HMFMNDSNQSNGA--IIPQQLIATPS-PVSP-------NLQMNQR-----VLPNPITQSL 632
                 D N SN    + P  + ATPS P+SP       N Q  QR        +PIT SL
Sbjct: 528  -----DLNHSNSVPNLPPGFIPATPSGPMSPQQQQLFLNSQRQQRDHAGGKFAHPITDSL 582

Query: 633  EQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFV 692
            E     S +VA++MGSD  NRTIYIGNINPRS+AEDICNVVRGGILQ+IK+I  K ICF+
Sbjct: 583  ESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFI 642

Query: 693  TFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPE 752
            TFIEA +AVQFYAN+FIDPIVLHGN L++GWG Y+GPLPK I+LAVTIGASRNVY+SLPE
Sbjct: 643  TFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPE 702

Query: 753  FAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSA 812
             AFK+K+I DP++K  HE+  LP  E LR+DF  YG IEQIN L+DSHCCW+NFMNISSA
Sbjct: 703  IAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSA 762

Query: 813  ISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSR 872
            I LVE+    ST Q+   ++         F  RY+GL+INYGKDRCGNIN+NL+AGK S+
Sbjct: 763  IRLVEDA---STKQDHFNQL---------FDHRYEGLVINYGKDRCGNINRNLVAGKTSK 810

Query: 873  FYKKVKRPSYNIRLSKLEEKRRQNEIDEKEKA---------FDK------------PLNL 911
            ++KKVK+ + ++RLS+LEEKRR  + + +E           FD              L+L
Sbjct: 811  YHKKVKKHTRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSL 870

Query: 912  ESLGISLDAHKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSFGGLGLAVASSDVKRA 971
            +SLGIS+                                   GS+   G+A  +      
Sbjct: 871  DSLGISI--------------MEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSG 916

Query: 972  TSDETDYEDIFNKXXXXXXXXXXVEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKIE 1031
            +S +                   +E+I++ P+DP  ++    L     T+          
Sbjct: 917  SSSD-------------------IELIINPPNDPNRSVG--VLEGDPSTL------SPPS 949

Query: 1032 DEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSK----NNETPMQDIFTNGETANNRKKK 1087
            D+ + V + +++        PP AP T+S  +++    N      D    G       + 
Sbjct: 950  DKRKLVALHEVS-----SPPPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAENGRH 1004

Query: 1088 RGSFARH-RTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
            R    R+ RTIPGSDVMAQYLAQ+QHSTFMYAAN+LGAS E     D+
Sbjct: 1005 RQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTEQYDD 1052

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 1/46 (2%)

Query: 57  NSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNM-QSGYNSAR 101
           NSP+ N  PTPFDTAYGA+L PSHLLMGSPFVS+PN+ Q+ Y + R
Sbjct: 83  NSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQR 128

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/792 (43%), Positives = 479/792 (60%), Gaps = 97/792 (12%)

Query: 169 TRNNSGRRTFARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLH 228
            RN   RR  A+N   D +  E     PF + Y++LP GDD YRTRSLL ENV+ S+DL+
Sbjct: 194 ARNRHRRR--AQNEQADKMFKE-----PFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLY 246

Query: 229 SIVKNFVKSNTLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEF 288
           S V  + +   +ES Y+ +       ++ +TK+ S+L+SFL++  CL+ YN++LQRL+EF
Sbjct: 247 SFVSKYSRYGPVESIYMFK------DRNDKTKH-SVLLSFLSRKICLDSYNSVLQRLAEF 299

Query: 289 KTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENA--EEADITNGS------------- 333
           KT LKS++L + FV L Y        ++    + +    E D T+ S             
Sbjct: 300 KTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDA 359

Query: 334 --TMISASLHHNIANKDATRSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVN 391
               + ASL ++I N+ ATRS+ +E     +K+ L  ++L FL  + N+RY+LESI L+N
Sbjct: 360 YNVTVVASLQYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLIN 419

Query: 392 TDVPSNQFPENYAVLTFLNISMAIEVLDYLKK-YSKNLGISKCFYVSLAPLVVSSARSSV 450
              P   FP+NYA+LTFLNISMA+EVLDY++   +      KCF+VS++    +S+   +
Sbjct: 420 AKEPFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGI 479

Query: 451 ANIYEGKTSTHRLSVPSVTAXXXXXXXXXXXXXXXXXXXITTLNNNSSIGVSVYGHXXXX 510
                  T+++ ++  +                      +++LN   S+G  +       
Sbjct: 480 V------TTSNSITPVASGGSAGIATNGDLGGYTSKNASLSSLN---SVGSYI------- 523

Query: 511 XXXXXXXXXXNEEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTE 570
                     ++EID L++ L+G       + +   +Y  P   E S HLSN  + + + 
Sbjct: 524 --------SLDQEIDFLSSSLKGSHT----ITVAVDEYPKPFFAEFSDHLSNASVLEASA 571

Query: 571 NSRQFSQDIPSPLPLNEHMFMNDSNQSNGA--IIPQQLIATPS------PVSPNLQMNQ- 621
              Q S    SP P    +   DS    GA  +      ATP+      P+ P++ MN  
Sbjct: 572 LDTQIS----SPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSG 627

Query: 622 ----------RVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICN 671
                     + +  PITQSL++ F  SA+VA+SMG  IGNRT+YIGNI+PRSK EDICN
Sbjct: 628 IYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICN 687

Query: 672 VVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLP 731
           VVRGGILQSI+++ +K ICFVTFIEA +AVQFY N+FIDPIVLHGNML+VGWGH+SGPLP
Sbjct: 688 VVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLP 747

Query: 732 KLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIE 791
           K +SLAVT+GASRNVYVSLP+FAFK+K+I+DPQY++  +   LP  EQLR DF+ +GDIE
Sbjct: 748 KSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIE 807

Query: 792 QINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLI 851
           QIN+LSD HCCW+NFMNISSAI LVEE      ++   GE     A  + F  RY+GL+I
Sbjct: 808 QINFLSDGHCCWVNFMNISSAIKLVEE------IKYNDGE-----AFHKSFDNRYRGLII 856

Query: 852 NYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNE---IDEKEKAFDKP 908
            YGKDRCGN+NKNLI+GKNSRFYKKVK+PSYNIRLS++EE+R+++E     + +   +K 
Sbjct: 857 GYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKM 916

Query: 909 LNLESLGISLDA 920
           L   SLGI L+ 
Sbjct: 917 LQFGSLGIHLEG 928

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (76%), Gaps = 4/52 (7%)

Query: 1076 TNGETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1127
            + G+    R K+R +    + IPGSDVMAQYLAQ+QHSTFMYAANILGA+AE
Sbjct: 1200 SRGQQGKGRNKRRNA----KAIPGSDVMAQYLAQLQHSTFMYAANILGATAE 1247

 Score = 59.3 bits (142), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 47/69 (68%), Gaps = 5/69 (7%)

Query: 27  MVGNPMMYHPVDFVNGAGQYGPSQHPAYYT--NSPLPNIPPTPFDTAYGASLFPSHLLMG 84
           M  +PM + PV  +    QY P Q PAYY     PL N PPTPFDTAYG +L PSHLL+G
Sbjct: 47  MANSPMAFPPVGSLQA--QYAPPQ-PAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLLIG 103

Query: 85  SPFVSSPNM 93
           SPFVSSP++
Sbjct: 104 SPFVSSPDL 112

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1123 (37%), Positives = 578/1123 (51%), Gaps = 201/1123 (17%)

Query: 47   GPSQHPAYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSG----YNSARS 102
            G  ++  YY  + +P  P TPFDT+YG SL PSHLLM SPF+++P M S        +RS
Sbjct: 32   GSREYSGYYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHRAGGSRS 91

Query: 103  SNLKRKAYSRPVXXXXXXXXXXXXXXXXXXXXMVTPSNYYRMGXXXXXXXXXXXXXXXXX 162
            S+  + +Y  P                     M  P+                       
Sbjct: 92   SH-AQSSYHTP-------------NFGSTQLRMPPPTEKRNF------------------ 119

Query: 163  XXKGCDTRNNSGRRTFARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVD 222
               G   R+NS  +  A   +F  ILP            +    G D Y TRSLL  N++
Sbjct: 120  -KHGSSYRHNSSVQQRAYEVVF-HILP------------RSADGGGDEYMTRSLLFSNLN 165

Query: 223  HSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNIL 282
                LH  +  F K + +ES YL           V+++  S+L+SFLTK  CL+FYN +L
Sbjct: 166  PDTHLHDFLTKFEKFDRVESVYL-----------VDSQQQSVLVSFLTKETCLDFYNGVL 214

Query: 283  QRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHH 342
            Q+LSEFK  LKS+ L L F  L  D K  PT  E                       +  
Sbjct: 215  QKLSEFKKELKSKELTLNFASLR-DVKTGPTLQE-----------------------IKI 250

Query: 343  NIANKDATRSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPEN 402
             +    ATRS+I+EF+  V+ + L  K L F+  ++  RY++E+I++VN    S  F  +
Sbjct: 251  EVLRAGATRSLILEFQDKVDLA-LLSKSLGFI-VNEGPRYVVEAIEIVNAGRSSKHFGPH 308

Query: 403  YAVLTFLNISMAIEVLDYLKKYSKNL-GISKCFYVSLAPLVVSSARSSVANIYEGKTSTH 461
            YA++ F++I+MA+E ++YLK  S  L G+ K  YV+      +SA         GK+   
Sbjct: 309  YAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVN-----TTSA--------SGKSEFQ 355

Query: 462  RLSVPSVTAXXXXXXXXXXXXXXXXXXXITTLNNNSSIGVSVYGHXXXXXXXXXXXXXXN 521
             LS   +                        L+N S   +S                   
Sbjct: 356  TLSSSQLNER--------------------ALSNTSDSDIS-----------------GG 378

Query: 522  EEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPS 581
            E +  L +KLQ   L    L ++   Y  P +EE S HL +V ISK   NS+    D+ S
Sbjct: 379  ESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAL-NSKSSLNDLTS 437

Query: 582  --PLPLNEHMFMND--SNQSNGAIIPQQLIATPSPVSPNLQ-----MNQRVLPNPITQSL 632
                P  + + +ND   + S G+++  +   +  P  P +      MN   +  P+ Q+L
Sbjct: 438  NTTSPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMN---MSKPLGQTL 494

Query: 633  EQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFV 692
            +Q +  +A+VA++MG  +GNRT+YIGNI+PRSK EDICNVVRGGILQS+KYI  K ICFV
Sbjct: 495  QQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFV 554

Query: 693  TFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPE 752
            TFIEA SAVQF+ANS I+PIVLHGN+L+VGWGH+SG LP+ ISLAVTIGASRNVYVSLPE
Sbjct: 555  TFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPE 614

Query: 753  FAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSA 812
             AFK+KFI DP+Y++  E   LP  EQL EDFS +GDIE +N+L D HCCWINFMNIS+A
Sbjct: 615  HAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNA 674

Query: 813  ISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSR 872
            I LVE+ N  +   N+S          EKFG RYKGL I YGKDRCGN+NKNL+A KNS+
Sbjct: 675  IKLVEDANNPN---NDS--------FHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSK 723

Query: 873  FYKKVKRPSYNIRLSKLEEKRRQ--NEIDEKEKAFDKPLNLESLGISLDAHKDXXXXXXX 930
            ++KKVK+ SYNIRL K ++       E+ ++ K  DKP+  ++ GIS+   ++       
Sbjct: 724  YFKKVKKASYNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQN-----LV 778

Query: 931  XXXXXXXXXXXXXXXXXXXXXXTGSFGGLGLAVASSDVKRATSDETD--YEDIFNKXXXX 988
                                  TG  GGLG+++ASS     T +ET+    D  +K    
Sbjct: 779  RDSDEEQKLEEDELLRLSDLNNTG--GGLGISLASS-----TGEETNTPVSDESSKEESV 831

Query: 989  XXXXXXVEVIMHSPSDPEYA-LKSQTL-RSSSQTVINSKRPVKIEDEEEAVGMSQLNYR- 1045
                  V++++ +P   + + L+S+T  RS  Q  + +  P      E+    S +  R 
Sbjct: 832  SSESSDVDILVSAPGSADTSQLESKTAPRSPKQPRVLANVP------EKPSAFSAIIPRV 885

Query: 1046 --SSLRQAPPRAPSTLS--YNHSKNNETPMQDIFTNGETANNR-------KKKRGSFARH 1094
              +SL   PP APSTLS  Y  +  + +     F   E ++ R         K+    R 
Sbjct: 886  SSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRR 945

Query: 1095 R---TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
            R    IPGSDVMAQYLAQ+QHSTFMYAANILG    +    DE
Sbjct: 946  RKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/965 (38%), Positives = 529/965 (54%), Gaps = 170/965 (17%)

Query: 197  FCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSKD 256
            + I+Y++LP GDD Y TRSLL EN++ SIDLH+ ++ FV    +ES Y++   ++     
Sbjct: 210  YKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETH---- 265

Query: 257  VETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIE 316
             +    SIL+SF ++  CL+FYN++LQ+LSE+KT L SE L L FV L Y    +     
Sbjct: 266  -QNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNG 324

Query: 317  SEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSPVEKSDLF-KKKLQFLD 375
              ++     E D       +++ + + +AN  ATRS+ IEF   V+K D F +  L FL 
Sbjct: 325  KISVESQKNETDFE-----LTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLS 379

Query: 376  RSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKKYSKNLG--ISKC 433
             + NKRYI+ES+ +VN +   N+FP +Y +L+FLNISM IEVL Y++  SKNL   I  C
Sbjct: 380  SNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIR--SKNLSKTIKNC 437

Query: 434  FYVSL---APLVVSSARSSVANIYEGKT-STHRLSVPSVTAXXXXXXXXXXXXXXXXXXX 489
             YVS       V +S R S++      T +T+ L  P                       
Sbjct: 438  LYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESP----------------------- 474

Query: 490  ITTLNNNSSIGV----SVYGHXXXXXXXXXXXXXXNEEIDMLATKLQGVELDGTYLEINY 545
               +N+N+ + +    S+Y                  EI+ +A KL  +E+      ++ 
Sbjct: 475  ---INHNTEVDMNDIPSIYDE---------------NEIE-IANKLSELEIQTHTFNLDI 515

Query: 546  RDYQTPTIEEHSTHLSNVKISKT---------TENSRQFSQDIPSPLP-LNEHM----FM 591
             +Y  P IE  + HL NV IS+                + +++ +  P L+ H+    + 
Sbjct: 516  SNYSNPHIEIRAEHLPNVSISRDPMIYANPIYQSPPSGYMENMWTTTPFLSSHIVHEEYA 575

Query: 592  NDSNQSNGAIIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIG 651
            ND    N      QL   P P                 Q+L+  F  SA++AS MG  +G
Sbjct: 576  NDRVDYNMKHYNNQLYNVPLP-----------------QTLQSQFATSAEMASKMGGGVG 618

Query: 652  NRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDP 711
            NRTI+IGNINPRSK EDICNV RGGI+Q +KYI EK ICFV FI+  +A QFYANSFIDP
Sbjct: 619  NRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDP 678

Query: 712  IVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHET 771
            I+LH N L++GWG + GPLPK I LAVT GASRNVYVSLPEFAFK+K+I+DP YK+ H  
Sbjct: 679  IILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNK 738

Query: 772  LSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGE 831
              LP  +QLREDFS +G++EQIN+L D HCCWINF NI SAI LVE       V+NE   
Sbjct: 739  YILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVE------LVKNEDN- 791

Query: 832  VTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEE 891
                    E++  RYKGL+I YGKDRCGN+NK+L++ KNSR+++KVK+PSYNIRL +LEE
Sbjct: 792  ----NNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNIRLQQLEE 847

Query: 892  KRRQNEIDEKEKAFDKPLNLESLGISLDAHKDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 951
            +R++N  DE ++  +K +NL+SLGI+   +++                            
Sbjct: 848  ERKRN--DEIKQIDNKRINLDSLGITTSPNQN------------------------IQED 881

Query: 952  XTGSFGGLGLAVASSDVK-RATSDETDYEDIFNKXXXXXXXXXXVEVIMHSPSDPEYALK 1010
             T S   L L   +SD   + + +E+D +D              VE+I++SP +     K
Sbjct: 882  ETLSLAKLKL---TSDTGFKNSENESDIDD------SASNSSTDVELIINSPGN---GFK 929

Query: 1011 SQTLRSSSQTVIN-SKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNET 1069
            S   R      ++  +RP     + +A+           +   P AP+ LS+++ + + T
Sbjct: 930  SHRNRKPKPNNLDLGERP-----KVDAI---------VFKADGPMAPNKLSHDYHRTHNT 975

Query: 1070 PMQDIFTNGETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1129
             + +        + R +KR      + IPGSDVM+QYLAQVQHSTFMYAAN+L AS E+ 
Sbjct: 976  RVDN------PRSERTRKR---THKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEP 1026

Query: 1130 THPDE 1134
               DE
Sbjct: 1027 EFYDE 1031

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (68%), Gaps = 2/45 (4%)

Query: 68  FDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSR 112
           FD AYG +L PSH+LM SPFVS+PN    Y S ++S  +  +Y+R
Sbjct: 112 FDYAYGTTLLPSHILMNSPFVSTPN--KSYLSFQASPSRGISYNR 154

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  446 bits (1146), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 248/527 (47%), Positives = 323/527 (61%), Gaps = 53/527 (10%)

Query: 627  PITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPE 686
            PI ++LE  FN SA+VASSMG ++GNRTIYIGN+NPRSKAED+CNVVRGGILQSIK I  
Sbjct: 702  PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761

Query: 687  KKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNV 746
            K+ICFVTFIEA +AVQFYANSFIDP++LHGN L++GWG+Y  PL K I+LAVTIGASRNV
Sbjct: 762  KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821

Query: 747  YVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 806
            YVSLPEFAFK+KF++DP+YK+ HE   LP  +QLR DF+ YG IEQINYLSDSHCCW+NF
Sbjct: 822  YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881

Query: 807  MNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLI 866
            MNI+SAI LVE++N      N   + T  +    KF  RY GL+INYGKDRCGN+N+NLI
Sbjct: 882  MNITSAIKLVEDVN------NNPKDNTFSK----KFNHRYDGLIINYGKDRCGNVNRNLI 931

Query: 867  AGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDEKEKAFDKPLN------LESLGISLDA 920
            + KNSR Y+KVK+ S N +L +L+EKRR  +  EK K  +  +N      L++LGI L  
Sbjct: 932  SNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQ--EKGKELNGGVNDNKLPSLDALGIGL-- 987

Query: 921  HKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSFGGLGLAVAS---------SDVKRA 971
                                            T +F  LG  + S         +D K  
Sbjct: 988  ---QRTAPPEEQKVPESNEDDANYDSAVTESDTNTFNALGFRIQSNTDSHDDEQNDEKGE 1044

Query: 972  TSDETDYEDIFNKXXXXXXXXXXVEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKIE 1031
              +E D   I +           VE+I+  P +            S  ++I  K+    +
Sbjct: 1045 EQEEVDV--IAHADDISSVNSSDVEIIIDCPHN-----------ESDTSMIQEKKKTIRK 1091

Query: 1032 DEEEAVGMSQLNYRSSL----RQAPPRAPSTLSYNHSKNNETPMQDIFTNGETANNRKKK 1087
            ++++   +++   R+++    R+  P   + L   H + N+   +     G   +     
Sbjct: 1092 NQQKIDRLAKA--RNAMFPEHRETIPDINNKLF--HDRKNKDKNRRKQVQGGIQDQDPHL 1147

Query: 1088 RGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
              +  + R IPG+DVMAQYL Q+QHSTFMYAANILG SAEDNT+ DE
Sbjct: 1148 SSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDE 1194

 Score =  197 bits (501), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 168/307 (54%), Gaps = 58/307 (18%)

Query: 186 DILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYL 245
           ++ P  L Q+PF I+YK+LPTGDDAYRTRSLL  NV  SIDLHS + +FV+ +++ES YL
Sbjct: 174 EVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYL 233

Query: 246 IEGGKSDDSKDVETKN----LSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKF 301
           I    +DD KD + +N     SIL+SFL++  CL+FYNN+LQRL+EFKT L+S++L L F
Sbjct: 234 I--SNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNF 291

Query: 302 VCLNYDPKC------------LPTFIESEALTENAEEADITNGSTMISASLHHNIANKDA 349
           V LNY  K             L    E+E    N  E D  N    ++A L  ++ N DA
Sbjct: 292 VILNYLEKTDDGSTANISNNQLNQIQENENDV-NTNEFDYRNSMNTVNA-LKFDLINPDA 349

Query: 350 TRSIIIEFKSPVEKSDLFKKKLQFL-DRSKNKRYILESIDLVNTDVPSNQ---------- 398
           TR I+IE K+  +K  L  K L FL D  KN RYILESIDL N     N           
Sbjct: 350 TRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAK 409

Query: 399 ---------------------------FPENYAVLTFLNISMAIEVLDYLKKYSKNLGIS 431
                                      FP +YAVL+F+NI MA+E+ DYLK      GI+
Sbjct: 410 NENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGIT 469

Query: 432 KCFYVSL 438
              YV +
Sbjct: 470 NASYVQI 476

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (70%), Gaps = 2/72 (2%)

Query: 21  YNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPLPNIPPTPFDTAYGASLFPSH 80
           Y  +N  V NP M +  D  NG+ QY  +   AYY  SPLPN PPTPFDTAYGA+L PSH
Sbjct: 42  YISLNHSVHNPNMVYQHD-PNGS-QYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSH 99

Query: 81  LLMGSPFVSSPN 92
           LLMGSP+VS+PN
Sbjct: 100 LLMGSPYVSTPN 111

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  436 bits (1121), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 262/611 (42%), Positives = 357/611 (58%), Gaps = 70/611 (11%)

Query: 548  YQTPTIEEHSTHLSNVKISK--TTENSRQFSQD-IPSPLPLNEHMFMNDSNQSNGAIIPQ 604
            Y  P +EEH+ H S++ ISK  +++ SR  S   I SP P    +  +++  S  +I+  
Sbjct: 329  YGPPVVEEHNQHCSHITISKALSSKVSRNGSSSSIASPQPQEVLVSNSEAPSSRNSIVSL 388

Query: 605  QLIATPSPVSPNLQMNQRV-LPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPR 663
                +  P  P    +  + +  P+ Q+L+Q +  +A+VA++MG   GNRT+YIGNI+PR
Sbjct: 389  LSARSQGPTYPVPGYHYYMDMSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPR 448

Query: 664  SKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 723
            SK EDICNVVRGGILQS+KYI  K ICFVTFIEA SAVQF+ANS I+PIVLHG++L+VGW
Sbjct: 449  SKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGW 508

Query: 724  GHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRED 783
            GH+SG LP+ ISLAVTIGASRNVYVSLPE+AFK+KFI DP+Y+   E   LP  +QL +D
Sbjct: 509  GHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDD 568

Query: 784  FSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFG 843
            FST+GDIE IN+L D HCCWINFMNIS+AI LVE+ N  +   NES          EKF 
Sbjct: 569  FSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSN---NES--------FHEKFE 617

Query: 844  GRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRL-----SKLEEKRRQNEI 898
             RY+GL I YGKDRCGN+NKNL++ KNS+++KKVK+ SYNIRL     S +E + +  + 
Sbjct: 618  NRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRLRRQQKSDIEAQAKSGKG 677

Query: 899  DEKEKAFDKPLNLESLGISLDAHKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSFGG 958
            DE     +K L +++ GIS+ +  D                                 GG
Sbjct: 678  DENS---EKKLQVDAFGISVGSQPDARYSDEEQKIEENELLLLSKPNSAE--------GG 726

Query: 959  LGLAVASSDVKRATSDETDYEDIFNKXXXXXXXXXXVEVIMHSPSDPEYA-LKSQTLRSS 1017
            LG++V S DV   T + T      NK          V++++ +P     + L+       
Sbjct: 727  LGISV-SQDVT-VTENNTACGGK-NKTGSVSSGSSEVDILVSAPGSANTSQLEGGGPTQR 783

Query: 1018 SQTVINSKRPVKIEDEEEAVGMSQLNY---------RSSLRQAPPRAPSTLSYNHSKNNE 1068
            +    N K+       E + G+S+L+          ++SL   PP AP+ L+ ++   N 
Sbjct: 784  TTAASNGKK-------ERSSGVSKLHCFSEIAPRVSKASLDAVPPLAPAALNCHY---NS 833

Query: 1069 TPMQDIFTNG-------------ETANNRKKKRGSFARHR---TIPGSDVMAQYLAQVQH 1112
             P +    NG             +  +   + + S +R R    IPGS+VMAQYLAQ+QH
Sbjct: 834  APRRSARKNGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQLQH 893

Query: 1113 STFMYAANILG 1123
            STFMYAA+ILG
Sbjct: 894  STFMYAADILG 904

 Score =  144 bits (364), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/266 (35%), Positives = 143/266 (53%), Gaps = 42/266 (15%)

Query: 176 RTFARNNIFDDILPEMLLQRPFCINYKVLP---TGD-DAYRTRSLLIENVDHSIDLHSIV 231
           R   R+N    +  E   Q P+ + + +LP    GD D +RTRSL   N++  + LH  +
Sbjct: 42  RGSRRHNKEKHLYDEGTRQIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFL 101

Query: 232 KNFVKSNTLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTF 291
             F K + +ES Y+           V+ +  S+L+SFLTK  CL+FYN ILQ+LSEFK  
Sbjct: 102 ATFHKFDRIESVYV-----------VDREQQSVLVSFLTKETCLDFYNGILQKLSEFKKE 150

Query: 292 LKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATR 351
           L+S+ L+L F          P  +ES              G T+    +   +    ATR
Sbjct: 151 LRSKELSLSFAS--------PQKVES--------------GPTL--QEIKFEVLRAGATR 186

Query: 352 SIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNI 411
           S+ +EFK  ++ + L KK   F D S   RY++ESI+ VNTD PS  F  NYA++ F++I
Sbjct: 187 SLGLEFKDEIDFASLLKK-FDFFDNS-GPRYVIESIETVNTDKPSKYFGSNYAIVHFISI 244

Query: 412 SMAIEVLDYLK-KYSKNLGISKCFYV 436
           +MA+E ++YLK +  ++ G++K  YV
Sbjct: 245 AMAVETMEYLKVQTPESFGLTKVSYV 270

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  436 bits (1120), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/416 (57%), Positives = 280/416 (67%), Gaps = 46/416 (11%)

Query: 521 NEEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIP 580
           +EE+  +A KL+G++L    L+I  RDY  P     + HL NV IS  T    Q  Q IP
Sbjct: 459 DEEVISIADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPT----QLDQ-IP 513

Query: 581 SPLPLNEHMFMNDSNQS----------------NGAIIPQQLIATPSP---VSPNLQMNQ 621
              P  + +++ND + S                NG  I    +  PS    +  N Q+ +
Sbjct: 514 G-TPRTQEIYINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQE 572

Query: 622 -----RVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGG 676
                    +PIT SLE   + SAKVAS+MGSD GNRTIYIGNINPRSKAEDICNVVRGG
Sbjct: 573 APFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGG 632

Query: 677 ILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISL 736
           ILQSIK+I  K ICFVTFIEA +AVQFYAN+FIDPIVLHGN L++GWG+YSGPLPK I+L
Sbjct: 633 ILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIAL 692

Query: 737 AVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYL 796
           AVTIGASRNVYVSLPEFAFK+K+I+DP++K+ HE   LPD EQLR DFS+YG  EQINYL
Sbjct: 693 AVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYL 752

Query: 797 SDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKD 856
           SDSHCCW+NFMNISSAI LVEE   +    N            EKF  RY GL+INYGKD
Sbjct: 753 SDSHCCWVNFMNISSAIKLVEEATNDFDRFN------------EKFDERYNGLVINYGKD 800

Query: 857 RCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDEKEKAFDKPLNLE 912
           RCGNINKNLIAGKNSRFYK   R ++N +LSKLEEKRR +  D +E  F    N E
Sbjct: 801 RCGNINKNLIAGKNSRFYK--IRQNHNFKLSKLEEKRRDH--DRRENGFKHVYNDE 852

 Score =  215 bits (547), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 170/277 (61%), Gaps = 42/277 (15%)

Query: 190 EMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGG 249
           E L   P  I+Y +LP GDDAYRTRSLL ENVD++I+LHS + NFVK+N++ES YL+   
Sbjct: 174 EKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNK 233

Query: 250 KSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPK 309
              ++ D       I++SFL++  CL+FYNN+LQRL EFK  L SE+LNL FV L Y+  
Sbjct: 234 NDSNTCD-------IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYN-- 284

Query: 310 CLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSP------VEK 363
                   +   +N               SL  NI  +DATRS+ IE  S       +EK
Sbjct: 285 --------KTTRDNQ------------GPSLEFNIVTRDATRSLAIELCSNENDSLILEK 324

Query: 364 SDLFKKKL-QFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLK 422
             LF+K L + L   +NKRY+LESIDLV+TD  + +F +NYA+L+FLNI+MAIE++DY++
Sbjct: 325 EQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQ 384

Query: 423 KYSKNLGISKCFYVSLAPLVV------SSARSSVANI 453
             S  L I KC +V++ PL+       SSA SS  NI
Sbjct: 385 VISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNI 421

 Score = 81.6 bits (200), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 52/84 (61%), Gaps = 10/84 (11%)

Query: 17  QQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGP-----SQH--PAYYTNSPLPNIPPTPFD 69
           Q Q Y+  +    NP+M +P  F    G   P     S H    YY  SPLPN PPTPFD
Sbjct: 23  QDQYYSAFDTT--NPLMSYP-QFEQPYGATFPPPLSSSTHFQQTYYKGSPLPNAPPTPFD 79

Query: 70  TAYGASLFPSHLLMGSPFVSSPNM 93
           TAYGA+L PSHLLMGSPF+SSPN+
Sbjct: 80  TAYGATLLPSHLLMGSPFISSPNV 103

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/33 (90%), Positives = 32/33 (96%)

Query: 1096 TIPGSDVMAQYLAQVQHSTFMYAANILGASAED 1128
            TIPGSDVMAQYLAQ+QHSTFMYAANILGAS E+
Sbjct: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEE 1028

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  399 bits (1025), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 192/327 (58%), Positives = 243/327 (74%), Gaps = 13/327 (3%)

Query: 594 SNQSNGAIIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNR 653
           SNQ N      +LI      + N  +    + + + ++ +  F  SA++A++MG   GNR
Sbjct: 522 SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581

Query: 654 TIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIV 713
           T+YIGNINPRSKAEDICNVVRGG LQ IK+  EK ICFVTFIEA SA QFYANSFIDPI+
Sbjct: 582 TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641

Query: 714 LHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLS 773
           LH N LRVGWG +SGPLPK ISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 642 LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701

Query: 774 LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVT 833
           LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N      + +G  T
Sbjct: 702 LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVN------SSNGGKT 755

Query: 834 LKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKR 893
                 E++  RYKGL+I YGKDRCGN+NK+LI+GKNS+FY+KVK+PSYNIRL +LEE+R
Sbjct: 756 F----HERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEER 811

Query: 894 RQNEIDEKEKAFDKPLNLESLGISLDA 920
           +Q   +EK K  +K +NL S GI ++ 
Sbjct: 812 KQ---EEKNKISNKSINLNSFGIQVET 835

 Score =  236 bits (601), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 161/431 (37%), Positives = 213/431 (49%), Gaps = 54/431 (12%)

Query: 53  AYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSR 112
            YYTN  +PN PPTPFD+AYGASL PSHLLMGSPFVS+P M   Y+         + ++R
Sbjct: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYS---------QQFAR 161

Query: 113 PVXXXXXXXXXXXXXXXXXXXXM-VTPSNYYRMGXXXXXXXXXXXXXXXXXXXKGCDTRN 171
           P                     + + PS+                              +
Sbjct: 162 PSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNH 221

Query: 172 NSGRRT------FARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSI 225
           NS R T      F + NI      E  L R F I+YKVLP G+D Y+TRSLL ENVD S+
Sbjct: 222 NSHRNTNNNGGRFTQKNIIKR-FQENSLNR-FTISYKVLPKGNDEYQTRSLLFENVDKSV 279

Query: 226 DLHSIVKNFVKSNTLESAYLIEGG-------------------KSDDSKDVETKNLSILI 266
           DLH  +K FV    +ES YLI                        +D         SIL+
Sbjct: 280 DLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILL 339

Query: 267 SFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEE 326
           SFL++  CL+FYN++LQRLSEFKT L S  L L FV L Y  +  P          + EE
Sbjct: 340 SFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRP----------DDEE 389

Query: 327 ADITNGSTMISASLHHNIANKDATRSIIIEFKSPV-EKSDLFKKKLQFLDRSKNKRYILE 385
           +D    S  +  SL ++I  + ATRSI +EF  P+  K      KL FL   +NKRYI+E
Sbjct: 390 SDF---SPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIE 446

Query: 386 SIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKKYSKNLGISKCFYVSL---APLV 442
           S+D++N        P+N  +LTFLNISM ++V+D ++   K+ GISKC +V+     P V
Sbjct: 447 SVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKENPTV 506

Query: 443 VSSARSSVANI 453
            +  R S+ +I
Sbjct: 507 PNMKRLSLVDI 517

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (59%), Gaps = 15/104 (14%)

Query: 1045 RSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET--------------ANNRKKKRGS 1090
            ++ L  +PP AP+TLS +  K+++    D+ TN  T              + N   KR S
Sbjct: 922  KTLLESSPPLAPATLSRDFQKSSKQLSSDL-TNLSTMDQNDMSENDSNTSSKNASHKRSS 980

Query: 1091 FARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134
                + +PGSDVM+QYLAQ+QHSTFMYAANILGAS+++    DE
Sbjct: 981  KKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  392 bits (1008), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 258/728 (35%), Positives = 378/728 (51%), Gaps = 148/728 (20%)

Query: 201 YKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEG------------ 248
           Y +LP G+D YR+RSLL  NV+  +D+   ++   K+  +ES YLI+             
Sbjct: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNT 278

Query: 249 ------------------GKSDDSKDVE-----TKNLSI----------LISFLTKGDCL 275
                              K +D KD E     TK ++I          L+SF TK  CL
Sbjct: 279 SNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCL 338

Query: 276 NFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTM 335
           +FYNN+LQR +E K  +KS+ L + FV +  D + +                        
Sbjct: 339 DFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWM------------------------ 374

Query: 336 ISASLHHNIANKDATRSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVP 395
             A+L  N+ +  ATRS+ +EF      SD     L FL  S   +Y++  +D+V TD  
Sbjct: 375 --ANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLKNSG--KYVVIDVDVVTTDER 430

Query: 396 SNQFPENYAVLTFLNISMAIEVLDYLKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYE 455
              F  +Y +L FL+++MA+EV + L+  + +  +S+  +V+ A    +SA   +     
Sbjct: 431 RKNFGLHYCLLHFLSVTMALEVKELLE--TGDEAVSRVSFVTPA----NSADKEMRRRRS 484

Query: 456 GKTSTHRLSVPSVTAXXXXXXXXXXXXXXXXXXXITTLNNNSSIGVSVYGHXXXXXXXXX 515
              S  + + P + +                   ++T +  + I   +Y           
Sbjct: 485 SAISLKQEASPQMFSTDSRSRSRSSNVSLPLSEQVSTAS--TDISTPIY----------- 531

Query: 516 XXXXXNEEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTE----- 570
                 EE D          L  + L ++  +Y+ P + E   HL++  ISK T      
Sbjct: 532 ------EEFDG--------NLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISKPTTLYMHE 577

Query: 571 ------NSRQFSQDIPSPLPLNEHMFMNDSNQSNGAIIPQQLIATPSPVSPNLQMNQRVL 624
                 +S   S DI  PL ++ H             +PQQ++    P      + + ++
Sbjct: 578 SGTTNFSSSNLSDDI-DPLSISSH-----------DPVPQQMLLNEYPY-----IMEPLM 620

Query: 625 PNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYI 684
           P  ITQ+++  +   +K   ++ + + +RT+YIGNINPRSKAEDICNVVRGGILQ IK++
Sbjct: 621 PPQITQTIQNQY---SKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWV 677

Query: 685 PEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASR 744
             K+ICFVTFIE  +AVQFYAN+ ++PI+LHGN+L+VGWG   GPLPK I+LAVT+GASR
Sbjct: 678 SHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASR 737

Query: 745 NVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWI 804
           NVYVSLP+ AFK+KFI+DPQ+K+      +P+  QL+ DF  YG +EQ+N+ SD HCCWI
Sbjct: 738 NVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWI 797

Query: 805 NFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKN 864
           NFMNISSAI LVEE        +++ +    + TE    GRY GL+I YGKDRCGNIN+N
Sbjct: 798 NFMNISSAIKLVEEY-------SDTKDNLFHKKTE----GRYVGLIIGYGKDRCGNINRN 846

Query: 865 LIAGKNSR 872
           L+  KN +
Sbjct: 847 LVFNKNGK 854

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 3/49 (6%)

Query: 1079 ETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1127
            E ANN   ++ S    + I GSDVM +YL Q+ H+TF+YAANILGA+ +
Sbjct: 1097 EGANNGNPRKSSM---KPIAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 14/77 (18%)

Query: 28 VGNPMMYHPVDFVNGAGQYGPSQHPAYYTN--SPLP-----------NIPPTPFDTAYGA 74
          VG     + V   NG   + P Q+  YYT+    +P           +IP TPFD  YG 
Sbjct: 21 VGYEQQVYDVAGRNGGSNHHPPQY-IYYTHRGGSMPGSIPGSIPGTVSIPQTPFDPVYGI 79

Query: 75 SLFPSHLLMGSPFVSSP 91
          +L PSHLL+GSPFV++P
Sbjct: 80 TLLPSHLLVGSPFVNTP 96

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  396 bits (1018), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 183/304 (60%), Positives = 237/304 (77%), Gaps = 20/304 (6%)

Query: 626  NPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIP 685
            N +TQ+LE +FN S ++++ +G   GNRT+YIGNINPRSK ED+CNVVRGGILQ I ++ 
Sbjct: 799  NNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR 858

Query: 686  EKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRN 745
            +K ICFVTFIEA +A QF+AN++IDPIVLHGN+L+VGWG++SGPLPK ISLAVTIGA+RN
Sbjct: 859  DKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRN 918

Query: 746  VYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 805
            VYVSLPEFAFK+KFI++P Y+K HE   LP+  QLR+DFS YG+IEQINYL+D HCCWIN
Sbjct: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWIN 978

Query: 806  FMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNL 865
            FMNI+SAI+LVEE+N++  ++              KF GRY GL+I YGKDRCGN+NKNL
Sbjct: 979  FMNINSAITLVEEVNEDDGIR-----------FHNKFDGRYNGLIIGYGKDRCGNVNKNL 1027

Query: 866  IAGKNSRFYKKVKRPSYNIRLSKLEEKRR---------QNEIDEKEKAFDKPLNLESLGI 916
            +A KNS+F+KKVK+P+Y I+L K+EE+RR          N++    +     +NLESLGI
Sbjct: 1028 VATKNSKFFKKVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGI 1087

Query: 917  SLDA 920
            + ++
Sbjct: 1088 TFES 1091

 Score =  159 bits (402), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 203/462 (43%), Gaps = 104/462 (22%)

Query: 192 LLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKS 251
           LL+ P  ++YK+LP G D +RTRSLL+EN++ SID  ++VKNF+    +ES YLI+    
Sbjct: 256 LLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLNPG 315

Query: 252 DDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCL 311
                  +K  SIL+SF+++  CL+FYNN+LQRL EFKT L S++L L FV L Y+    
Sbjct: 316 -------SKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYEFTDY 368

Query: 312 PTFIESEALTENAEEADITNGSTMI----------------------------------- 336
              I   A ++N +E+  +N +  I                                   
Sbjct: 369 NHPINEHA-SDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNKENFPLT 427

Query: 337 -SASLHHNIANKDATRSIIIEFKSPVEKSDLFKKK-LQFLDRSKNKRYILESIDLVNT-- 392
            +++L  ++  + ATRS++++F   V K  L  +K   F++ + N RYILESI LVN   
Sbjct: 428 FASALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIEN 487

Query: 393 ------------------DVPSNQFPENYAVLTFLNISMAIEVLDYLKKYSKNLGISKCF 434
                             D P ++F  NY +LTF NI MAIE  DY K     L I  CF
Sbjct: 488 NTKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCF 547

Query: 435 YVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAXXXXXXXXXXXXXXXXXXXITTLN 494
           +VS         +++     E   ST   S PS                      IT+LN
Sbjct: 548 FVS---------KTNYHKNSENSKSTISHSTPSSKISSIVNLPNEINNNNKSNVPITSLN 598

Query: 495 -----NNSSIG-------------------------VSVYGHXXXXXXXXXXXXXXNEEI 524
                +N SI                          +++                 ++EI
Sbjct: 599 SDNDKSNVSISNDNISNDNTSNDNNNSNDNPINNNDITIRNKSRKNSNVTVHELSMDQEI 658

Query: 525 DMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKIS 566
           ++L  KL+ ++L    L I+ + Y  P +EE    L N+ I+
Sbjct: 659 EILNEKLKNIDLKDNELIISAKIYNQPIVEEFDQDLENISIT 700

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/64 (60%), Positives = 48/64 (75%), Gaps = 4/64 (6%)

Query: 51  HPAYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSAR--SSNLKRK 108
           +P YY  SP+P+ PPTPFD +YGA+L PSHLLMGSPFVS+PN+ S   SA   SS   RK
Sbjct: 94  NPTYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRK 151

Query: 109 AYSR 112
           ++SR
Sbjct: 152 SFSR 155

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 57/112 (50%), Gaps = 26/112 (23%)

Query: 1041 QLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQD--IFTNGETAN---------------- 1082
            Q N    L Q PP A STL+  + K    P  D   F   +T +                
Sbjct: 1242 QSNQVPVLNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKNP 1301

Query: 1083 -----NRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1129
                 N+ K R +    +TIPGSDVM+QYL Q+QHSTFMYAANILG SAEDN
Sbjct: 1302 FRGPRNKNKNRNT---RKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDN 1350

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  379 bits (974), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 248/653 (37%), Positives = 350/653 (53%), Gaps = 114/653 (17%)

Query: 547  DYQTPTIEEHSTHLSNVKISKTTE----NSRQFSQDIPSPLPLNEH---------MFMND 593
            +Y TP IE+HS HL+++ IS+ ++    ++     D  +    N H         +FMND
Sbjct: 413  EYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMND 472

Query: 594  --SNQSNGAIIPQQL-IATPSPVSPNLQMNQRVLPNP----------------------- 627
              S+ S   I+P +L + TP    P   M  +++P P                       
Sbjct: 473  PSSSGSTPMIVPSELNLNTPVMGGP---MQGQLMPGPPQPMSLHNPSDGNGGSPSYFMDP 529

Query: 628  -----ITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIK 682
                 I Q+L++ +   A    S  + I NRT+YIGNI+PRSK EDICNVVRGGILQ+IK
Sbjct: 530  MVGAPIGQTLQRQYLAGA----SQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIK 585

Query: 683  YIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGA 742
            +I  K+ICFVTFIE  +AVQFYAN+ ++PIVLHGN+LRVGWG  SG LPK I+LAVTIGA
Sbjct: 586  WISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGA 645

Query: 743  SRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCC 802
            SRNVYVSLPE++FKEK+I++P++K  H    LP  EQLR+DF+ YG +EQINYL D HCC
Sbjct: 646  SRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCC 705

Query: 803  WINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNIN 862
            W+NFMNI+ AI LVE+ N          E  L++    +F GRYK L+I YGKDRCGN+N
Sbjct: 706  WVNFMNIAHAIRLVEDSNSPI-------EKNLEK-FHAQFDGRYKNLIIGYGKDRCGNVN 757

Query: 863  KNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDEKEKAFDKPLNLESL-GISLDAH 921
            KNL A KNSRFYKK+K+ SY+++  K  + R+++ I   +   D   N E L G+ +++ 
Sbjct: 758  KNLAANKNSRFYKKIKKQSYSMKQGK--QPRKEDGIVNSD---DLTKNNEVLPGVQMNSS 812

Query: 922  KDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSFGGLGLAVASSDVKRATSDETDYED- 980
            K+                                  GLG+++ S+ +   T     Y D 
Sbjct: 813  KNGGVGESQSLVGDQELAE-----------------GLGISLTSAQISPDTGHTHHYSDG 855

Query: 981  -------IFNKXXXXXXXXXXVEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKIEDE 1033
                     +           +++I+ +P D     +S T     +    S R  +  + 
Sbjct: 856  VEEGDECDDDDAGYSTSGSSDIDIIV-APPDEFKRRESGTSSGKHKKKSKSTRRNQHSNA 914

Query: 1034 EEAVGMSQ------LNYRS---SLRQAPPRAPSTLSYN-------HSKNNETPMQDIFTN 1077
              +   +Q      L++ S   SL   PP APS++  +       H+    T       N
Sbjct: 915  ASSASYNQQYSLGSLDHTSSAGSLDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQYN 974

Query: 1078 GETANN-----RKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS 1125
             +T  N     R++++  F+  + I G DVM+QYL Q+ HSTF+YA NILGA+
Sbjct: 975  SQTPTNANYKSRRRRQAKFS--KPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025

 Score =  149 bits (376), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 139/249 (55%), Gaps = 47/249 (18%)

Query: 196 PFCINYKVLPTGDDAYRTRSLLIENVD--HSIDLHSIVKNFVKSNTLESAYLIEGGKSDD 253
           P+ IN+K+LP G D Y TRSLL+ N++    +D+H+ + +FVK   +ES YL+     DD
Sbjct: 143 PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM-----DD 197

Query: 254 SKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPT 313
                  N SIL+SFLTK  CL+FYNN+LQR SEFKT L S  L++ FVC +        
Sbjct: 198 -------NHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVCQD-------- 242

Query: 314 FIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSPVEK--SDLFKKKL 371
             ES                      L  N+  + ATRS+ +EF+  V++   D  + K 
Sbjct: 243 --ESSWFKY-----------------LQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKF 283

Query: 372 QFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKKYS--KNLG 429
            +L  S  +R++LE IDL+N    +  F   Y +L F++ISMA+EV D+L++ S  + L 
Sbjct: 284 PWLFCS--QRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLN 341

Query: 430 ISKCFYVSL 438
           IS+  +V++
Sbjct: 342 ISRIQFVNV 350

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/32 (68%), Positives = 27/32 (84%)

Query: 60 LPNIPPTPFDTAYGASLFPSHLLMGSPFVSSP 91
          +P +P TPFD  YGASL PSH+LMGSPF+S+P
Sbjct: 56 MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  380 bits (976), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 264/385 (68%), Gaps = 36/385 (9%)

Query: 521 NEEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISK--------TTENS 572
           ++ ++    KLQG+ L    L I  + Y    IEEH  HL+++ ISK        ++  S
Sbjct: 431 DQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLLSSNNNSSSVS 490

Query: 573 RQFSQDIPSPLPLNEHMFMND-SNQSNGAIIPQQLIATPS----PVSPNLQMNQRVLPNP 627
            Q +Q++ S  P+ + M+++D SN +   ++ Q  +A+ +    P  P+  M+   +  P
Sbjct: 491 LQGNQNLTSS-PVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYYMD---VTKP 546

Query: 628 ITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEK 687
           I Q+L+Q    +A+VAS+MG  +GNRT+Y+GNINPRSK EDICNVVRGGILQ IK+   K
Sbjct: 547 IRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHK 606

Query: 688 KICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVY 747
            +CFVTFIEA +AVQF+AN+ I+PIVLHGN+L+VGWGH+ G L + I+LAVTIGASRNVY
Sbjct: 607 HVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVY 666

Query: 748 VSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 807
           VSLPE+AFK+KFI DP++++  E   LP  EQLR+DFS +G+IEQINYL D HCCW+NFM
Sbjct: 667 VSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFM 726

Query: 808 NISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGG----RYKGLLINYGKDRCGNINK 863
           NI+SAI LVE+ N                A  +KF G    RYKGL+I YGKDRCGN+NK
Sbjct: 727 NITSAIKLVEDANG---------------ADNKKFHGSYQDRYKGLIIGYGKDRCGNVNK 771

Query: 864 NLIAGKNSRFYKKVKRPSYNIRLSK 888
           NL+A K SRF+KKVK+ SY IR+ K
Sbjct: 772 NLVANKKSRFFKKVKKASYKIRMHK 796

 Score =  163 bits (412), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 150/281 (53%), Gaps = 58/281 (20%)

Query: 196 PFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSK 255
           P+ IN+K+LP GDD Y TRSLL+ NV+ SI LH  +  FVK   +ES Y++   + ++ +
Sbjct: 182 PYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEEEE 241

Query: 256 DVETKNL--------------SILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKF 301
           + E +                SIL+SFLTK  CL+FYNN+LQ+LS+FK  L S++L L F
Sbjct: 242 EEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNF 301

Query: 302 VCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSPV 361
           V L                                S  +  ++  K ATRSI +EFK+  
Sbjct: 302 VSL-------------------------------TSEDIRDDVLRKGATRSIALEFKNSF 330

Query: 362 EKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYL 421
               L  + ++ L  + N R+++E ID+VNT+ P+  F  +YA++ F++ISMA+E   YL
Sbjct: 331 TTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYL 388

Query: 422 KKYSKNLGISKCFYVS-----------LAPLVVSSARSSVA 451
             + + LGIS+ F+V+            AP    ++RSSV+
Sbjct: 389 LNWDEKLGISRLFFVTDSIINKSDYFRSAPASQDASRSSVS 429

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 6/75 (8%)

Query: 22 NGMNAMVGNPMMYHPVDFVNGAGQYG-----PSQHPAYYTNSPLPNIPPTPFDTAYGASL 76
          NG+       M YHP+  +NG  Q       PSQ   YY  SP+P+ P TPFDT+YGA+L
Sbjct: 21 NGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQ-GYYAGSPMPSAPQTPFDTSYGATL 79

Query: 77 FPSHLLMGSPFVSSP 91
           PSHLLMGSPF+S+P
Sbjct: 80 LPSHLLMGSPFISTP 94

 Score = 75.9 bits (185), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 56/100 (56%), Gaps = 8/100 (8%)

Query: 1038 GMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGETANNRKKKRGS-----FA 1092
            G   +   +SL   PP APST+S ++S  +         NG    ++K+  G        
Sbjct: 967  GFPSMVSSTSLDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTHHG 1026

Query: 1093 RHR---TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1129
            RHR    IPGS VMAQYLAQ+QHSTFMYAANILG +  DN
Sbjct: 1027 RHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDN 1066

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  335 bits (858), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 198/446 (44%), Positives = 256/446 (57%), Gaps = 81/446 (18%)

Query: 541 LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNE------HMFMNDS 594
           L++   +Y  P IE H  HL +V IS+        S+ + S   L E          N S
Sbjct: 423 LQVIPSEYPVPLIESHDDHLHSVTISRP-------SKTLTSSTSLVEMDGGPNGGTPNGS 475

Query: 595 NQSNGAII---PQQLIATPSPVSPNLQMNQRVLPNPI-------TQSLE-QNFNVSAKVA 643
           N   G ++   P     TPS +   L +N  ++P P+       +QSL   N N +    
Sbjct: 476 NAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAG 535

Query: 644 SSMGSD---------------------IG---NRTIYIGNINPRSKAEDICNVVRGGILQ 679
            S   D                     +G   NRT+YIGNI+PRSK EDICNVVRGGILQ
Sbjct: 536 PSYFMDPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQ 595

Query: 680 SIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVT 739
           +IK+I  K+ICFVTFIEA +A+QFYAN+ ++PIVLHGN+LRVGWG  SG LPK I+LAVT
Sbjct: 596 NIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVT 655

Query: 740 IGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDS 799
           IGASRNVYVSLPE++FKEK+I++P++K+ H    LP  EQLR+DF+ YG +EQINYL D 
Sbjct: 656 IGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDG 715

Query: 800 HCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCG 859
           HCCW+NFMNI+ AI LVE+ N  S    E            +F GRYK L+I YGKDRCG
Sbjct: 716 HCCWVNFMNIAHAIRLVEDCNSLSQRNLEK--------FHAQFDGRYKNLIIGYGKDRCG 767

Query: 860 NINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNE------------------IDEK 901
           N+NKNL A KNSRF+KK+K+ +   + +K ++ +R                     +  K
Sbjct: 768 NVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRGTSSASSDDARKDDASTEKVPVSSK 827

Query: 902 EKAFDKPLNL-------ESLGISLDA 920
           E   D+ L L       E LGISL +
Sbjct: 828 EPVCDEILGLNDDNALAEGLGISLSS 853

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 140/250 (56%), Gaps = 48/250 (19%)

Query: 196 PFCINYKVLPTGDDAYRTRSLLIENVDH--SIDLHSIVKNFVKSNTLESAYLIEGGKSDD 253
           P+ +N+K+LP G D Y TRSLL  N++   + D+H+ + NF+K   +ES YL+     DD
Sbjct: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL-----DD 212

Query: 254 SKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPT 313
           S        SIL+SFLTK  CL+FYNN+LQR SEFK+ L S  L++ FVC          
Sbjct: 213 SH-------SILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------- 255

Query: 314 FIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEF--KSPVEKSDLFKKKL 371
                         D TN   +    L  N+  +  TRS+ IEF  +S    SDL  +K+
Sbjct: 256 -------------QDETNWFRL----LQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKI 298

Query: 372 QFLDRSKNKRYILESIDLVNTDVPSNQ-FPENYAVLTFLNISMAIEVLDYLKKYS--KNL 428
            +L  S   R+++E IDLVN   P NQ F   Y ++ F+ ISMA+EV +YL++ S  K L
Sbjct: 299 PWLFFS--HRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQL 356

Query: 429 GISKCFYVSL 438
           GISK  +V++
Sbjct: 357 GISKIQFVNV 366

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%)

Query: 60  LPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGY 97
           +P +P TPFD  YGASL PSH+LMGSPFVS+P    G+
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGH 116

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 1095 RTIPGSDVMAQYLAQVQHSTFMYAANILGASA 1126
            + I G DVM+QYL Q+ HSTF+Y+ NILGA+ 
Sbjct: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATT 1052

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  179 bits (453), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 91/214 (42%), Positives = 129/214 (60%), Gaps = 31/214 (14%)

Query: 648 SDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANS 707
           +++GNRT+Y+GN+    K ++ICN VRGG+LQ IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 523 NNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMS 582

Query: 708 FIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 767
            +  + +     +VGWG +SGPLP LI+LAV+ GASRNVY+   +F    K  + P + +
Sbjct: 583 SLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTE 642

Query: 768 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
           L           LR  F  YGD+EQIN+L + +CC+INF NIS+AI  +E++        
Sbjct: 643 L----------SLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKI-------- 684

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                        K    +K L IN+GKDRCGNI
Sbjct: 685 -------------KNNPDFKDLKINFGKDRCGNI 705

 Score = 91.7 bits (226), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 107/226 (47%), Gaps = 35/226 (15%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI      +D+ + VR G++++IK +P+K   F++F++  SA+ F++++ +  +
Sbjct: 268 RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRL 327

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVS---------------LPEFAFKE 757
            + G  +++GWG  +   P + +  VT GA+RNVY+                    +   
Sbjct: 328 NIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSPS 387

Query: 758 KFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVE 817
               D   KK +   S    E+LRED   YG+I+ +  + D    +++  +I SAI +V 
Sbjct: 388 NNTSDDLEKKKNIDDSPLTEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVVN 447

Query: 818 EMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
            + + +                      Y+   I YGKDRC  I K
Sbjct: 448 NLAQTNPY--------------------YQNKRIFYGKDRCAFITK 473

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  172 bits (437), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/217 (40%), Positives = 130/217 (59%), Gaps = 32/217 (14%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRTIY+GN+    K E+ICN VRGG+LQ IK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 338 NLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSS 397

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  + +H    ++GWG +SGPLP  ++LAV+ GASRN+Y+   +FA  +K  H P + + 
Sbjct: 398 LHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKKSQH-PIFTE- 455

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
                      LR  F  +G++EQIN+L + +CC+INF NISSAI  ++++    T    
Sbjct: 456 ---------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT---- 502

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNL 865
                            +K L IN+GKDRCGN+ +  
Sbjct: 503 -----------------FKDLKINFGKDRCGNVPRQF 522

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 104/214 (48%), Gaps = 29/214 (13%)

Query: 652 NRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDP 711
           +RT+Y+GN+ P    +++ + VR G+++ +K +PEK   F++F+E  SA+ F++++ +  
Sbjct: 102 SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 712 IVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKKLH 769
           + +    +++GWG  +   P + +     GA+RNVY+           ++  DP  + + 
Sbjct: 162 LNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLNTNKDICAQWGVDPNEEVIT 221

Query: 770 ETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNES 829
           E       E+LR D S +G++E +  + +    +++F +I +AI +V  +          
Sbjct: 222 E-------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANL---------- 264

Query: 830 GEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                           Y    I YGKDRC  I K
Sbjct: 265 ----------ANINPYYAQKKIFYGKDRCAFITK 288

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  173 bits (439), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 130/213 (61%), Gaps = 32/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRT+Y+GN+    K E+ICN VR G+LQS+K + ++ +CFVTFI+  +A QFYA S 
Sbjct: 405 NLGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSS 464

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  ++L     +VGWG +SGPLP LI+LAV+ GASRNVY+   +F          +  K 
Sbjct: 465 LHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFE---------EDSKR 515

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
           +E +   D   LR+ F  YG++EQIN+L   +CC+IN+ NIS+AIS ++++         
Sbjct: 516 NERVFTED--NLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKI--------- 564

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                       K    +K L IN+GKDRCGNI
Sbjct: 565 ------------KSNPYFKDLKINFGKDRCGNI 585

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 109/217 (50%), Gaps = 37/217 (17%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI      +++ + VR G+++ +K +PEK   F++F++  SA+ F++++ +  +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 772
            + G  +++GWG  +   P + +   T GA+RNVY+         +   D +   + E+L
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIG--------QLYTDAE---VAESL 277

Query: 773 SLPD------AEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQ 826
           ++P        E+L  D   YGDI+ +  + +    +I+F +I SAI +V  +       
Sbjct: 278 NIPKESEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNL------- 330

Query: 827 NESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                     A   ++   Y+   I YGKDRC  I K
Sbjct: 331 ----------AASNRY---YQNRKIFYGKDRCAFITK 354

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  173 bits (438), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 131/213 (61%), Gaps = 32/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRT+Y+GN+    K E+ICNVVRGG+LQS+K + ++ +CFVTFI+  +A QFYA S 
Sbjct: 444 NLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSS 503

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  + +     +VGWG +SGPLP  ++LAV+ GASRNVY+      F++  + DP+    
Sbjct: 504 LHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPR---- 557

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
                +   + LR+ F  YG++EQIN+L + +CC+INF NIS+AI  ++++         
Sbjct: 558 -----IFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKI--------- 603

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                       K    ++ L IN+GKDRCGN+
Sbjct: 604 ------------KSNPHFEDLKINFGKDRCGNV 624

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 100/211 (47%), Gaps = 31/211 (14%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI      +++ + VR G+++ +K IPEK   F++F++  SA+ F++++ +  +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 772
            + G  +++GWG  +   P + +  +   A+RNV++        +    +P  +      
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPITEA----- 328

Query: 773 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEV 832
                 +LRED   +G+IE +  + +    +++F +I+SAI  V  +             
Sbjct: 329 ------KLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNL------------- 369

Query: 833 TLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                        Y+   I YGKDRC  I K
Sbjct: 370 -------RSMNPYYENKKIAYGKDRCAFITK 393

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  169 bits (427), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 124/213 (58%), Gaps = 34/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRTIY+GN++ R + E++CNVVRGG+LQS+K++P++ +CFVTF +  +A QFYA + 
Sbjct: 261 NLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMAS 320

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  + +     ++GWG +SGPLP  ++ A++ GASRNVY       F      DP   + 
Sbjct: 321 LHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEF 373

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
            E         LR+  S +G++EQ+N + +  C ++NF N+ SAI+ VE++ K    Q  
Sbjct: 374 FEE------RHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQVKKWPQFQQ- 426

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                               L +NYGKDRCGN+
Sbjct: 427 --------------------LKVNYGKDRCGNV 439

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 99/215 (46%), Gaps = 46/215 (21%)

Query: 652 NRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDP 711
           +RT+Y+GNI P     ++ + V+ G+++  +  P K   FV+F++  SA+ F++++ ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 712 IVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHET 771
           + +    +++GW   +   P + +   + GA+RNVY+                       
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLG---------------------- 135

Query: 772 LSLPDAE---QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
            +LPD     +L +D S YG+I+ +  LS     +++  +I  AI  V  + +++ +   
Sbjct: 136 -NLPDGVSRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDNKI--- 191

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                            Y    +++GKDRC  + K
Sbjct: 192 -----------------YSDRRVSFGKDRCAYVTK 209

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  172 bits (435), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 128/214 (59%), Gaps = 34/214 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRT+Y+GN+    K E+ICN VRGG+LQS+K + ++ +CFVTFI+  +A QFYA S 
Sbjct: 397 NLGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSS 456

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  + +H    ++GWG +SG LP  ++LAV+ GASRN+YV   +F              +
Sbjct: 457 LHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDF------------NAI 504

Query: 769 HETLSLPDAEQ-LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
            ET      EQ LRE F  +G++EQIN+L + +CC+INF NIS+AI  ++++        
Sbjct: 505 DETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI-------- 556

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                        K    +K L +N+GKDRCGN+
Sbjct: 557 -------------KCNPYFKNLKVNFGKDRCGNV 577

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 112/215 (52%), Gaps = 33/215 (15%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI P   A+ + + VR G+++ +K +P++   F++F++  SA+ F++++ +  +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSL----PEFAFKEKFIHDPQYKKL 768
            + G  ++VGWG  +   P + +   + GA+RNVY+      P+ A   +F  DP  + +
Sbjct: 221 NIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNEEIV 278

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
            E       E+LR+D + +G+IE I  + D    +++F +I SAI +V  +         
Sbjct: 279 SE-------EKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL--------- 322

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                   A+   +   Y    I YGKDRC  I K
Sbjct: 323 --------ASVNPY---YTNKKIFYGKDRCAFITK 346

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  170 bits (430), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 127/213 (59%), Gaps = 32/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRTIY+GN+    K E+ICN VRGG+LQ IK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 391 NLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSS 450

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  + +H    ++GWG +SGPLP  ++LAV+ GASRN+Y+   +F    K +  P + + 
Sbjct: 451 LHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFEDDRK-LEQPIFTE- 508

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
                      LR  F  +G++EQIN+L + +CC+INF NISSAI  ++++    T    
Sbjct: 509 ---------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT---- 555

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                            +K L IN+GKDRCGN+
Sbjct: 556 -----------------FKDLKINFGKDRCGNV 571

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 108/215 (50%), Gaps = 33/215 (15%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GN+ P     ++ + VR G+++ +K +PEK   F++F++  SA+ F++++ +  +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSL----PEFAFKEKFIHDPQYKKL 768
            +    +++GWG  +   P + +     GA+RNVY+      P+     ++  DP  + +
Sbjct: 216 NIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNEETI 273

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
            E       E+LR D + +G++E +  +++    +++F +I SAI +V  +         
Sbjct: 274 TE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANL--------- 317

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
              V    A ++ F          YGKDRC  I K
Sbjct: 318 -ANVNPYYAQKKIF----------YGKDRCAFITK 341

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  169 bits (428), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 130/214 (60%), Gaps = 32/214 (14%)

Query: 648 SDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANS 707
           +++GNRT+Y+GN+    K E+ICNVVRGGILQ+IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 398 NNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMS 457

Query: 708 FIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 767
            +  I +     RVGWG + GPLP  I+LAV+ GASRNVY+   +F +++    +P +  
Sbjct: 458 SLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIFT- 515

Query: 768 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
                    A+ LR+ F  YG++EQ+N+L + +C ++N+ NIS+AIS ++++        
Sbjct: 516 ---------ADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNPL--- 563

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                             +K L IN+GKDRCG I
Sbjct: 564 ------------------FKNLKINFGKDRCGTI 579

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 110/214 (51%), Gaps = 31/214 (14%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           +T+Y+GNI P     ++ + VR G+++ +K +PEK   F+TF++  +A+ F++++ +  +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAV-TIGASRNVYVSL--PEFAFKEKFIHDPQYKKLH 769
            + G  +++GWG  + P+  L++ A+ + GA+RNVY+ L   +     +   DP  +K+ 
Sbjct: 223 HIDGRDIKIGWGKAT-PVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKIT 281

Query: 770 ETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNES 829
           E       E+LR D   +G+I+ +  + +    +I+F +I SA+ +V  +          
Sbjct: 282 E-------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL---------- 324

Query: 830 GEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                           Y+   I YGKDRC  I K
Sbjct: 325 ----------AGINPYYENKKIYYGKDRCAFITK 348

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  169 bits (429), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 132/214 (61%), Gaps = 32/214 (14%)

Query: 648 SDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANS 707
           +++GNRTIY+GN+    + E+ICNVVRGG+LQS+K + ++ +CFVTFI+  +A QF+A S
Sbjct: 494 NNLGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMS 553

Query: 708 FIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 767
            +  + +     +VGWG +SGPL   ++LAV+ GASRN+Y+   +FA  +K   +P + +
Sbjct: 554 SLHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFATDKKR-DNPIFTE 612

Query: 768 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
                     + LR+ FS YG++EQIN+L + +CC+INF NIS+AI  ++++        
Sbjct: 613 ----------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNPV--- 659

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                             +K L IN+GKDRCGNI
Sbjct: 660 ------------------FKDLKINFGKDRCGNI 675

 Score = 92.0 bits (227), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 122/264 (46%), Gaps = 61/264 (23%)

Query: 641 KVASSMGSDIGN---------RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICF 691
           ++ S+MGS + +         RT+Y+GNI      +++ + VR G+++ +K IPEK   F
Sbjct: 201 RMQSTMGSRLNDPLDFTTAPSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAF 260

Query: 692 VTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVS-L 750
           ++F++  SA+ F++++ +  + ++G  +++GWG  +   P + +  +  GA+RNV++  L
Sbjct: 261 ISFLDENSALLFHSDAILKRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQL 320

Query: 751 PEFAF---KEKFIHDPQYKK--LHETLSLPDAE--------------------------Q 779
              +F   K K    P  +   ++ T+S  + E                          +
Sbjct: 321 KTKSFDPNKAKVTKMPPSRNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAK 380

Query: 780 LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATE 839
           LR+D + +GDI+ I  + D    +I+F +I+SAI  V  +N                   
Sbjct: 381 LRKDLADFGDIDCIKIVEDKGIAFIHFASITSAIKCVHNLN------------------- 421

Query: 840 EKFGGRYKGLLINYGKDRCGNINK 863
                 Y    I YGKDRC  I K
Sbjct: 422 -SMNDYYSTKKIFYGKDRCAFITK 444

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  166 bits (421), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 129/214 (60%), Gaps = 36/214 (16%)

Query: 648 SDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANS 707
           +++GNRTIY+GN+    K E+ICNVVRGG+LQ+IK + ++  CF+TFI+  +A QFYA S
Sbjct: 351 NNLGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMS 410

Query: 708 FIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 767
            +  + +  N  +VGWG +SGPL   ++LA++ GASRN+Y+   +F  K ++ ++     
Sbjct: 411 SLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFNE----- 465

Query: 768 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
                     E LRE F  +G++EQIN+L +  CC++NF NI+ AI  +++         
Sbjct: 466 ----------EHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDK--------- 506

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                 +K   E      ++ L IN+GKDRCGNI
Sbjct: 507 ------IKSLPE------FEDLKINFGKDRCGNI 528

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 128/252 (50%), Gaps = 49/252 (19%)

Query: 614 SPNLQMNQRVLPNPIT-QSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNV 672
           +P L MN    PNPIT Q    N  ++   A S       RT+Y+GNI      +++ + 
Sbjct: 97  NPMLPMNHE--PNPITMQPFMANDPLNFTNAPS-------RTVYLGNIPQGLTIKELLDH 147

Query: 673 VRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPK 732
           VR G+++S+K +P K   F++FI+   A+ F++++ +  + + G  +++GWG  S  +  
Sbjct: 148 VRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRLNIRGKDIKIGWGK-SNHIDS 206

Query: 733 LISLAVT-IGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIE 791
           +++  +T  GA+RNVY+                  +L++  ++   ++L +D   +G+I+
Sbjct: 207 IVAARITNDGATRNVYIG-----------------QLNDDPTITTEQELEKDMQKFGEID 249

Query: 792 QINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLI 851
            I +LS+    +++F +IS AI +V+ ++K     NE                +YK   I
Sbjct: 250 CIKFLSNKGIAFVHFASISVAIYVVQNLSK----LNE----------------KYKNKRI 289

Query: 852 NYGKDRCGNINK 863
            YGKDRC  I K
Sbjct: 290 FYGKDRCAFITK 301

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  168 bits (425), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 126/214 (58%), Gaps = 32/214 (14%)

Query: 648 SDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANS 707
           +++GNRT+Y+GN+    K E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S
Sbjct: 453 NNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMS 512

Query: 708 FIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 767
            +    +     +VGWG +SGPLP  ++LAV+ GASRNVY+   +F    K     +   
Sbjct: 513 SLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK----KEQPI 568

Query: 768 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
            +ET        LR  F  YG++EQIN+L +  CC+INF NI++AI  ++++        
Sbjct: 569 FNET-------ALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI-------- 613

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                        K    +K L IN+GKDRCGN+
Sbjct: 614 -------------KSNPHFKSLKINFGKDRCGNV 634

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 108/211 (51%), Gaps = 31/211 (14%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI P    +++ + VR G+++  K +PEK   F++F+E  SA+ F++++ +  +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 772
            +    ++VGWG  +   P + S  +  GA+RNVY+            +D   K+  E L
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKENKEPL 335

Query: 773 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEV 832
           +    E+LRED   YG+I+ I  + +    +++F +I++AI +V  + +++         
Sbjct: 336 T---EEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNPF------- 385

Query: 833 TLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                        Y+   I YGKDRC  I K
Sbjct: 386 -------------YQEKKIFYGKDRCAFITK 403

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  167 bits (423), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 104/307 (33%), Positives = 159/307 (51%), Gaps = 47/307 (15%)

Query: 560 LSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGAIIPQQLIATPSPVSPNL-Q 618
           LS +K+     NS  +          +   F+  + + N A    Q +  P+  + +L Q
Sbjct: 327 LSAIKVVNNLSNSNPYYSKKKIYYGKDRCAFITKTQKHNAA----QFLGIPTSKANSLEQ 382

Query: 619 MNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGIL 678
            N  +L N + Q       ++     S  +++GNRT+Y+GN+    + EDICN +R G+L
Sbjct: 383 TNSGLLANALLQQSAAAAAIATSAGGS--NNLGNRTVYLGNLPNDIRIEDICNTIRCGLL 440

Query: 679 QSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAV 738
           Q+IK + ++ +CFVTFI+  SA QFYA S I   VL     +VGWG +SGPL   ++LAV
Sbjct: 441 QNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIYGFVLQKKRCKVGWGKHSGPLSNPLTLAV 500

Query: 739 TIGASRNVYVSLPEFAF----KEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQIN 794
           + GASRNVY+   +F      +E++  D                 LR  FS YG++EQIN
Sbjct: 501 SNGASRNVYIGNIDFTADGTKRERYFTD---------------SNLRRIFSEYGEVEQIN 545

Query: 795 YLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYG 854
           +L   +CC++N+ NI++AIS ++++    T                     +K L IN+G
Sbjct: 546 FLYSKNCCFVNYTNINNAISAIDKIKNNPT---------------------FKNLKINFG 584

Query: 855 KDRCGNI 861
           KDRCGNI
Sbjct: 585 KDRCGNI 591

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 108/215 (50%), Gaps = 26/215 (12%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI P   A D+ + VR G+++ +K +PEK   F++F++  S++ F++++ +  +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAV-TIGASRNVYVSLPEFAFKEKFIHDPQYKKLHET 771
            + G  +++GWG  S PL  +I+ +V T GA+RN+++         K   D      H +
Sbjct: 228 NIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNK-QKDNDATIYHGS 285

Query: 772 LSLPD---AEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
               D    E+LR+D   YGDI+ I    +    +++F +I SAI +V  ++  +     
Sbjct: 286 DDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNPY--- 342

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                            Y    I YGKDRC  I K
Sbjct: 343 -----------------YSKKKIYYGKDRCAFITK 360

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  167 bits (423), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 127/213 (59%), Gaps = 32/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRT+Y+GN+    K E+ICN +RGG+LQ+IK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 468 NLGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSS 527

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  + +H    ++GWG +SGPLP  I+LAV+ GASRN+Y  L    F+E         K 
Sbjct: 528 LHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIY--LGNINFEED-------AKQ 578

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
            E++   D   LR  F  +G +EQIN+L + +CC+INF NIS+AI  ++++         
Sbjct: 579 EESVFAEDT--LRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKI--------- 627

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                       K    +  L IN+GKDRCGN+
Sbjct: 628 ------------KSNPHFNNLKINFGKDRCGNV 648

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 104/213 (48%), Gaps = 29/213 (13%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI      + + + VR G+++ +K + EK   FV+F++   A+ F++++ +  +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFK--EKFIHDPQYKKLHE 770
            + G  +++GWG      P + +     GA+RNVY+          EK+  DP  K++  
Sbjct: 293 NIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADP--KEI-- 348

Query: 771 TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESG 830
              L   E+L +D S +G+IE I  + D    +++F +I +AI  V  +          G
Sbjct: 349 ---LVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANI----------G 395

Query: 831 EVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
            +    + ++ F          YGKDRC  I K
Sbjct: 396 SIDPYYSNKKVF----------YGKDRCAFITK 418

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  162 bits (410), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 130/214 (60%), Gaps = 34/214 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRTIY+GN+    K E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A Q YA + 
Sbjct: 384 NLGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTS 443

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEF-AFKEKFIHDPQYKK 767
           +  + +H    ++GWG +SG L   ++LAV+ GASRN+Y+   +F A  E+ +  P + +
Sbjct: 444 LHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSERDV--PVFTE 501

Query: 768 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
                     + LR+ F  YG++EQIN+L +  CC++NF NIS+AI  ++++       N
Sbjct: 502 ----------QNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKS-----N 546

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
           E                ++K L IN+GKDRCGN+
Sbjct: 547 E----------------QFKDLKINFGKDRCGNV 564

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 111/214 (51%), Gaps = 31/214 (14%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI P  +  ++ + VR G+++ ++ + EK   F++F++  SA+ F++++ +  +
Sbjct: 148 RTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRL 207

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVT-IGASRNVYVSL--PEFAFKEKFIHDPQYKKLH 769
            + G  ++VGWG  + P+  +++ AV+  GA+RNVY+     +     +F  DP  + L 
Sbjct: 208 NIGGRDIKVGWGKPT-PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP--RDLI 264

Query: 770 ETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNES 829
            T      E+LR D   YG+IE +  + +    +++F +I SAI +V  +          
Sbjct: 265 AT-----EEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL---------- 309

Query: 830 GEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                  AT   +   Y    I YGKDRC  + K
Sbjct: 310 -------ATVNPY---YSNKKIFYGKDRCAFVTK 333

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  163 bits (412), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 123/213 (57%), Gaps = 32/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRT+Y+GN+    K E+ICNVVRGG+LQ++K + ++ +CFVTFI+  +A QFYA S 
Sbjct: 447 NLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSS 506

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  I +     RVGWG + G L   ++LAV+ GASRNVYV    F    K   DP + + 
Sbjct: 507 LHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKR-EDPIFTE- 564

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
                      LR  F  +G++EQINYL + +CC++N+ NIS+AI  ++++         
Sbjct: 565 ---------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPV---- 611

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                            +K L IN+GKDRCGN+
Sbjct: 612 -----------------FKDLKINFGKDRCGNV 627

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 103/212 (48%), Gaps = 26/212 (12%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           +T+Y+GN       +++ + VR G+++ ++ +P+K   FV+F++  +A+ F++++ +  +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVT-IGASRNVYVSLPEFAFKEKFIHDPQYKKLHET 771
            + G  +++GWG  + P+  +++ AV    A+RNVY+   +     K     Q   +  T
Sbjct: 270 HIDGRDIKIGWGKPT-PIDPVVATAVANDNATRNVYIG--QLNTGPKL--SSQVSPVDVT 324

Query: 772 LSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGE 831
             +   ++LR D   +G+I+ I  + +    +++F +I +AI  V  +            
Sbjct: 325 EPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANL------------ 372

Query: 832 VTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                         Y+   I YGKDRC  I K
Sbjct: 373 --------ANINPYYRNKKIFYGKDRCAFITK 396

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  162 bits (409), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 127/213 (59%), Gaps = 32/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRTIY+GN+    K E+ICNVVRGG+LQSIK + ++ +CFVTFI+  +A Q YA + 
Sbjct: 382 NLGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMAS 441

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +  + +H    ++GWG +SG L   ++LAV+ GASRN+Y+   +F    +  H P + + 
Sbjct: 442 LHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSETEH-PIFTE- 499

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
                    + LR  F  +G++EQIN+L + +CC++NF NIS+AI  ++++         
Sbjct: 500 ---------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKI--------- 541

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                       K   ++  L IN+GKDRCGN+
Sbjct: 542 ------------KNNPQFSDLKINFGKDRCGNV 562

 Score =  100 bits (248), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 111/213 (52%), Gaps = 29/213 (13%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GNI P  +A  + + VR G+++ I+ + EK   F++F++  SA+ F++++ +  +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKKLHE 770
            + G  +++GWG  +   P + S     GA+RNVY+     + +F  +   DP+ + + E
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDEVVTE 265

Query: 771 TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESG 830
                  ++LR+D S YG+IE +  +++    +++F +I SAI +V  +           
Sbjct: 266 -------QKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL----------A 308

Query: 831 EVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
            V    A ++ F          YGKDRC  I K
Sbjct: 309 AVNPYYANKKIF----------YGKDRCAFITK 331

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  162 bits (410), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 648 SDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANS 707
           +++GNRT+Y+G++    K E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S
Sbjct: 410 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 469

Query: 708 FIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 767
            +    +     +VGWG +SGPLP  ++LAV+ GASRNVYV   +FA     ++D +   
Sbjct: 470 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--SDSLNDER--- 524

Query: 768 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
                 +     LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++        
Sbjct: 525 ------IFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI-------- 570

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                        K    +K L IN+GKDRCGN+
Sbjct: 571 -------------KSNPYFKDLKINFGKDRCGNV 591

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 120/262 (45%), Gaps = 46/262 (17%)

Query: 613 VSPNLQMNQRVLPNPI------TQSLEQNFNVSAKVASSMGSDIG-----NRTIYIGNIN 661
           VSP    N   LP+ I      T +   N N    V S   + +       RT+Y+GN+ 
Sbjct: 134 VSPFGDENPNALPDSISPIVRATATAVTNANAPLSVNSQANNSLNFTSAPTRTVYLGNVP 193

Query: 662 PRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRV 721
           P    +++ + VR G+++ +K IPEK   F++F++  +A+ F++++ +  + +    +++
Sbjct: 194 PHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRLNIGDRDIKI 253

Query: 722 GWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLR 781
           GWG  +   P + +   T GA+RNVY+       +E  + +               EQLR
Sbjct: 254 GWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHLSE---------------EQLR 298

Query: 782 EDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEK 841
            D   YG+I+ I  + +    +I+F +I +AI +V  +     ++N              
Sbjct: 299 ADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNL----PIRNP------------- 341

Query: 842 FGGRYKGLLINYGKDRCGNINK 863
               Y+   I YGKDRC  I K
Sbjct: 342 ---YYQNKRIFYGKDRCAFITK 360

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  162 bits (410), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 126/214 (58%), Gaps = 32/214 (14%)

Query: 648 SDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANS 707
           +++GNRT+Y+G++    K E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S
Sbjct: 426 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 485

Query: 708 FIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 767
            +    +     +VGWG +SGPLP  ++LAV+ GASRNVYV          F+ D    +
Sbjct: 486 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGDSLRDE 539

Query: 768 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQN 827
              T S      LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++        
Sbjct: 540 RVFTES-----NLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI-------- 586

Query: 828 ESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                        K    +K L IN+GKDRCGN+
Sbjct: 587 -------------KSNPYFKDLKINFGKDRCGNV 607

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 104/211 (49%), Gaps = 35/211 (16%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GN+ P    +++ + VR G+++ +K IPEK   FV+FI+  +A+ F++++ +  +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 772
            +    +++GWG  +   P + +   T GA+RNVY+       +E  + +          
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSE---------- 310

Query: 773 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEV 832
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +     ++N     
Sbjct: 311 -----EQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNL----PIRNP---- 357

Query: 833 TLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                        Y+   I YGKDRC  I K
Sbjct: 358 ------------YYQNKRIFYGKDRCAFITK 376

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  161 bits (407), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 125/213 (58%), Gaps = 32/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRT+Y+G++    K E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 440 NLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSS 499

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +    +     +VGWG +SGPLP  ++LAV+ GASRNVYV          F+ D    + 
Sbjct: 500 LYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDER 553

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
             T S      LR  F  YG++EQIN+L + +CC++N+ NIS+AI  ++++         
Sbjct: 554 IFTES-----NLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKI--------- 599

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                       K    +K L IN+GKDRCGN+
Sbjct: 600 ------------KSNPYFKDLKINFGKDRCGNV 620

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 104/211 (49%), Gaps = 35/211 (16%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GN+ P    +++ + VR G+++ +K I EK   F++F++  +A+ F++++ +  +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 772
            +    +++GWG  +   P + +   T GA+RNVY+         +   D +   L E  
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIDGEESHLSE-- 323

Query: 773 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEV 832
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +     ++N     
Sbjct: 324 -----EQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNL----PIRNP---- 370

Query: 833 TLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                        Y+   I YGKDRC  I K
Sbjct: 371 ------------YYQNKRIFYGKDRCAFITK 389

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  159 bits (402), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 125/213 (58%), Gaps = 32/213 (15%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708
           ++GNRT+Y+G++    K E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 429 NLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSS 488

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
           +    +     +VGWG +SGPLP  ++LAV+ GASRNVYV      +    + D +    
Sbjct: 489 LYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDYVSDSVRDER---- 542

Query: 769 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828
                +    +LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++         
Sbjct: 543 -----IFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI--------- 588

Query: 829 SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNI 861
                       K    +K L IN+GKDRCGN+
Sbjct: 589 ------------KSNPYFKDLKINFGKDRCGNV 609

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 101/211 (47%), Gaps = 35/211 (16%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPI 712
           RT+Y+GN+ P    +++ + VR G+++ +K IPEK   F++F++  +A+ F++++ +  +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 713 VLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 772
            +    +++GWG  +   P + +   T GA+RNVY+       +E  +            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 773 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEV 832
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +   +         
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRNLY------- 360

Query: 833 TLKRATEEKFGGRYKGLLINYGKDRCGNINK 863
                        Y+   I YGKDRC  I K
Sbjct: 361 -------------YQNKRIFYGKDRCAFITK 378

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 18/92 (19%)

Query: 654 TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---TFIEAPSAVQFYANSFI 709
           T YIGNI   +   D+  +++  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 299 TAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 355

Query: 710 DPIVLHGNMLRVGWG---------HYSGPLPK 732
                 G  LR GWG         H  GP+P+
Sbjct: 356 --FPFQGRNLRTGWGKEKPTFIPQHQQGPVPQ 385

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 81/215 (37%), Gaps = 40/215 (18%)

Query: 522 EEIDMLATKLQGVELDGTYLEINY----RDYQTPTIEEHSTHLSNVKISKTTENSRQFSQ 577
           E+  +    +Q  EL+G  L IN+     ++             N  +     N+  F +
Sbjct: 196 EQAQLAMDSMQSQELNGRPLRINWASKRENHHNGNRRGGLAGNRNGGMRLFPNNNNGFGR 255

Query: 578 DIPSPLPLNEHMFMNDSNQSNGAIIP---QQLIATPSPVSPNLQMNQRVLPNPIT-QSLE 633
            +P P P       N      G  +P   Q + A PS  +P        +P P+  Q++E
Sbjct: 256 GMPMPPP-------NSMGIPLGGTLPPNAQPMGAPPSGPAP-------TVPPPVNPQAVE 301

Query: 634 QNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV 692
                +    +         T YIGNI   +   D+  +++  G +   K+ PEK  CFV
Sbjct: 302 AMIRRAPPRVT---------TSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFV 352

Query: 693 ---TFIEAPSAVQFYANSFIDPIVLHGNMLRVGWG 724
              T  +A   +   AN F       G  LR GWG
Sbjct: 353 KYDTHEQAAVCIVALANFF-----FQGRNLRTGWG 382

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 82/211 (38%), Gaps = 39/211 (18%)

Query: 522 EEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQF--SQDI 579
           EE       +QG EL+G  L IN+   +      +  +++  + +    N+  F  S+ +
Sbjct: 184 EEAQKAMDAMQGHELNGRPLRINWASKRENNNNNNRRNVNGPRNNGFRHNNGGFPGSRGM 243

Query: 580 PSPLPLNEHMFMNDSNQSNGAIIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVS 639
           P P P +  + M       G + P Q +  P         N   +P P          V+
Sbjct: 244 PMPPPNSMSLPM-------GVVPPPQALGNP---------NGPSVPPP----------VN 277

Query: 640 AKVASSMGSDIGNR--TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---T 693
            +   SM      R  T YIGNI   +   D+  +++  G +   K+ PEK  CF+   T
Sbjct: 278 PQAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDT 337

Query: 694 FIEAPSAVQFYANSFIDPIVLHGNMLRVGWG 724
             +A   +   AN         G  LR GWG
Sbjct: 338 HEQAAVCIVALAN-----FPFQGRNLRTGWG 363

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 82/207 (39%), Gaps = 39/207 (18%)

Query: 530 KLQGVELDGTYLEINY---RDYQTPTIEEHSTHLSNVKISKTTENSRQF----SQDIPSP 582
           ++QG EL+G  + IN+   RD Q    + H+      + +    N   F    +  +  P
Sbjct: 230 QMQGKELNGRPIRINWASKRDNQQGQQQSHNNGGFQNRRNNNNNNPNMFGSRNTNQMQGP 289

Query: 583 LPLNEHMFMNDSNQSNGAIIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKV 642
            P N  M         G   PQQ +   +PV PN      V       ++E     +   
Sbjct: 290 PPPNMQM---------GVPPPQQGM---NPVGPNGPHPPVVPLPVNPDAVEDMIRRAPPR 337

Query: 643 ASSMGSDIGNRTIYIGNINPRSKAE-DICNVVRG-GILQSIKYIPEKKICFV---TFIEA 697
            +         T YIGN+ PR   E D+  +++  G +   K+ P++ ICF+   T  +A
Sbjct: 338 VT---------TAYIGNL-PRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHEQA 387

Query: 698 PSAVQFYANSFIDPIVLHGNMLRVGWG 724
              +   AN       L G  L+ GWG
Sbjct: 388 AVCIVALAN-----FPLQGRNLKTGWG 409

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 654 TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---TFIEAPSAVQFYANSFI 709
           T+YIGNI   +   D+  +++  G +   KY PEK  CF+   T  +A   +   AN   
Sbjct: 326 TVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLAN--- 382

Query: 710 DPIVLHGNMLRVGWG 724
                 G  L+ GWG
Sbjct: 383 --YPFQGRNLKTGWG 395

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 654 TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---TFIEAPSAVQFYANSFI 709
           T YIGNI   ++  D+  +++  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 315 TAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 371

Query: 710 DPIVLHGNMLRVGWG 724
                 G  LR GWG
Sbjct: 372 --FPFQGRNLRTGWG 384

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score = 36.2 bits (82), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 654 TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---TFIEAPSAVQFYANSFI 709
           T+YIGNI   +   D+  +++  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 325 TVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTHEQAAVCIVVLAN--- 381

Query: 710 DPIVLHGNMLRVGWG 724
                 G  L+ GWG
Sbjct: 382 --FPFQGRNLKTGWG 394

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score = 35.8 bits (81), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 654 TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---TFIEAPSAVQFYANSFI 709
           T YIGNI   +   D+  + +  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 344 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 400

Query: 710 DPIVLHGNMLRVGWG 724
                 G  LR GWG
Sbjct: 401 --FPFQGRNLRTGWG 413

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score = 35.8 bits (81), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 654 TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---TFIEAPSAVQFYANSFI 709
           T YIGNI   +   D+  + +  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 348 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 404

Query: 710 DPIVLHGNMLRVGWG 724
                 G  LR GWG
Sbjct: 405 --FPFQGRNLRTGWG 417

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 654 TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---TFIEAPSAVQFYANSFI 709
           T YIGNI   +   D+  + +  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 342 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 398

Query: 710 DPIVLHGNMLRVGWG 724
                 G  LR GWG
Sbjct: 399 --FPFQGRNLRTGWG 411

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 85/213 (39%), Gaps = 39/213 (18%)

Query: 654 TIYIGNINPRSKAEDICNV-VRGGILQSIKYIPEKKI-------CFVTFIEAPSAVQFYA 705
           T+Y+GNI+P+   E++  + V+   + +I+Y P+ K+        FV F   P   Q+  
Sbjct: 11  TVYVGNIDPKVTKENLYELFVQVSPIANIRY-PKDKVLQLHQGFAFVEFY-TPEDCQYVV 68

Query: 706 NSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQY 765
               + + L+   L+V   +        I   VTI     V+V                 
Sbjct: 69  QLLNNTVQLYDRFLKVRKANVQSSGSDTID--VTIQPIAKVFV----------------- 109

Query: 766 KKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSH--CCWINFMNISSAISLVEEMNKES 823
           K L  ++  P   +L   F       +I YLSD    C +I F N   +   +  +N + 
Sbjct: 110 KNLDPSIDEPHLSRLFGKFGPLAKGPEIFYLSDGQLRCAYIYFKNYDHSDLALATLNGQL 169

Query: 824 TVQNESGEVTLKRATEEKFGGRYKGLLINYGKD 856
            V   + +VT+  A +E   G  K     YG+D
Sbjct: 170 VV---NKKVTVDYAFKENGKGNAK-----YGED 194

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 35.8 bits (81), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 13/111 (11%)

Query: 618 QMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRG-G 676
           Q  Q  L   +T +L  N N+       +GS+  N TI++G ++     +++  + R  G
Sbjct: 277 QTAQLALSTVVTGNLRSNGNIR----QGLGSNSKNSTIFVGGLSTDVSEQELNELFRPFG 332

Query: 677 ILQSIKYIPEKKICFVTF---IEAPSAVQFYANSFIDPIVLHGNMLRVGWG 724
            +  +K    KK  FVTF   I+A +A++      +   ++ G  +R+ WG
Sbjct: 333 EIMDVKIPLGKKCGFVTFKRRIDAKAAIK-----GLHGFLVRGCPIRLSWG 378

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score = 35.8 bits (81), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 654 TIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFV---TFIEAPSAVQFYANSFI 709
           T YIGNI   +   D+  + +  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 342 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 398

Query: 710 DPIVLHGNMLRVGWG 724
                 G  LR GWG
Sbjct: 399 --FPFQGRNLRTGWG 411

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 763 PQYKKLH---ETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVE 817
           P+ ++LH   + L   D + LR+DF  +G+I +I+  +S   C  ++F ++ SAI+ +E
Sbjct: 330 PRSRQLHSNRQNLCSFDYKDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALE 388

>Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {ON}
           YOR242C (SSP2) - involved in sporulation [contig 67]
           FULL
          Length = 426

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 16/82 (19%)

Query: 776 DAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTL 834
           D + LR+DF  +G+I +I+  +S   C  + F ++SS+I  +E   K ++  N       
Sbjct: 349 DIKDLRQDFENFGNIVEISPMISRKLCLCVTFYDVSSSIGALESFEKPNSYLN------- 401

Query: 835 KRATEEKFGGRYKGLLINYGKD 856
                +K+G  +    I YG+D
Sbjct: 402 -----KKYGRDWS---IAYGRD 415

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 5/67 (7%)

Query: 653 RTIYIGNINPRSKAEDICNV-VRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDP 711
           RT+Y+GNI+PR   ED+  + V+ G ++ I Y P  K+      +  + ++F  +S +D 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINY-PRDKVLDTH--QGYAFIEFLNDSTVDY 63

Query: 712 IV-LHGN 717
           ++ L GN
Sbjct: 64  VLKLFGN 70

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 68/161 (42%), Gaps = 12/161 (7%)

Query: 669 ICNVVRGGILQSI-----KYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 723
           + N V+GG L+ I     K   + K   + F+    A  F          ++G  LR  W
Sbjct: 183 VLNQVQGGALKHITPQYKKETNQLKSVELEFLCPEDAQHFMEYGRHAVFQINGVHLRPRW 242

Query: 724 GHYSGPLPKLISLAVTIGASRNVYV-SLPEFAFKEKFIHDPQYKKLH-----ETLSLPDA 777
           G  S       SL        N+Y  S      K++   +P++   H       +   + 
Sbjct: 243 GIQSLSENFEASLNANQRDRLNLYAPSSRCLLLKKQGSKNPKHSTCHYPSPRSHICDLNV 302

Query: 778 EQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVE 817
           ++L++DFS +G+I  I+  +S   C  INF +I SA+  ++
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQ 343

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 9/79 (11%)

Query: 649 DIGNRTIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFVTF---IEAPSAVQFY 704
           D  N T+++GN+N +   +++  V    G ++ +K  P KK  FV F   I+A +++   
Sbjct: 318 DPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGL 377

Query: 705 ANSFIDPIVLHGNMLRVGW 723
              F+      G+ +R+ W
Sbjct: 378 QGYFV-----AGSPIRISW 391

>TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON}
           Anc_8.797 YOR319W
          Length = 220

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 10/84 (11%)

Query: 652 NRTIYIGNINPRSKAEDICNV-VRGGILQSIKYIPEKKI-------CFVTFIEAPSAVQF 703
           N+T+Y+GNI+P+   + +  + V+   + SIKY P+ K+        F+ F      VQ+
Sbjct: 11  NKTVYVGNIDPQVTLDILYELFVQVAPISSIKY-PKDKVLQAYQGYAFIDFF-TEDDVQY 68

Query: 704 YANSFIDPIVLHGNMLRVGWGHYS 727
                 + + L+G +L+V   +Y+
Sbjct: 69  VIKVMNNTVRLYGKLLKVRLSNYA 92

>Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ACR135C
          Length = 375

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 27/168 (16%)

Query: 669 ICNVVRGGILQSI--KYIPEK---KICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 723
           + N V+GG L+ I  +Y  E    K   + F+    A  F          ++G  LR  W
Sbjct: 183 VLNQVQGGPLKHIAPQYRKESNQLKSVELEFLSPEDAQHFMEYGRHAVFQINGVHLRPKW 242

Query: 724 GHYSGPLPKLISLAVTIGASRNVY-----VSLPE---FAFKEKFIHDPQYKKLH-----E 770
           G        + SL+    AS N +     V  P       K++   +P++   H      
Sbjct: 243 G--------IQSLSENFEASLNTHKDSLNVYTPSSRCLLLKKQGSRNPKHSTCHYPSPRS 294

Query: 771 TLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVE 817
            +   + + L+ DF  +GDI  I+  +S   C  INF +I +A+  ++
Sbjct: 295 HICDLNIQDLKNDFGQFGDILDISPMISRKLCVQINFFDIKTAVDALQ 342

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 91/226 (40%), Gaps = 49/226 (21%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSI---KY-IPEKKICFVT--FIEAPSAVQFYAN 706
           R++ I +I   +    + + VRGG L+ I   +Y  PE+ +  V   F+    A  F   
Sbjct: 163 RSVSINDIPRGTGIASVLSQVRGGSLERIVVYRYDTPERSLHKVDLFFLNYDGAQSFMKY 222

Query: 707 SFIDPIVLHGNMLRVGW----GHYSGPLP-----------KLISLAVTIGASRNVYVSLP 751
           +  +   ++G  LR  W      Y   +            KLIS  + +  S +  +   
Sbjct: 223 ATTNIFKVNGTHLRPEWIFLESTYENIMKEQSVNRILDEEKLISRCLIVKKSSSKTI--- 279

Query: 752 EFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNIS 810
                   ++ P   K  ++L   D ++L +DF  +G++ +I   +S   C  I F +IS
Sbjct: 280 --------VNKPSQDK-SQSLENIDIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDIS 330

Query: 811 SAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKD 856
           SA+  +EE  ++ +                 +   +K   I YGKD
Sbjct: 331 SAMRAMEEYEQKGSYL---------------YNKYFKTWTIWYGKD 361

>Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON}
           YDL209C (REAL)
          Length = 343

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 12/77 (15%)

Query: 779 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRAT 838
           ++R  FS  GDI++I Y+ D +C ++ F   ++A     E  KES         TL   +
Sbjct: 159 RIRFVFSRLGDIDRIRYVEDKNCAFVKFKYQANA-----EFAKESMSNQ-----TLLLPS 208

Query: 839 EEKFGGRYK--GLLINY 853
           ++++ GR +  GLL+ +
Sbjct: 209 DKEWDGRREGTGLLVKW 225

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 779 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEM---------NKESTVQNES 829
           ++R  FS  GDI++I Y+ D  C ++ F + +SA    E M         +KE   + E 
Sbjct: 159 RVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASAEFAKEAMSNQTLLLHSDKEWDDRKEG 218

Query: 830 GEVTLKRATEE 840
             + +K A E+
Sbjct: 219 TGLLVKWANED 229

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 73/176 (41%), Gaps = 11/176 (6%)

Query: 653 RTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICF----VTFIEAPSAVQFYANSF 708
           + I +GNI  R+    I   +  G L++I    + +       + F+   +A  F     
Sbjct: 183 KAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDEQALKKIELDFLTHEAAYSFMKYGR 242

Query: 709 IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768
            +   ++G  L   WG  S    K  +      +S +          K K+I+  +  K 
Sbjct: 243 TNMFKINGQHLTPEWGKSSEHKTKKGNEWDDQQSSSDDQDFCRSLIMK-KYINCTKRTKY 301

Query: 769 HET-----LSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEE 818
            E      L   +  ++++DF T+G+I +I   +S   C  INF N+ SA+  ++E
Sbjct: 302 SEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKAMKE 357

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 770 ETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNKEST 824
           +TL   D ++L +DF  +G++ +I   +S   C  I F +ISSA+  +EE  ++ +
Sbjct: 290 QTLENIDIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGS 345

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 43/84 (51%), Gaps = 9/84 (10%)

Query: 645 SMGSDIGNRTIYIGNINPRSKAEDICNVVRG-GILQSIKYIPEKKICFVTF---IEAPSA 700
           +M + + + T+++G +NP      +  + +  G +  +K  P K+  FV +   +EA +A
Sbjct: 437 AMNAGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAA 496

Query: 701 VQFYANSFIDPIVLHGNMLRVGWG 724
           +     + +   ++ G+ +R+ WG
Sbjct: 497 I-----NGLQGFIIMGSPIRLSWG 515

>SAKL0F15070g Chr6 (1213643..1215403) [1761 bp, 586 aa] {ON} similar
           to uniprot|P27614 Saccharomyces cerevisiae YJL172W CPS1
           Vacuolar carboxypeptidase yscS expression is induced
           under low-nitrogen conditions
          Length = 586

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 48/85 (56%), Gaps = 6/85 (7%)

Query: 356 EFKSPVEKSDLFKKKLQFLDRSKNKR--YIL---ESIDLVNTDVPSNQFPENYAVLTFLN 410
           +F   ++ +D   + +++L  +  K+  Y+L   ++ID+++  + +N  PE  A LT   
Sbjct: 360 DFLHAMDDADANDRVIKYLIETGGKKTEYLLRTTQAIDIIHGGIKANALPETVAFLTDSR 419

Query: 411 ISMAIEVLDYLKKY-SKNLGISKCF 434
           IS+   + + L+K+ +K L ISK +
Sbjct: 420 ISIESSIDETLQKFLNKTLDISKKY 444

>Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 16/82 (19%)

Query: 776 DAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTL 834
           D ++L +DF  +G++ +I   +S   C  I F +ISSA+  +EE  ++ +  N       
Sbjct: 296 DIQELEKDFRNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYGQKGSYINTK----- 350

Query: 835 KRATEEKFGGRYKGLLINYGKD 856
                      +K   I YGKD
Sbjct: 351 ----------YFKAWTIWYGKD 362

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
           Anc_4.344 YML076C
          Length = 894

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (47%), Gaps = 10/90 (11%)

Query: 605 QLIATPSPVSPNLQMNQRVLPNPITQSLEQNF-NVSAKVASSMGSDIGNRTIYIG----- 658
           +L  TPSPV P L  NQ VLP  I QSL   + N+    ++S        ++  G     
Sbjct: 136 KLQKTPSPVKPTLMTNQTVLPG-IHQSLSDLWGNIGQPTSNSEPHSYNTNSMNTGLPSEV 194

Query: 659 NI-NPRSKAEDIC--NVVRGGILQSIKYIP 685
           NI NP S   +I     +R G LQ++  +P
Sbjct: 195 NIENPSSINSNILMNEALREGALQTLNNVP 224

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 90/219 (41%), Gaps = 29/219 (13%)

Query: 650 IGNRTIYIGNINPRSKAEDICNVVRGGILQSI---KY-IPEKKICFVT--FIEAPSAVQF 703
           +  R++ I +I   +    + + VRGG L+ I   +Y  PE+ +  V   F+    A  F
Sbjct: 161 LKTRSVSISDIPRGTGIASVLSQVRGGSLERIIVYRYDTPERSLHKVDLFFLNYDGAQSF 220

Query: 704 --YANSFIDPIVLHGNMLRVGWGHYSGPLPKLI---SLAVTIGASRNVYVSLPEFAFKEK 758
             YAN+ +    ++G  L+  W         +I   S+   +   + +   L       K
Sbjct: 221 MRYANTSV--FKVNGVRLKPEWIFLESTYENVIKEQSVNRIVEEEKLISRCLIVKKSSTK 278

Query: 759 FIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVE 817
            + +   +   + L   +  +L +DF  +G+I +I   +S   C  I F +ISSA+  +E
Sbjct: 279 TVFNKSNQDRSQNLETINVRELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAME 338

Query: 818 EMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKD 856
           E  ++ +  N                  +K   I YGKD
Sbjct: 339 EYEQKGSGLNNK---------------YFKTWTIWYGKD 362

>NDAI0C05650 Chr3 (1305925..1307214) [1290 bp, 429 aa] {ON}
           Anc_8.566
          Length = 429

 Score = 32.3 bits (72), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 13/52 (25%)

Query: 1   MSNSNSKKPVANYAYR-------------QQQDYNGMNAMVGNPMMYHPVDF 39
           M NS S++  +N AY              Q + Y G +   GNP++YHPV+ 
Sbjct: 79  MKNSTSRESPSNIAYHAYTNNLNMPINSFQPRRYEGQDGFYGNPVIYHPVNI 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,999,079
Number of extensions: 5138790
Number of successful extensions: 14937
Number of sequences better than 10.0: 112
Number of HSP's gapped: 15291
Number of HSP's successfully gapped: 183
Length of query: 1134
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1013
Effective length of database: 39,606,813
Effective search space: 40121701569
Effective search space used: 40121701569
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)