Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YML116W (ATR1)8.843ON54254226930.0
Smik_13.188.843ON54554123730.0
Suva_13.278.843ON55352622300.0
Skud_13.258.843ON53753921990.0
NDAI0E002808.843ON54952017550.0
CAGL0B02343g8.843ON53748817340.0
NCAS0B002908.843ON54250216640.0
SAKL0D01386g8.843ON52151316580.0
KNAG0G034308.843ON54251316390.0
KNAG0J002608.843ON55051316150.0
Suva_13.4678.843ON54351415960.0
NCAS0A02540singletonON53952215930.0
Kpol_541.168.843ON52852415730.0
CAGL0M03003g8.843ON55853215680.0
NCAS0C004008.843ON51751415590.0
KAFR0B03930singletonON55553815570.0
TDEL0B005508.843ON53753215440.0
Kwal_27.102458.843ON51551615400.0
YMR279C8.843ON54050415400.0
KLTH0C03806g8.843ON52551615310.0
Skud_13.4518.843ON53949615260.0
NDAI0K004008.843ON55353115200.0
Smik_13.4928.843ON54352615180.0
KAFR0B039408.843ON54753414770.0
TBLA0D032708.843ON55051514720.0
TBLA0D03280singletonON58051814460.0
TPHA0C047908.843ON55648214270.0
KAFR0A028408.843ON52051014130.0
TBLA0C01160singletonON60052511511e-151
Smik_15.560na 1ON5165228651e-109
Suva_8.435na 1ON5155238371e-105
Skud_15.545na 1ON5165228341e-105
YOR378Wna 1ON5155198241e-103
KLTH0C10560gna 1ON5154978131e-101
Kwal_23.6547na 1ON5115057912e-98
TDEL0G04950singletonON5125047353e-90
KLLA0B00352gna 1ON4984567301e-89
KNAG0D00130na 1ON5655145413e-61
SAKL0C06116gsingletonON1851904591e-53
KAFR0C04860na 1ON5345284169e-44
CAGL0L02519gna 1ON5294264097e-43
NCAS0A05720na 1ON5635033791e-38
NDAI0K02730singletonON6045613333e-32
KLLA0C18931gna 2ON5531491242e-06
Suva_13.2652.473ON5611301232e-06
SAKL0F00440gsingletonON5441221224e-06
Smik_13.2722.473ON5611301207e-06
Skud_13.2442.473ON5621181198e-06
YMR088C (VBA1)2.473ON5621181162e-05
Kwal_34.15746na 2ON5181261152e-05
KAFR0J009302.242ON5662391144e-05
NDAI0D010202.242ON5922991126e-05
KLTH0H16214gsingletonON5511461118e-05
NCAS0G029902.242ON5811721109e-05
NCAS0A078102.473ON5682051082e-04
Skud_6.16na 3ON5495111053e-04
SAKL0E02992g2.473ON5701461054e-04
SAKL0H09328g8.570ON5962401046e-04
YNL065W (AQR1)2.242ON5862591036e-04
Skud_14.2672.242ON5622591036e-04
NDAI0H022002.473ON5711361036e-04
KLLA0F13684g2.473ON5711381037e-04
TDEL0A024902.473ON554791000.001
Smik_6.24na 3ON5444841000.001
Ecym_73992.473ON5631311000.001
Suva_14.2762.242ON5622591000.002
TDEL0D06610singletonON49791990.002
Suva_10.11singletonON540479980.002
CAGL0J01375g2.473ON564147980.003
SAKL0E08756g2.242ON565144970.004
AGR076C8.272ON68669960.005
NCAS0C03460na 4ON630246960.005
ZYRO0C01430g8.272ON59075910.017
TDEL0F039908.272ON631106910.017
ABL040W2.473ON56778910.018
KLTH0D16962gsingletonON571143910.020
KLLA0F03311g2.242ON542110900.021
KLLA0A04631g8.272ON579113900.022
Smik_14.2622.242ON561252890.028
SAKL0A08228gsingletonON569146890.031
YKR105C (VBA5)singletonON582145890.035
Kpol_467.242.473ON370114870.052
Kwal_23.48242.242ON553247870.056
YPR198W (SGE1)singletonON543186870.062
KLTH0C10120gsingletonON651135860.085
ZYRO0G03234g2.473ON56279850.095
KNAG0E025602.473ON578134840.11
KLTH0G09372g2.242ON551145840.12
SAKL0H16808g8.272ON65768840.13
SAKL0A00726gsingletonON598225830.15
KLLA0E24113g8.570ON575245830.16
TPHA0A017508.272ON636130830.19
KLTH0C10142gsingletonON573132820.20
Kpol_543.448.272ON64368820.21
NDAI0A02050singletonON617175820.22
Kwal_56.237548.272ON58987820.25
Smik_17.11singletonON544127810.27
ZYRO0E10230gsingletonON558264810.29
NDAI0B037702.242ON571250810.31
SAKL0C05588gsingletonON677149810.34
CAGL0G08624g2.242ON583253800.40
Skud_16.503singletonON543164800.40
TBLA0G025502.242ON613241800.42
Smik_8.1175.284ON514239790.49
ADL258W2.242ON534244790.51
TDEL0G03260singletonON612167790.57
ZYRO0D11462g5.483ON593133790.58
ACL172C3.245ON631135780.60
TPHA0C031002.241ON602249780.62
KLTH0G13464g8.272ON59369780.65
Ecym_42988.272ON67866770.91
TPHA0I017608.570ON653146761.1
TPHA0G031502.473ON600119761.1
TBLA0F030408.272ON90687761.3
Suva_13.174na 5ON541136751.3
Smik_3.206singletonON10953701.5
YOR306C (MCH5)8.783ON521185751.6
KLTH0D05434g2.473ON57684751.6
KLTH0G09504gna 6ON62429751.8
ZYRO0A00330gsingletonON576190741.8
Kpol_416.5singletonON60793741.8
KAFR0J004805.284ON500252742.0
KLTH0E03234gsingletonON521174742.1
KLLA0F17776gna 7ON553149742.1
KAFR0J016202.242ON570272732.3
Kpol_1003.112.241ON581135732.5
YGR224W (AZR1)na 4ON613145732.6
ZYRO0D12628g5.530ON567151732.7
ZYRO0G21648g6.155ON488135732.7
Suva_9.712.241ON561249723.1
Smik_16.81na 4ON625235723.1
Kpol_1048.458.570ON648147723.2
TBLA0E038002.242ON608230723.5
YMR011W (HXT2)na 5ON541136723.6
TDEL0C045902.242ON529143723.6
Suva_8.3588.783ON522137723.7
TBLA0B00840singletonON637116723.9
Kpol_358.4na 8ON61719714.4
Skud_13.163na 5ON547112714.6
Smik_13.171na 5ON541136714.7
KNAG0B049005.284ON516253714.9
SAKL0C02178gsingletonON565109715.0
Skud_15.4748.783ON522187705.9
KLTH0B00132gsingletonON568161706.4
Klac_YGOB_Anc_2.2412.241ON602190706.5
KLTH0B00594gsingletonON618127706.9
CAGL0B02079gna 4ON624151706.9
TPHA0M00120singletonON61922707.0
Kpol_416.6singletonON59793697.5
TBLA0B046406.155ON482143698.1
Kwal_14.854na 9ON570112698.5
Smik_6.22singletonON636108698.8
ZYRO0A01474g2.242ON538259698.9
YHR048W (YHK8)5.284ON514252689.8
TBLA0A01270singletonON522111689.9
TBLA0C01100na 10ON64955689.9
SAKL0D04510gna 11ON531177689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML116W
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...  1041   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   918   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   863   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   851   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      680   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   672   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      645   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   643   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   635   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   626   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   619   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   618   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   610   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   608   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      605   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   604   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   599   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   597   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   597   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   594   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   592   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               590   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   589   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   573   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   571   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   561   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   554   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   548   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   447   e-151
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   337   e-109
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   327   e-105
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   325   e-105
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   322   e-103
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   317   e-101
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   309   2e-98
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   287   3e-90
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   285   1e-89
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   213   3e-61
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   181   1e-53
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     164   9e-44
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   162   7e-43
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            150   1e-38
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   132   3e-32
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    52   2e-06
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    52   2e-06
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    52   4e-06
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    51   7e-06
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    50   8e-06
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    49   2e-05
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    49   2e-05
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    49   4e-05
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    48   6e-05
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    47   8e-05
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    47   9e-05
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    46   2e-04
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    45   3e-04
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    45   4e-04
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    45   6e-04
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    44   6e-04
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    44   6e-04
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    44   6e-04
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    44   7e-04
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    43   0.001
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    43   0.001
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    43   0.001
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    43   0.002
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    43   0.002
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    42   0.002
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    42   0.003
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    42   0.004
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    42   0.005
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    42   0.005
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    40   0.017
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    40   0.017
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    40   0.018
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    40   0.020
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    39   0.021
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.022
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    39   0.028
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    39   0.031
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    39   0.035
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    38   0.052
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    38   0.056
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    38   0.062
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    38   0.085
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    37   0.095
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    37   0.11 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    37   0.12 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    37   0.13 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    37   0.15 
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    37   0.16 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    37   0.19 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    36   0.20 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    36   0.21 
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    36   0.22 
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    36   0.25 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    36   0.27 
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    36   0.29 
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    36   0.31 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    36   0.34 
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    35   0.40 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    35   0.40 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    35   0.42 
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    35   0.49 
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    35   0.51 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               35   0.57 
ZYRO0D11462g Chr4 (965863..967644) [1782 bp, 593 aa] {ON} simila...    35   0.58 
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    35   0.60 
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    35   0.62 
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    35   0.65 
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    34   0.91 
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    34   1.1  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    34   1.1  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    34   1.3  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    33   1.3  
Smik_3.206 Chr3 complement(303825..304154) [330 bp, 109 aa] {ON}...    32   1.5  
YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON} ...    33   1.6  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    33   1.6  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    33   1.8  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    33   1.8  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    33   1.8  
KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.28...    33   2.0  
KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {...    33   2.1  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    33   2.1  
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    33   2.3  
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    33   2.5  
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    33   2.6  
ZYRO0D12628g Chr4 (1069722..1071425) [1704 bp, 567 aa] {ON} simi...    33   2.7  
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...    33   2.7  
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    32   3.1  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   3.1  
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    32   3.2  
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    32   3.5  
YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}  HXT2High-...    32   3.6  
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    32   3.6  
Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON...    32   3.7  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    32   3.9  
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    32   4.4  
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    32   4.6  
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...    32   4.7  
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               32   4.9  
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    32   5.0  
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    32   5.9  
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    32   6.4  
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    32   6.5  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    32   6.9  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    32   6.9  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                32   7.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    31   7.5  
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    31   8.1  
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    31   8.5  
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    31   8.8  
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    31   8.9  
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    31   9.8  
TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {O...    31   9.9  
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     31   9.9  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    31   9.9  

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 1041 bits (2693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/542 (95%), Positives = 515/542 (95%)

Query: 1   MGNQSLVVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPN 60
           MGNQSLVVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPN
Sbjct: 1   MGNQSLVVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPN 60

Query: 61  YFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGS 120
           YFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGS
Sbjct: 61  YFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGS 120

Query: 121 FILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLP 180
           FILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLP
Sbjct: 121 FILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLP 180

Query: 181 NVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIA 240
           NVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIA
Sbjct: 181 NVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIA 240

Query: 241 AFINFVLSIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXX 300
           AFINFVLSIYAIPSTIPTNIHHFSMDWIGS          NFVWNQAPISGWNQAY    
Sbjct: 241 AFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVI 300

Query: 301 XXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQL 360
                        YEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQL
Sbjct: 301 LIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQL 360

Query: 361 NIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPV 420
           NIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPV
Sbjct: 361 NIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPV 420

Query: 421 HETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGM 480
           HETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGM
Sbjct: 421 HETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGM 480

Query: 481 GATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYDCT 540
           GATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYDCT
Sbjct: 481 GATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYDCT 540

Query: 541 VA 542
           VA
Sbjct: 541 VA 542

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/541 (84%), Positives = 475/541 (87%), Gaps = 6/541 (1%)

Query: 5   SLVVLTESKG------EYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQN 58
           S+ VL ES+       E ENE   P KKSSRDN   E+L  TAFT  EDEMV+ NQKWQN
Sbjct: 2   SVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQN 61

Query: 59  PNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVS 118
           P YFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVS
Sbjct: 62  PKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVS 121

Query: 119 GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFV 178
           GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT YSGSDTFFII RAFQGLGIAFV
Sbjct: 122 GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFV 181

Query: 179 LPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYS 238
           LPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE+P QWPWAFYA+S
Sbjct: 182 LPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFS 241

Query: 239 IAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXX 298
           IA+ INF LSIYAIP+ IPTNIHHFSMDWIGS          NFVWNQAPISGW+QAY  
Sbjct: 242 IASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYII 301

Query: 299 XXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQF 358
                          YE+ FAK+PLLP AVIKD HMIQIMLALFFGWGSFGIFTFYYFQF
Sbjct: 302 VILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQF 361

Query: 359 QLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVT 418
           QLNIR YTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSV+LFFSMVAFNVGSIMASVT
Sbjct: 362 QLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVT 421

Query: 419 PVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCL 478
           PVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCL
Sbjct: 422 PVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCL 481

Query: 479 GMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYD 538
           GMGATVETQ++ DGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFI   +A+AA E D
Sbjct: 482 GMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEND 541

Query: 539 C 539
           C
Sbjct: 542 C 542

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/526 (79%), Positives = 454/526 (86%)

Query: 11  ESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYL 70
           E   E ENE  L  + SS  NN   +LT    T SEDE++ + QKWQNPNYFKY WQEYL
Sbjct: 22  EDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYL 81

Query: 71  FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGD 130
           FIFTCMISQLLNQ+GTTQTLSIMNIL+DSFGS+ NS+SWLMASFPLVSGSFILISGR+GD
Sbjct: 82  FIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGD 141

Query: 131 IYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIY 190
           I+GLK MLL+GYV++IIWSLICG+TKYSGSDTFFI+SRAFQGLGIAFVLPNVLGIIGN+Y
Sbjct: 142 IFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVY 201

Query: 191 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIY 250
           VGGTFRKNIVISF+GAMAPIGATLGC FAGLIGT +P QWPWAFYAY+I A IN +LSIY
Sbjct: 202 VGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIY 261

Query: 251 AIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXX 310
           AIP+ IPTN+H FSMDWIGS          N VWNQAPISGWNQAY              
Sbjct: 262 AIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVL 321

Query: 311 XXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWA 370
              YEI FAK+PLLP+AV+KDRHMIQIML+LFFGWGSFGIFTFYYFQFQLNIR YT LWA
Sbjct: 322 FGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWA 381

Query: 371 GGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLG 430
           GG+YFMFLIWGIIAALLVGF+IK VSPSVFLFF+MVAFNVGSIMASVTPVHETYFR Q+G
Sbjct: 382 GGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMG 441

Query: 431 TMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNS 490
           TMIILSFGMDLSFPASSIIFSD LPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE Q++ 
Sbjct: 442 TMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDP 501

Query: 491 DGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAE 536
           DGKH+LKGYRGAQYLGIGLASLAC+ISGLYMVE +IK  RA+A AE
Sbjct: 502 DGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAE 547

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/539 (77%), Positives = 454/539 (84%), Gaps = 5/539 (0%)

Query: 1   MGNQSLVVLTESKG---EYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQ 57
           M  +SLV   ES+    E ENE+   VKKSSR +  G   T T  T   +EM    Q+WQ
Sbjct: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHD--GNEETVTISTDHGEEMTVDKQRWQ 58

Query: 58  NPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 117
           NPNYFK +W EYLFIFTCMISQLLNQAGTTQTLSIMNI+++SFGS  NS++WLMASFPLV
Sbjct: 59  NPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLV 118

Query: 118 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAF 177
           SGSFILISGRLGDIYGLKKML +GYV++IIWSLICG+TKYSGSDTFFIISRAFQGLGIAF
Sbjct: 119 SGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAF 178

Query: 178 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAY 237
           VLPNVLGIIGNIYV GTFRKNIVIS VGAMAP+GATLGCLFAGLIGT++PKQWPWAFYAY
Sbjct: 179 VLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAY 238

Query: 238 SIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYX 297
           +I + IN  LS+Y+IP+ IPTNI HFSMDWIGS          NFVWNQAPISGW+QAY 
Sbjct: 239 TITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYI 298

Query: 298 XXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQ 357
                           YE RFAK+PLLPRAV+KDRHMIQIMLALFFGWGSFGIFTFYYFQ
Sbjct: 299 IVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQ 358

Query: 358 FQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASV 417
           FQLNIR Y+A+WAGGTYFMFLIWGIIAALLVG  IK VSPSVFLF SM+AFN+GSIMASV
Sbjct: 359 FQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASV 418

Query: 418 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 477
           TPVHETYFRTQLGTMIILSFGMD SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC
Sbjct: 419 TPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 478

Query: 478 LGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAE 536
           LGMGATVET V+ DGKH+LKGYRGAQYLGIGLASLAC+ISGLYMVE  IK  +A+A   
Sbjct: 479 LGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/520 (63%), Positives = 393/520 (75%), Gaps = 2/520 (0%)

Query: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMIS 78
           E E        +N + E    +  ++ ED  +  + KWQNP+YF+  WQEYLFIF+CM+S
Sbjct: 28  EEECSSITKEENNEVSEDELPS--SEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMS 85

Query: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKML 138
           QLLNQA T QTLSIMNI++DSF SEG  ++WL+ASFPLVSGSFILISGR+GDIYGLKK L
Sbjct: 86  QLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTL 145

Query: 139 LVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKN 198
           + GY+  IIWSLI G T YS +D FFIISRAFQGLGIAF+LPNV+GI+GNIY   T RKN
Sbjct: 146 IGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKN 205

Query: 199 IVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPT 258
           IVIS +GA APIGA +G LFAGLIGTE+PKQWPWAFYA++IA+ IN  +SIY+IP+ IPT
Sbjct: 206 IVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPT 265

Query: 259 NIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRF 318
           NIH F+MDWIGS          NFVWNQ PI GW +AY                 YEI++
Sbjct: 266 NIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKY 325

Query: 319 AKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFL 378
           AK+P+LP  V K+RH+I I+ ALF GWGSFGIF+FYYF F LN+R Y+ALWAG TYFMF 
Sbjct: 326 AKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFA 385

Query: 379 IWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFG 438
           IWG +AA++VG  IK +S SV LFFSM+AFN+G IM SVTPV +TYFR  LGTMIILSFG
Sbjct: 386 IWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFG 445

Query: 439 MDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKG 498
           MD+SFPA++II SD L M+YQGMAGSL NT+VNYSMSLCLGMG TVE Q+N  GK +LKG
Sbjct: 446 MDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKG 505

Query: 499 YRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYD 538
           YR A+YLG+GLA L  +ISG+YM E     R+ R ++  D
Sbjct: 506 YRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRD 545

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 382/488 (78%), Gaps = 1/488 (0%)

Query: 44  QSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSE 103
           Q + + +D NQKWQNP YF    +EYLF+ +C +SQLLNQAG  QT  IMNI++DS  S+
Sbjct: 38  QCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQ 97

Query: 104 GNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTF 163
              ++WLMA+FPL+SGSFILISGR+GDIYGLKK LLVGY+ +I+WSLICG+TKY+ SD+F
Sbjct: 98  NGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSF 157

Query: 164 FIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIG 223
           FI+SRAFQGLGI+ +LPN+LGI+G+IY+ G+ RKN+VIS +G MAPIGATLG +F+GLIG
Sbjct: 158 FIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIG 217

Query: 224 TEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFV 283
           TED  QWPWAFY+Y+I A INFVLSI+ IP+TIPTN+H   MDWIGS          NFV
Sbjct: 218 TEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFV 277

Query: 284 WNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAK-TPLLPRAVIKDRHMIQIMLALF 342
           WNQAPI GW+ AY                 YE+ F    PLLP+ V+K    I ++ ALF
Sbjct: 278 WNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALF 337

Query: 343 FGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLF 402
           FGWGSFGIF+FYYF FQLN+R YT LWAGGTYFMFLIWGI+AAL+VGFTIK V PS+ LF
Sbjct: 338 FGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILF 397

Query: 403 FSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMA 462
            SMVAFN GSI+ SVTP+H+TYFR  LG MIILSFGMDLSFPASSI+ SD LP++YQGMA
Sbjct: 398 LSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMA 457

Query: 463 GSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMV 522
           GSLVNT+VNYSMS CLG+   VE  VN+ GK +LKGYRGA YLGIGLAS+AC+ISG  M+
Sbjct: 458 GSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALML 517

Query: 523 ESFIKGRR 530
              I+GR+
Sbjct: 518 SEIIQGRK 525

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/502 (63%), Positives = 383/502 (76%), Gaps = 1/502 (0%)

Query: 35  ESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMN 94
           E +     +Q+E   ++ + KWQNP+YF+  WQEYLFIF+CM+SQLLNQA T QTLSIMN
Sbjct: 36  EEIEKDVISQTETPQLE-HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMN 94

Query: 95  ILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGI 154
           I++DSF SEG  ++WL+ASFPLVSGSFILISGR+GDIYGLKK L+ GY+  IIWS+I G+
Sbjct: 95  IITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGL 154

Query: 155 TKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATL 214
           TKYS SDTFFI+SRAFQGL IAF+LPNV+GI+GNIY   + RKNIVIS +GA APIGA  
Sbjct: 155 TKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFF 214

Query: 215 GCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSXXXX 274
           G LFAGLIGTEDP QWPWAFYA++IA+  N  +SIY+IP+++PTN+H F+MDWIGS    
Sbjct: 215 GSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAV 274

Query: 275 XXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHM 334
                 NFVWNQ PI GW  AY                 YE+++A++PLLP  V K+RH+
Sbjct: 275 IGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHI 334

Query: 335 IQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKN 394
           I I+ ALF GWGSFGIF+FYYF F LN+R Y+ALWAG TYFMF IWG +AA++VG  IK 
Sbjct: 335 IMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKK 394

Query: 395 VSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNL 454
           +S +  LF SMVAFN+G IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II SD L
Sbjct: 395 ISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGL 454

Query: 455 PMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLAC 514
            M+YQGMAGSL NT+VNYSMSLCLGMG TVE Q+N  G  LLKGYRGA+YLGIGLA L  
Sbjct: 455 TMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGI 514

Query: 515 MISGLYMVESFIKGRRARAAAE 536
           +I+ +Y+ E     R+   AA 
Sbjct: 515 IITAIYLGEILWGKRKQHLAAN 536

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/513 (62%), Positives = 388/513 (75%), Gaps = 6/513 (1%)

Query: 27  SSRDNNIGESLTATAFTQSEDEMVDSNQKW---QNPNYFKYAWQEYLFIFTCMISQLLNQ 83
           SS+   +G   +ATAFT+  D  VD ++KW   Q+P YF   W+EYLFIF  M+SQLLNQ
Sbjct: 11  SSQSKELGTQ-SATAFTEHSDVQVD-DKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQ 68

Query: 84  AGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYV 143
           AGTTQTLS++NILS +F S  + ++WLMASFPLVSGSFIL+SG++GDIYGLKK LLVGYV
Sbjct: 69  AGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYV 128

Query: 144 LVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISF 203
           + IIWSLICG+T Y+ S  FFIISRAFQGLGIAF+LPN++GI+GNIYV GT RKN+VIS 
Sbjct: 129 VTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISL 188

Query: 204 VGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHF 263
           +GA APIGAT+G LF+GLIGT   ++W W FYAY+I A IN  LSI+ IP+TIPTN+   
Sbjct: 189 IGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGS 247

Query: 264 SMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPL 323
           SMDWIGS          NFVWNQ PI GW+ AY                 YE ++A  PL
Sbjct: 248 SMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPL 307

Query: 324 LPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGII 383
           +PR  + +  ++  +LA+FFGWGSFGI+TFYYF F LN+R+YT LWAGG+YFMFLIWGII
Sbjct: 308 IPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGII 367

Query: 384 AALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSF 443
           AA+ VG+TIK + PS+ LF SM+AF+ G IM SVTPV +TYFR  LG MIILSFGMDLSF
Sbjct: 368 AAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSF 427

Query: 444 PASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQ 503
           PASSII SD LPME QGMAGSLV+T++NYSMS+CLG+  TVE Q+N +G  LLKGYR A 
Sbjct: 428 PASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAAL 487

Query: 504 YLGIGLASLACMISGLYMVESFIKGRRARAAAE 536
           YLGIGLASL   IS L+M+E++++ RR     E
Sbjct: 488 YLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/513 (58%), Positives = 385/513 (75%)

Query: 30  DNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQT 89
           +N   + L +   T +     D N KWQ+  YF+  WQEY+F+ TCM+SQLLNQA   QT
Sbjct: 30  ENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQT 89

Query: 90  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 149
           LS+MNIL+ SF S   +++WLMASFPLVSGSFILISGR+GDIYGLK  L+ G +  IIW+
Sbjct: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149

Query: 150 LICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 209
           LI G T Y+ SDTFFI+SR+FQGLG+AF+LPNV+G +GNIY   TFRKNIVIS +GA AP
Sbjct: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209

Query: 210 IGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIG 269
           +GA +G  FAGLIGT++P  WPW+FYA +IA+ +  + ++Y+IP+ IPTN+H FSMDWIG
Sbjct: 210 VGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIG 269

Query: 270 SXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVI 329
           S          NFVWNQ PI GW +AY                 YE+ +A +PLLPR + 
Sbjct: 270 SGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVIT 329

Query: 330 KDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVG 389
           ++RHM+ I++ALF GWGSFGIF+FYYF F LN+R Y+ +WAGGTYFMF IWG++A+++VG
Sbjct: 330 QNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389

Query: 390 FTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 449
            +I+ +S S+ LFFSM+AF+VG IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II
Sbjct: 390 LSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAII 449

Query: 450 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGL 509
            SD+LP +YQGMAGSL NT+VNYSMSLCLGMG+TVE+Q+N +GK LLKGYR A+YLGIG+
Sbjct: 450 LSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGI 509

Query: 510 ASLACMISGLYMVESFIKGRRARAAAEYDCTVA 542
           ASLA ++S +YM E     R+ R  +  +  ++
Sbjct: 510 ASLAVILSLIYMCERLWIDRKERMESTSETNLS 542

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/513 (59%), Positives = 370/513 (72%), Gaps = 7/513 (1%)

Query: 11  ESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYL 70
           E++    ++T +  KK+    +  E         SE E  D++  WQNP YF   WQEY 
Sbjct: 24  EAEYTKNDQTNVEEKKNCSTESEAEWC-------SESEFTDNDTPWQNPTYFANRWQEYA 76

Query: 71  FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGD 130
           FI TCM++QLLNQAG  Q  + MNIL+D+F S    ++WLMASFPLVSGSFIL+SGR+GD
Sbjct: 77  FISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGD 136

Query: 131 IYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIY 190
           IYGLKK L+ GY++V+IWSLICG   Y+ +D FFI+ RAFQGLGIAF+LPNV+G+IGNIY
Sbjct: 137 IYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIY 196

Query: 191 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIY 250
              T RKN VISFVG  APIGA LG +++GLI  E+PKQWPW FYAY+I   IN V++IY
Sbjct: 197 KANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIY 256

Query: 251 AIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXX 310
           +IPST+PTNIH F MDW GS          NFVWNQ PI GWN+ Y              
Sbjct: 257 SIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIA 316

Query: 311 XXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWA 370
              YEI+FAK+PLLP  VIK+RH+  I+LA+F GWGSFGI+TFYY+ FQLN+R Y+A+WA
Sbjct: 317 FFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWA 376

Query: 371 GGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLG 430
           GGT+FMF+IWG IAA LV  TIK V PSV L FSM  F VG IM SVTPVH++Y++  LG
Sbjct: 377 GGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLG 436

Query: 431 TMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNS 490
             IILSFGMDLSFPASSII SD LP +YQGMAGSLVNT+VNYS SLCLG+G+T E QVN 
Sbjct: 437 MQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNK 496

Query: 491 DGKHLLKGYRGAQYLGIGLASLACMISGLYMVE 523
           +G   LKGYR A Y+GIGL +   +++  Y+ E
Sbjct: 497 NGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/514 (58%), Positives = 379/514 (73%), Gaps = 5/514 (0%)

Query: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMIS 78
           + E  V  SS D ++      T  + ++   V ++  WQ+P YF    +E +FI TCM++
Sbjct: 25  KAEDKVVVSSEDEDV-----TTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLA 79

Query: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKML 138
           QLLNQAG T  L+IMN+LS SF SE + ++WLMASFPLV+GSFILISGRLGDIYGLKKML
Sbjct: 80  QLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKML 139

Query: 139 LVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKN 198
           ++GYV +I+WSLICG++KYS +D FFI  RAFQGLGIAF+LPNV+G++G++Y  G+ RKN
Sbjct: 140 MIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKN 199

Query: 199 IVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPT 258
           +VISF+GA AP G   G LF GLI  ED +QWPW FYA++IA F+N +L+ Y+IP+ IPT
Sbjct: 200 LVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPT 259

Query: 259 NIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRF 318
           N+H FSMDW GS          NFVWNQAP +GW  AY                 YE+++
Sbjct: 260 NVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKY 319

Query: 319 AKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFL 378
           AK PLLP AV K+RHMI I+LA+F GWGSFGI+TFYY  FQLN+R Y+ +W GGTYF+F+
Sbjct: 320 AKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFV 379

Query: 379 IWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFG 438
           I+G IAA +V  +IK V P+  L F++VAF+VGSIM SV PV +++++   G   IL FG
Sbjct: 380 IFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFG 439

Query: 439 MDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKG 498
           MDLSFPASSII SD LPMEYQGMAGSLVNTV+NYS SLCLGMGATVE Q+N +GK LLKG
Sbjct: 440 MDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKG 499

Query: 499 YRGAQYLGIGLASLACMISGLYMVESFIKGRRAR 532
           YRGA YLG+GLASL  +IS  YM+E+F   RR R
Sbjct: 500 YRGAIYLGVGLASLGVLISFTYMLETFWNNRRDR 533

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/522 (54%), Positives = 377/522 (72%), Gaps = 1/522 (0%)

Query: 13  KGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFI 72
           + + +N +   V   + D NI  +     ++ S D ++D +  WQNPNYF   ++EY FI
Sbjct: 8   QTDSDNFSSSTVSFPNEDKNISHN-EKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFI 66

Query: 73  FTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIY 132
           FTCM++ LLNQAG TQ LS MN++S+SF S+   ++WLMASFPLVSGSFILISGR+GDIY
Sbjct: 67  FTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIY 126

Query: 133 GLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVG 192
           GLKK ++ GY+ +IIWSL+CG   ++ +DTFFI+ RAFQGLGI+F+LPNV+G+IGNIY  
Sbjct: 127 GLKKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKV 186

Query: 193 GTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAI 252
           GT RKNIVIS +G  AP GA +G L+ GLI TE+ KQWPW FYAY++   +N ++++Y++
Sbjct: 187 GTLRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSV 246

Query: 253 PSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXX 312
           P+ IPTN+H+F+MDWIGS          NFVWNQ P++GW++AY                
Sbjct: 247 PNCIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFV 306

Query: 313 XYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGG 372
            YE+++  +PLLP  V K+  ++ I+  LF GWG+FGI+TFYYF FQLN+R Y+ +W GG
Sbjct: 307 VYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGG 366

Query: 373 TYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTM 432
           TYFMF+IWG IAAL+V FTIK V P++ LFFS + F +GS+M SVTP+H+ Y+R  LG  
Sbjct: 367 TYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQ 426

Query: 433 IILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDG 492
           IIL FGMDLSFPASSII SD+LPM+YQGMAGSLVNTV+NY+ SLCLGMG TVE Q+N  G
Sbjct: 427 IILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSG 486

Query: 493 KHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAA 534
           + LLKGYR A YL +GL  L   I+ + +  +    RR R A
Sbjct: 487 EDLLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDRLA 528

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/524 (58%), Positives = 375/524 (71%), Gaps = 5/524 (0%)

Query: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDE---MVDSNQKWQNPNYFKYAWQEYLFIFTC 75
           +T+L  K     + I E    +  + + DE   M   N   +NP+YF    QEY FIF+C
Sbjct: 2   DTDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSC 61

Query: 76  MISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLK 135
           M+SQLLN AGTTQTLSIMN+L+    S  + K WL+ASFPLVSGSFIL+SGRLGDIYGLK
Sbjct: 62  MLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLK 121

Query: 136 KMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTF 195
           KML++GYV+++IWSLI G++ YS S  FFII+RAFQGLGI+ VLPNVLG+IG IY  GT 
Sbjct: 122 KMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTL 181

Query: 196 RKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST 255
           +KN+VIS VGAM+PIGATLG LF+GL+ TE    WPWAFYAY++AAFIN  +S Y+IP+ 
Sbjct: 182 KKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNN 241

Query: 256 IPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYE 315
           IPTN++  SMDWIGS          NFVWNQAP  GWN AY                 YE
Sbjct: 242 IPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYE 301

Query: 316 IRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYF 375
           +R+A+ PLLP  +I++R +I I+ A+ FGWGSFGI+TFYYF F LN+R Y+ LWAGG+YF
Sbjct: 302 LRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYF 361

Query: 376 MFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIIL 435
           +F+I G I A+  GF +K + P+V L FSMV FN+G I+ SVTPVH+TYFR  LGTMIIL
Sbjct: 362 IFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIIL 421

Query: 436 SFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHL 495
             GMDLSFPASSII SDNLP ++QGMAGSLVNTV+NYS SL LG+  TVE   N +G  L
Sbjct: 422 PLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDL 481

Query: 496 LKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYDC 539
           L+GYRGA Y GI  + +A +I+GLYMVE+     + R   E DC
Sbjct: 482 LRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR--KEKDC 523

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/532 (56%), Positives = 391/532 (73%), Gaps = 2/532 (0%)

Query: 8   VLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQ 67
           V+T+S   ++   E       + N+   S+T+     S D+  +++  +QNP YF+  ++
Sbjct: 26  VVTKSIA-FDGCEECSSSDECQSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFK 84

Query: 68  EYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGR 127
           E +FI +CM++QLLNQAG TQ+LS MN+L+D F S  + + WLMASFPLVSGSFILISGR
Sbjct: 85  EVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGR 144

Query: 128 LGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 187
           LGDIYGLKK L VGY+++ +WS+ICG+ KY+ SD FFI+ R+FQGLGIAF+LPN++G++G
Sbjct: 145 LGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVG 204

Query: 188 NIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVL 247
           NIY  GT RKNIVIS +G MAP GA LG LF GLI TED +QWPW FYA+ IA+F+N +L
Sbjct: 205 NIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLL 264

Query: 248 SIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXX 307
           ++Y+IP+ +PTN+++ +MDWIGS          N VWNQAPI GW +AY           
Sbjct: 265 ALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIIL 324

Query: 308 XXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTA 367
                 YEI++A +PLLP +V++++ ++ I+ ALFFGWGSFGI+T+YY+ FQLN+R+YT 
Sbjct: 325 LLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTP 384

Query: 368 LWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRT 427
           LWAGGT+FMF+IWG +AA +V  TIK V P+V L FSMVAF+ GSIM SVTPVH+TY+R 
Sbjct: 385 LWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRM 444

Query: 428 QLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQ 487
            +G  IILSFGMDLSFPASSII SD LPM+YQGMAGSLVNTVVNYS SLCLGMG TVE Q
Sbjct: 445 NVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQ 504

Query: 488 VNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYDC 539
            N+ G  LLKGYR A YL IGLAS    +S +++V   I  +R R   E +C
Sbjct: 505 YNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDII-AKRHRKRIESEC 555

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/514 (54%), Positives = 372/514 (72%), Gaps = 11/514 (2%)

Query: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMIS 78
           E + P+  SS+             T S D +++++  WQN  YF+   +EY FIFTCM +
Sbjct: 2   ENKEPIVSSSQKK-----------TLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFA 50

Query: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKML 138
            LLNQAG TQ LS MN++S+SF S+  +++WLMASFPLVSGSFILISGR+GDIYGLKK +
Sbjct: 51  NLLNQAGQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTM 110

Query: 139 LVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKN 198
           + GY+ +IIW+L+CG   Y+ SDTFFI+ RAFQGLGI+F+LPN++G++GNIY  GT RKN
Sbjct: 111 IGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKN 170

Query: 199 IVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPT 258
           IVIS +G  AP GA +G L+ GLI TE  +QWPW FYAY++AAF+N +++IY++P  +PT
Sbjct: 171 IVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPT 230

Query: 259 NIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRF 318
           N+H+F+MDW+G+          NFVWNQ P++GW + Y                 YE++F
Sbjct: 231 NVHNFAMDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKF 290

Query: 319 AKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFL 378
             +PLLPR V K+  ++ I+  LF GWGSFGI+TFYY+ FQLN+R Y+ LWAG T+FMF+
Sbjct: 291 PISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFI 350

Query: 379 IWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFG 438
           IWG IAA +VGFTI  V P+V LFFS + F +GS+M SVTP+H+TY+R  +G  IILSFG
Sbjct: 351 IWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFG 410

Query: 439 MDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKG 498
           MDLSFPASSII SD+LPM+YQGMAGSLVNT++NYS SLCLGMG TVE Q+N  G+ LL+G
Sbjct: 411 MDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRG 470

Query: 499 YRGAQYLGIGLASLACMISGLYMVESFIKGRRAR 532
           YR A YL +GL  L   ++ L +     + R++R
Sbjct: 471 YRSALYLAVGLGGLGACVAFLNLCYDLWRKRKSR 504

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/538 (56%), Positives = 379/538 (70%), Gaps = 12/538 (2%)

Query: 9   LTESKGEYENE-TELPVKKSSRDNNIGESLTATAFTQS----------EDEMVDSNQKWQ 57
           +T + GE + E   + VK +    N   S + +  T +           ++  D+N  WQ
Sbjct: 11  ITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQ 70

Query: 58  NPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 117
           NP+YF   W+EYLFI TCM+S LLNQAG TQ  S MN++  +F ++ +SK+WLMASFPLV
Sbjct: 71  NPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLV 130

Query: 118 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAF 177
           SGSFIL+SGR+GDIYGLK+ ++ G +++IIWSLICG   YS S TFFII RAFQGLGIAF
Sbjct: 131 SGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAF 190

Query: 178 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAY 237
           VLPNV+G++GNIY  G+ RKNIVIS +G  AP GA  G  +AGLI T+  KQWPW FYAY
Sbjct: 191 VLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAY 250

Query: 238 SIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYX 297
           + A  +N VL+IY+IP T+P N+H FSMDW GS          NFVWN+API GW +AY 
Sbjct: 251 AFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYI 310

Query: 298 XXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQ 357
                           YEI+FAK+PLLP+AV  + ++I I+ A+F GWGSFGI+TFYY+ 
Sbjct: 311 IVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYA 370

Query: 358 FQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASV 417
           F LN+R YT L AG ++ MF++WG IAA  V FTIK V PSV LF SMVAF VGSIM S+
Sbjct: 371 FLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSI 430

Query: 418 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 477
           TPVH+TY++   G  IIL+FGMDLSFPASSII SD LPMEYQGMAGSLVNT+VNYS SLC
Sbjct: 431 TPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLC 490

Query: 478 LGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAA 535
           LGMG T E QVN +G  LLKGYR A Y+GIGL  +  +I+ L++ ES ++ +R R AA
Sbjct: 491 LGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFES-LRQKRGRTAA 547

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/532 (55%), Positives = 373/532 (70%), Gaps = 17/532 (3%)

Query: 18  NETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQK-----------WQNPNYFKYAW 66
           N  ++   KSS +N I  +L+       ED+M+ + ++           WQ+PNYFK  W
Sbjct: 8   NGGQVTALKSSHENEIERNLS------REDKMLTTEKEAPVFVEEPESPWQDPNYFKGKW 61

Query: 67  QEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISG 126
            E LF+ +CM+ QLLNQAG+T TLS M +L     S     SWLMASFPLVSGSFILISG
Sbjct: 62  DEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISG 121

Query: 127 RLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGII 186
           RLGDIYGLKKMLL+GY+ + IWSLICG++ +S +DTFFI SRAFQGLGI+FVLPN+LGI+
Sbjct: 122 RLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIV 181

Query: 187 GNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFV 246
           GNIY  GT RKNIVIS +G  APIGAT G LFAG++       WPWAFYAY+IAAF+  +
Sbjct: 182 GNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTI 241

Query: 247 LSIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXX 306
           +S + IP++IP N++ F+MDWIGS          NFVWNQ+ + GW   Y          
Sbjct: 242 ISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIF 301

Query: 307 XXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYT 366
                  +EI++AK PLLP+ V + R +I I+ +L  GWGSFGI+ FYYFQF L +R Y+
Sbjct: 302 LIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYS 361

Query: 367 ALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFR 426
            +WAGGT+FM  I G IAAL VGF+IK V P+V LFFSM+AF  GSI+ SVTPVHETYFR
Sbjct: 362 PVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFR 421

Query: 427 TQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVET 486
           + LG M+ILSFGMDLSFPA+SII SD L M+YQGMAGSLVNTVVNYSMSL LG+G T+E 
Sbjct: 422 SCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIER 481

Query: 487 QVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYD 538
           Q+N  G  LL+G+R A Y  IG+ SL  +ISG+++++  +   ++R   E +
Sbjct: 482 QINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSRKENELE 533

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/516 (56%), Positives = 371/516 (71%), Gaps = 7/516 (1%)

Query: 17  ENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCM 76
           EN+ E   +K    +  GE          + E +    + QNP+YF   W+EY+F+ + M
Sbjct: 5   ENDDEENWEKLQSSSAAGEE------RDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSM 58

Query: 77  ISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKK 136
           +SQLLNQA TTQT  + ++LS    ++ + + WLMASFPLVSGSFIL+SG++GDIYGLKK
Sbjct: 59  LSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKK 118

Query: 137 MLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFR 196
            LL GYV+V+IWSLICG++ Y+ +  FF+++R+FQGLGIAFVLPNV+GI+GNIY   T  
Sbjct: 119 TLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEA 178

Query: 197 KNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTI 256
           KN+V S +GA APIGATLGC+F+GLIG      W W FYAY+I A +N +++++ IP+ I
Sbjct: 179 KNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNI 237

Query: 257 PTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEI 316
           PTN++ + MDWIGS          NFVWNQAPI+GW  AY                 YEI
Sbjct: 238 PTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEI 297

Query: 317 RFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFM 376
           RFAK PLLP +V+ +R ++ I+ +LFFGWGSFGI+TFYY  F LN+R Y+ LWAGGTYFM
Sbjct: 298 RFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFM 357

Query: 377 FLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILS 436
           F IWGI+A+LLVG+TI    P+V LF SMVAF+ G IM +VTPVH+TYFR  LG MIILS
Sbjct: 358 FAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILS 417

Query: 437 FGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLL 496
           FGMDLSFPA+SII SD LP +YQGMAGSLV+T+++YSMSLCLG+  T E QVN +G  LL
Sbjct: 418 FGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLL 477

Query: 497 KGYRGAQYLGIGLASLACMISGLYMVESFIKGRRAR 532
           KGY+ A Y+GIGLASL  +ISG +M+E +   RR R
Sbjct: 478 KGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/504 (58%), Positives = 370/504 (73%), Gaps = 5/504 (0%)

Query: 27  SSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGT 86
           S+ D  +   +++T  TQ     V ++  WQ+P YF    +E +FI TCM++QLLNQAG 
Sbjct: 33  STEDEEVTTIVSSTKSTQ-----VTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQ 87

Query: 87  TQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVI 146
           T  L IMN+LS SF SE N+++WLMASFPL +GSFILISGRLGDIYGLKKML+VGYV+VI
Sbjct: 88  THALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVI 147

Query: 147 IWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA 206
           +WS+I G++KYS SD FFI SRAFQG+GIAF+LPN++G++G++Y  G+FRKNIVISF+GA
Sbjct: 148 VWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGA 207

Query: 207 MAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMD 266
            AP G   G LF GLI TEDP QWPW FYA+ IA F++ +++ Y+IP+ +PTNIH  SMD
Sbjct: 208 CAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMD 267

Query: 267 WIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPR 326
           W GS          NFVWNQAPI GW++ Y                 YE ++A+ PLLPR
Sbjct: 268 WTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLPR 327

Query: 327 AVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAAL 386
           A+ K+RHMI I+LA+F GWGSFGI+TFYY  FQLN+R Y+ +W GGTYF+F+I+G +AA 
Sbjct: 328 AMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAF 387

Query: 387 LVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPAS 446
            V F+IK + P++ L FS++AF+ GSIM SV PV ++Y++       IL FGMDLSFPAS
Sbjct: 388 FVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPAS 447

Query: 447 SIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLG 506
           SII SD LPM+YQGMAGSLVNTV+NYS SLCLGMG TVE Q+N  G  LLKGYR A YLG
Sbjct: 448 SIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLG 507

Query: 507 IGLASLACMISGLYMVESFIKGRR 530
           +GLASL  +IS  YM+E+     R
Sbjct: 508 VGLASLGVVISVTYMLENLWNRHR 531

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/516 (56%), Positives = 364/516 (70%), Gaps = 3/516 (0%)

Query: 18  NETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMI 77
           N    PV K    ++I   +      +  D ++ S  + QNP+YF   W+EYLF+ + M+
Sbjct: 2   NSEYTPVSKQRTGSDISRKVVDN--HEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSML 59

Query: 78  SQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKM 137
           SQLLNQA   Q   + ++LS+   ++ + ++WLMASFPLVSGSFIL+SG++GDIYGLKK 
Sbjct: 60  SQLLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKT 119

Query: 138 LLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRK 197
           LL GY +V+IWSLICG++ Y+ +  FFI++R+FQGLGIAFVLPNV GI+GNIY   T  K
Sbjct: 120 LLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAK 179

Query: 198 NIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIP 257
           N+V S +GA APIGATLGCLF+GLIGTE  + W W FYAY+I A +N +++ Y IP  IP
Sbjct: 180 NMVFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIP 238

Query: 258 TNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIR 317
           TN+H F MDW+GS          NFVWNQAP  GW+ AY                 +E R
Sbjct: 239 TNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEAR 298

Query: 318 FAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMF 377
           FAK PLLPRAV+ +R ++ I+ +LF GWGSFGI+T+YY  F LN+R YT LWAGG+YFMF
Sbjct: 299 FAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMF 358

Query: 378 LIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSF 437
            I+G IAA LVG TI    P++ L  S++AF+VG IM SVTPV +TYFR  LGTM+ILSF
Sbjct: 359 AIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSF 418

Query: 438 GMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLK 497
           GMDLSFPASSII SD LP +YQGMAGSLVNT++NYSMSLCLG+  T E QVN DG  LLK
Sbjct: 419 GMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLK 478

Query: 498 GYRGAQYLGIGLASLACMISGLYMVESFIKGRRARA 533
           GYR A Y+GIGLAS+   +SG Y +E +   RR R+
Sbjct: 479 GYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERS 514

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/496 (57%), Positives = 371/496 (74%), Gaps = 1/496 (0%)

Query: 35  ESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMN 94
           E +T  A + S+   + ++  WQ+P YF    +E +FI TCM++QLLNQAG T  L IMN
Sbjct: 36  EEVTTVA-SSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMN 94

Query: 95  ILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGI 154
           +LS SFGSE N+++WLMASFPL +GSFILISGRLGDIYGLKKML++GYV++I+WS+I G+
Sbjct: 95  VLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGL 154

Query: 155 TKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATL 214
           +KYS +D+FFI  RAFQG+GIAF+LPN++G++G++Y  G+ RKN+VIS +GA  P GA  
Sbjct: 155 SKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALF 214

Query: 215 GCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSXXXX 274
           G +F GLI TEDP QWPW FYA+ IA FI+ +++ Y+IP+ +PTN+H  SMDW GS    
Sbjct: 215 GGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAV 274

Query: 275 XXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHM 334
                 NFVWN+API+GW++AY                 YEI++A+ PLLP AV K+RHM
Sbjct: 275 IGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHM 334

Query: 335 IQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKN 394
           I I+LA+F GWGSFGI+TFYY  FQLN+R Y+ +W GGTYF+F I+G IAA  V F+IK 
Sbjct: 335 IMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKR 394

Query: 395 VSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNL 454
           + P++ L F+++AF+ GSIM SV PV ++Y++       +L FGMDLSFPASSII SD L
Sbjct: 395 LGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGL 454

Query: 455 PMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLAC 514
           PM+YQGMAGSLVNTV+NYS SLCLGMGATVE Q+N  GK++L+GYR A YLGIGLASL  
Sbjct: 455 PMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGV 514

Query: 515 MISGLYMVESFIKGRR 530
           +IS  YM+E+    R+
Sbjct: 515 LISVTYMLETVWNERK 530

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/531 (54%), Positives = 372/531 (70%), Gaps = 14/531 (2%)

Query: 18  NETELPVKKSSRDNNIGESLTATAFTQSEDE------------MVDSNQKWQNPNYFKYA 65
           NE  L   +S+ D    E    TA  + +DE            + ++N  WQNP+YF  +
Sbjct: 15  NEANLLESQSTIDCTSSER--KTAIKEQDDEIGSDSTTTSSSSLQENNSSWQNPDYFSSS 72

Query: 66  WQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILIS 125
           ++EY+F+ TCMI+ LLNQAG +Q LS MN++SDSF S    ++WLMASFPLVSGSFILIS
Sbjct: 73  FKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILIS 132

Query: 126 GRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGI 185
           GRLGDIYGLK+M++ G++ +IIWSLICG T Y+ SDTFFI++RAFQGLGI+F+LPNV+G+
Sbjct: 133 GRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGL 192

Query: 186 IGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINF 245
           +GNIY  GT RKN+VIS +G MAP G+  G L+ GLI TE+PKQWPW FYAY++AA +  
Sbjct: 193 VGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCL 252

Query: 246 VLSIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXX 305
           V+  Y +P  IPTN++ F+MDWIGS          NFVWNQ PI GW +AY         
Sbjct: 253 VMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSV 312

Query: 306 XXXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQY 365
                   YEI++AK PLLP+AV ++ H++ I+  LF GWGSFGI+TFYYF FQLN+R+Y
Sbjct: 313 IFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREY 372

Query: 366 TALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYF 425
           + +W+GGT+F+F+I+G +AA  V  TIK V P++ LFFS + F  GSI+ SVTPVH+TY+
Sbjct: 373 SPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYW 432

Query: 426 RTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE 485
           R   G  IIL FGMDL FPASSII SD LPM+YQGMA SLVNT+VNYS SLCLGMG TVE
Sbjct: 433 RNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVE 492

Query: 486 TQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAE 536
            Q+N  G  LLKGYR A Y G+G+A L   I+ L +       R A+   +
Sbjct: 493 RQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKD 543

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/526 (56%), Positives = 381/526 (72%), Gaps = 5/526 (0%)

Query: 15  EYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFT 74
           +  ++T + V      +   E +T T  + +E   V ++  WQ+P YF    +E +FI T
Sbjct: 17  QIHDKTIMKVDDKVVISTEDEEVT-TVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIAT 75

Query: 75  CMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGL 134
           CM++QLLNQAG T  L IMN+LS SF SE N+++WLMASFPL +GSFILISGRLGDIYGL
Sbjct: 76  CMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGL 135

Query: 135 KKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGT 194
           KKMLL+GYV++IIWS+I G++KYS SD FFI  RAFQGLGIAF+LPN++G++G++Y  G+
Sbjct: 136 KKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGS 195

Query: 195 FRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPS 254
            RKN+VIS +GA AP G   G +F GLI TEDP+QWPW FYA+SIA FI+ +++ Y+IP+
Sbjct: 196 LRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPN 255

Query: 255 TIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXY 314
            +PTN+H  SMDW GS          NFVWNQAPI+GW +AY                 Y
Sbjct: 256 NVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVY 315

Query: 315 EIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTY 374
           EI++A+ PLLP AV K+RHMI I+LA+F GWGSFGI+TFYY  FQLN+R Y+ +W GGTY
Sbjct: 316 EIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTY 375

Query: 375 FMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMII 434
           F+F+I+G IAA  V F+IK + P++ L F+++AF+ GSIM SV PV ++Y++       I
Sbjct: 376 FVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAI 435

Query: 435 LSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKH 494
           L FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMG TVE Q+N  G++
Sbjct: 436 LCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQN 495

Query: 495 LLKGYRGAQYLGIGLASLACMISGLYMVESF----IKGRRARAAAE 536
           LLKGYR A YLGIGLASL  +IS  YM+E+F     +  + R  AE
Sbjct: 496 LLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLEAE 541

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/534 (51%), Positives = 367/534 (68%), Gaps = 5/534 (0%)

Query: 11  ESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEM--VDSNQKWQNPNYFKYAWQE 68
           E K   E+     V   +  + + +S+     + ++D++  + +N KWQ+P YFK +WQE
Sbjct: 14  EEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQE 73

Query: 69  YLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRL 128
           Y FI TCM++ LLNQAG TQTLS MN+L+DS  S+G +K+WLMASF L SGSFIL+SGR+
Sbjct: 74  YTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRI 133

Query: 129 GDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 188
           GDIYGLK   + G ++  IWS++CG++KY+ + TFFII RAFQGLG+AFVLPNV+G++GN
Sbjct: 134 GDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGN 193

Query: 189 IYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLS 248
           IY  G+ RKNIVISF+G MAP+G T G ++ GLI   +  QWPW F+A +IA FIN ++ 
Sbjct: 194 IYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMG 253

Query: 249 IYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXX 308
           IY+IP+ +PTNI++  MDWIGS          NFVWNQAPISGW++AY            
Sbjct: 254 IYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFL 313

Query: 309 XXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTAL 368
                YE++ A++PLLP  V K+RH++ I+++LF GWG+FGI+TFYY+ F LN+R ++ L
Sbjct: 314 VAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPL 373

Query: 369 WAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQ 428
           WAG T+F+F+I+G + A+ V FTI  V PSV    S + F  G+I+ SVT   +TY+R  
Sbjct: 374 WAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNS 433

Query: 429 LGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQV 488
           LG  IIL+ GMDLSFP SSII SD LPM+YQGM+GSLVNT+ NY+ SLCLGMG T E Q 
Sbjct: 434 LGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQY 493

Query: 489 NSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESF---IKGRRARAAAEYDC 539
           N+ GK +LKGYR A Y+ IGL +L    S  YM E      + RR     E  C
Sbjct: 494 NNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKEDKC 547

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/515 (53%), Positives = 361/515 (70%), Gaps = 2/515 (0%)

Query: 15  EYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFT 74
           + +N  +  +K     +++  SLT    T + D   D +  +QNP+YFK  +QE+ FIF+
Sbjct: 23  DCKNPEQQSLKNIDSRSSLNSSLTQVLSTDTADN--DESSSYQNPDYFKNKYQEFGFIFS 80

Query: 75  CMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGL 134
            MI QLL+QAG TQTLSIMN+L+    S  + ++WLM+SFPL  GSFIL+SGRLGDIYGL
Sbjct: 81  GMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGL 140

Query: 135 KKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGT 194
           KK+LL GY++  +WS+ICG++ Y+ +D FFI +RAFQGLG+AF LPN++G+IG IY  G 
Sbjct: 141 KKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGC 200

Query: 195 FRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPS 254
           FRKN++IS +GAM+P GATLG LFAGL    D   WPW+FYA+ + +F+N ++S Y IP+
Sbjct: 201 FRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPN 260

Query: 255 TIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXY 314
           +IPTNIH   MDW+GS          NFV+NQAPI GW  AY                 Y
Sbjct: 261 SIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVY 320

Query: 315 EIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTY 374
           E+++AKTPL+P+A+  +R M+ I+ +LF GWGSFGI+TFYYF F+LN+R Y+ LWAG +Y
Sbjct: 321 EVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY 380

Query: 375 FMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMII 434
           F+F+I G   A++ G TIK + PSV    SM+ F  G+I+ + TPV++T+FR  LG M +
Sbjct: 381 FIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFL 440

Query: 435 LSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKH 494
           L  GMD SFPASSII SD+LPM+YQGMAGSLVNTV+NYS S+CLGM  TVE + NS GK 
Sbjct: 441 LPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKD 500

Query: 495 LLKGYRGAQYLGIGLASLACMISGLYMVESFIKGR 529
           LL GYR A Y  IGLA LA  +SG YM+E   K R
Sbjct: 501 LLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/518 (52%), Positives = 361/518 (69%), Gaps = 3/518 (0%)

Query: 13  KGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFI 72
           K  Y  +++     +S +  IG   + +  +    E + S  K  +P YFK    EYLFI
Sbjct: 46  KKNYSQDSQ---TNTSMNEVIGSISSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFI 102

Query: 73  FTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIY 132
            +CM+SQ ++QAG TQ LSIMNIL++   +E + ++WLMASF L  GSFIL+SGRLGDIY
Sbjct: 103 ISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIY 162

Query: 133 GLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVG 192
           GLKK+LL GY ++ IWSLICG + YS +D FFI SRAFQGLG+AFVLPN LG+IG IY  
Sbjct: 163 GLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEP 222

Query: 193 GTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAI 252
           G+ +KN++I  +GAM+PIGATLG LFAG+IGT+DPKQWPW+FY++ I +F N +LS Y+I
Sbjct: 223 GSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSI 282

Query: 253 PSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXX 312
           P+ IPTNI++ SMDWIG+          NFV+NQAPI GW  AY                
Sbjct: 283 PNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFV 342

Query: 313 XYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGG 372
            YE+++AKTPL+P+A+  +R M+ I+ ALF GWG+FG +TFYYF F LN+R YTA WAGG
Sbjct: 343 VYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGG 402

Query: 373 TYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTM 432
           +YF+F++ G   A L GF +K V PSV L+ SM+ F  G +M +VTP+H++YF+  LG M
Sbjct: 403 SYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIM 462

Query: 433 IILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDG 492
            +L  G+DLSFPA+SII SD LP++YQGMAGSLV T+ NYS S+CLGM  +VE   N +G
Sbjct: 463 FVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNG 522

Query: 493 KHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRR 530
           +++LKGYR A      LA L  ++SG+YMV + I  R 
Sbjct: 523 QNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRE 560

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/482 (52%), Positives = 343/482 (71%)

Query: 57  QNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPL 116
           Q P YF     E+ FIFTC++ QLLNQAGTTQ++SIMNI+++ FGSE + ++WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 117 VSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIA 176
           VSGSFIL+ GR GDIYGLKKMLL+GY ++ IWS+ICG+T Y+ SD FFI+++AFQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 177 FVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYA 236
           F+LPN++G++G IY  G+ +KNI ISF+GAMAP+GAT G LF+G++  +D K WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 237 YSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAY 296
           ++I +F+  V   + +P  +PTN ++  MDWIGS          +FVWNQAP+ GW++AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 297 XXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYF 356
                            YEI +A+ PLLP+A+  +RH+I I+LA+F GWG+FGI++FYYF
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 357 QFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMAS 416
            F LN+R ++ +W GG YF F++ G   A  VGF IK + PS+ L  S+  F +G+++ +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 417 VTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSL 476
           VTP  +TY+R   G M++L  GMDLSFPASSII SD LP EYQGMAGSLVNT+VNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 477 CLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAE 536
           CLG+  TVE Q+NS G  LLKGYR A Y G+G+ +L   I+ LYM E+F    + +    
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 537 YD 538
            D
Sbjct: 546 ND 547

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/510 (55%), Positives = 366/510 (71%), Gaps = 5/510 (0%)

Query: 28  SRDNNIGESLTAT-AFTQSEDE----MVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLN 82
           SR ++I E + +  +  +S +E    +V    KWQ+P YFK ++QEYLF+ +CM +QLLN
Sbjct: 4   SRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLN 63

Query: 83  QAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGY 142
           QA T QTLSIMN+LSDSF S  ++++WL+ASFPLV+GSFILISGR+GDIYGLKK L+ GY
Sbjct: 64  QATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGY 123

Query: 143 VLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVIS 202
           + +IIWSLICG T YS SDTF II+RAFQGLGIAF LPNV+G IGNIY  G+ RKN+VIS
Sbjct: 124 IFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVIS 183

Query: 203 FVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHH 262
            + A AP+GA +G  FAGLI TE P QWPW+FYA++IA   N ++SIY+IPS IPTN++ 
Sbjct: 184 LIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNG 243

Query: 263 FSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTP 322
           F MDWIGS          NF WNQ PI GW+ AY                 YEI FA +P
Sbjct: 244 FKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSP 303

Query: 323 LLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGI 382
           L+ R +   R+MI  +  LF GWGS+GI++FYYF F LN+R Y+ +WAGG+YF+F I+G+
Sbjct: 304 LIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGV 363

Query: 383 IAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLS 442
           +A+  VG +IK ++  V L FSMV F VG+ + SV PV ++YF+  L  M IL  G+D S
Sbjct: 364 LASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTS 423

Query: 443 FPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGA 502
           FPA++II SD LPMEYQGMAGSL  T+VNYSMSLCLGMG TVE Q+N DG+ +LKGYR A
Sbjct: 424 FPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSA 483

Query: 503 QYLGIGLASLACMISGLYMVESFIKGRRAR 532
           +YLGIGL+ L  +++ + +++  +   R +
Sbjct: 484 EYLGIGLSGLGLLLACILVIDKLVAKYRNK 513

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  447 bits (1151), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 220/525 (41%), Positives = 319/525 (60%), Gaps = 2/525 (0%)

Query: 8   VLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQ 67
           +LT        +  L  +   +  +   SL+AT         +  +Q  + P+ FK  +Q
Sbjct: 64  ILTGKNDTMPKDQNLVCQNIMQFASFESSLSATP--PDNKPFITESQNLRRPDIFKNRFQ 121

Query: 68  EYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGR 127
           E+ F+   +I Q L+Q G TQ LS MNIL++   +    + WLMA+FPL  G  ILISGR
Sbjct: 122 EFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGR 181

Query: 128 LGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 187
           LGDI+GLKK+LL+GY++  IW+LICG + Y+ SD  FI+SR FQGLG+A  LPN+  +IG
Sbjct: 182 LGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIG 241

Query: 188 NIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVL 247
            IY    F+KN++   +GAM+PIGATLG +FAGL    + K WPW+FY+++I AF+N ++
Sbjct: 242 IIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGII 301

Query: 248 SIYAIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXX 307
           + + IP+ I  N     MDWIGS          NFV+NQ PI GW+ AY           
Sbjct: 302 AWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVA 361

Query: 308 XXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTA 367
                 YE+  A  PL+P+ +  +  +I I+L LF GWG F I+TFYYF FQLN+R Y+ 
Sbjct: 362 LILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSP 421

Query: 368 LWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRT 427
           LWA  + F+ +I G I  ++    ++ + P + LFFSM+ F  G+I+ +VTP+H+T+FR 
Sbjct: 422 LWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRN 481

Query: 428 QLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQ 487
             G+M +   GM  SFP++S++ ++ LP  Y+ MAGSLVN  +NY+ S+C+GM  +    
Sbjct: 482 MFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSICVGMAGSANVN 541

Query: 488 VNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRAR 532
            N+ G+ LL G+R A YL IGL+  +  +SGLYM+ S    R  +
Sbjct: 542 HNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQK 586

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  337 bits (865), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/522 (37%), Positives = 294/522 (56%), Gaps = 21/522 (4%)

Query: 23  PVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLN 82
           PV + + D N+ E+L      + +DE++      Q        W E  F+     +QL+ 
Sbjct: 6   PVTEENLDMNV-ETL------KKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMT 57

Query: 83  QAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVG 141
           QAG  Q+L+ ++I+ DSFG+    + SW  +++ L  G+FILI+GRLGDI+G KK  ++G
Sbjct: 58  QAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 117

Query: 142 YVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVI 201
           +    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V 
Sbjct: 118 FFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVF 175

Query: 202 SFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTN-- 259
           S  GA AP G  LG +F+ ++G      WPWA++   IA F+  V   Y IP T   N  
Sbjct: 176 SLFGASAPGGFVLGAVFSSMLG--QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRD 233

Query: 260 IHHFSM----DWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYE 315
           +  F +    D+ GS          NF WNQ P+ GW   Y                  E
Sbjct: 234 VASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIE 293

Query: 316 IRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYF 375
            R A  PLLP A +       ++  +  GW SFGI+ FY +QF  + R  T L +   + 
Sbjct: 294 SR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFS 351

Query: 376 MFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIIL 435
              I G  AAL+ GF + +  PS  +FF+M AF VG+I+ +  PVH+TY+     ++I++
Sbjct: 352 PVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVM 411

Query: 436 SFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHL 495
            +GMD+SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+ VN  G ++
Sbjct: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANV 471

Query: 496 LKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEY 537
           LKGYR + YLGIGL+     ++  Y V +F+K ++  +  ++
Sbjct: 472 LKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQH 513

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  327 bits (837), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/523 (36%), Positives = 296/523 (56%), Gaps = 17/523 (3%)

Query: 22  LPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLL 81
           +P + S    N+    T+   T+++DE++ +  + Q+       W E  F+     +QL+
Sbjct: 1   MPRRPSVTQKNLE---TSAETTKTDDEVLLNQFELQDETPGSLVW-EAAFVGVLCSAQLM 56

Query: 82  NQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLV 140
            QAG  Q+++ ++I+ DSFG+    + SW  +S+ L  G+FILI+GRLGDI+G +K  ++
Sbjct: 57  TQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFIL 116

Query: 141 GYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIV 200
           G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V
Sbjct: 117 GFFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMV 174

Query: 201 ISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST-IPT- 258
            S  GA AP G  LG +F+ ++G      WPWA++   IA F+  V   + IP   +P+ 
Sbjct: 175 FSLFGASAPGGFVLGAVFSSMLG--QLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSR 232

Query: 259 NIHHFSM----DWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXY 314
           +   F+M    D+ GS          NF WNQ P+ GW   Y                  
Sbjct: 233 DSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFI 292

Query: 315 EIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTY 374
           E R A  PLLP A +       ++  +  GW SFGI+ FY +QF    R+ + L +   +
Sbjct: 293 ESR-AAYPLLPFAALSSDAAF-VLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQF 350

Query: 375 FMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMII 434
               I G  AA+  GF + +   S  + F+M AF VG I+ +  PVH+TY+     ++I+
Sbjct: 351 APVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIV 410

Query: 435 LSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKH 494
           + +GMD+SFPA++I+ S+++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+QVN  G +
Sbjct: 411 MPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGAN 470

Query: 495 LLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEY 537
            LKGYR + Y+GIGL+ L   ++ +Y   +F+K ++  +  +Y
Sbjct: 471 ALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEKQY 513

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  325 bits (834), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/522 (36%), Positives = 283/522 (54%), Gaps = 21/522 (4%)

Query: 23  PVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLN 82
           PV +   D N G         + +DE+V      Q+       W E  F+     +QL+ 
Sbjct: 6   PVMQKDFDTNTGT-------LKKDDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMT 57

Query: 83  QAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVG 141
           QAG  Q+L+ ++I+  SFG+    + SW  +++ L  G+FILI+GRLGDI+G KK  ++G
Sbjct: 58  QAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 117

Query: 142 YVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVI 201
           +    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V 
Sbjct: 118 FFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVF 175

Query: 202 SFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIH 261
           S  GA AP G  LG +F+ L+G      WPWA++   IA F   +   + IP T   + H
Sbjct: 176 SLFGACAPGGFVLGAVFSSLLG--QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRH 233

Query: 262 HFS------MDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYE 315
             S      +D+ GS          NF WNQ P+ GW   Y                  E
Sbjct: 234 ASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIE 293

Query: 316 IRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYF 375
            R A  PLLP A +       ++  +  GW SFGI+ FY +QF  + R  T L +   + 
Sbjct: 294 SR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFS 351

Query: 376 MFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIIL 435
              + G  AAL  G+ +    PS  + F+M AF  G+I+ +  PVH+TY+     ++I++
Sbjct: 352 PVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVM 411

Query: 436 SFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHL 495
            +GMD+SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+ VN  G   
Sbjct: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKP 471

Query: 496 LKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEY 537
           LKGYR + Y+GIGL+ L   ++ +Y   +F K ++  +  ++
Sbjct: 472 LKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQH 513

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  322 bits (824), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/519 (37%), Positives = 288/519 (55%), Gaps = 22/519 (4%)

Query: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMIS 78
            T   V + + D N  E+L       SE ++ D   K          W E  F+     +
Sbjct: 2   STSSSVTQKNLDTN-AEALKKEDKVLSEFDIQDERPK-------SLLW-ESAFVGVLCSA 52

Query: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKM 137
           QL+ QAG  Q+L+ ++I+ +SFG+    + SW  +++ L  G+FILI+GRLGDI+G KK 
Sbjct: 53  QLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 112

Query: 138 LLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRK 197
            ++G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RK
Sbjct: 113 FVLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RK 170

Query: 198 NIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST-I 256
           N+V S  GA AP G  LG +F+ ++G      WPWA++   IA F+  V   + IP T +
Sbjct: 171 NMVFSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPM 228

Query: 257 PT-NIHHFSM----DWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXX 311
           P+ +   F +    D+ GS          NF WNQ P+ GW   Y               
Sbjct: 229 PSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIF 288

Query: 312 XXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAG 371
              E R A  PLLP A +       ++  +  GW SFGI+ FY +QF  + R  T L + 
Sbjct: 289 AYIESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSS 346

Query: 372 GTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGT 431
             +    I G  AA+  GF + +  PS  + F+M AF VG+I+ +  PVH+TY+     +
Sbjct: 347 AQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVS 406

Query: 432 MIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSD 491
           +I++ +GMD+SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E++VN  
Sbjct: 407 IIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDG 466

Query: 492 GKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRR 530
           G   LKGYR + Y+GIGL+ L   ++  Y   +F+K ++
Sbjct: 467 GAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKK 505

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  317 bits (813), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/497 (36%), Positives = 277/497 (55%), Gaps = 17/497 (3%)

Query: 45  SEDEMVDSNQKWQNPNYFKYAWQEYL-----FIFTCMISQLLNQAGTTQTLSIMNILSDS 99
           + +   D  Q+   P++      E L     F+     +QL+ QAG  Q+++ ++I+ DS
Sbjct: 17  TRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQAGLGQSIAPLHIIGDS 76

Query: 100 FGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYS 158
           FG+    + SW  A++ L  G+FILI+GRLGD+YG KK  ++G+    +WSL+ G + YS
Sbjct: 77  FGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYS 136

Query: 159 GSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLF 218
            +  FF   RAFQG+G A +LPN + I+G  YV G  RK +++S  GA AP G  LG +F
Sbjct: 137 -NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSLFGATAPAGFVLGAVF 194

Query: 219 AGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIP----STIPTNIHHFS-MDWIGSXXX 273
           + + G      WPWA++A  I  F   V  I  IP      + T++  +  +D  GS   
Sbjct: 195 SSIFGQL--TWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTG 252

Query: 274 XXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRH 333
                  NF WNQ P+ GW   Y                  E R A  PLLP + +    
Sbjct: 253 VIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APHPLLPLSALSSDA 311

Query: 334 MIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIK 393
              ++  +  GW SFGI+ +Y++ F   +R ++ L     +    I G+ AAL  GF I 
Sbjct: 312 AF-VLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVIT 370

Query: 394 NVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDN 453
            V  S+ + F+M AF VG I+ +  PV + Y+     ++I++ +GMD+SFPA++I+ SD+
Sbjct: 371 RVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDS 430

Query: 454 LPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLA 513
           +P E+QG+A SLVN VVNYS+S+ LG+  TVE +VN+ G +LLKGYRGA Y+GIGL+   
Sbjct: 431 MPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAWYMGIGLSGFG 490

Query: 514 CMISGLYMVESFIKGRR 530
            +I+ +Y   +F K ++
Sbjct: 491 ILIAFMYEYHTFKKSKK 507

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  309 bits (791), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 184/505 (36%), Positives = 282/505 (55%), Gaps = 14/505 (2%)

Query: 35  ESLTATAFTQSEDEMVDSNQKWQNP-NYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIM 93
           ESL A  F + ++E  +S Q  Q+     +   +E LF+     +QL+ QAG  Q+++ +
Sbjct: 6   ESLEAQ-FVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPV 64

Query: 94  NILSDSFG-SEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC 152
            I+ +SFG S     SW  A++ L  G+FILI+GRLGD++G KK+ +VG++   +WSL+ 
Sbjct: 65  RIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLA 124

Query: 153 GITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGA 212
           G + YS +  FF   RA QG+G AF+LPN + I+G  Y  G  RK +V S  GA AP G 
Sbjct: 125 GFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGF 182

Query: 213 TLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFS-----MDW 267
            LG +F+ +        WPWA++A   A  +  V  I  IP   P  I   +     +D 
Sbjct: 183 VLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDA 240

Query: 268 IGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRA 327
            G+          NF WNQ P+ GW   Y                  E R A+ PLLP A
Sbjct: 241 AGATTGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFA 299

Query: 328 VIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALL 387
            +    +  ++  +  GW SFGI+ FY++QF  + R  + L     +    I G+ AAL 
Sbjct: 300 ALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALT 358

Query: 388 VGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASS 447
            G+ + +V     +  +M+AF VG ++ +  P+++TY+     ++II+ +GMD+SFPA++
Sbjct: 359 TGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAAT 418

Query: 448 IIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGI 507
           I+ S+ +P E+QG+A SLVNTVVNYS+SL LG   T+ET+VN+ G + L+GYRGA Y+GI
Sbjct: 419 IMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGI 478

Query: 508 GLASLACMISGLYMVESFIKGRRAR 532
           GL+ L  +++ +Y   +  K +  +
Sbjct: 479 GLSGLGVLVAIVYAWSTLKKFKEEQ 503

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  287 bits (735), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 168/504 (33%), Positives = 281/504 (55%), Gaps = 21/504 (4%)

Query: 42  FTQSEDEMVDSNQK----------WQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLS 91
           F++  +  +  NQ+          W   + F +  +EY F+FT +++Q  NQAG T  L 
Sbjct: 14  FSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILP 73

Query: 92  IMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLI 151
           ++N+LSDSF  +     +L+ S+P+V GSF+LI GRLG+++G K+ LL GY+++I+ SL+
Sbjct: 74  LVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLL 128

Query: 152 CGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV--GGTFRKNIVISFVGAMAP 209
            G+++YS S  F++I RAFQG+G+A +LPN        Y       RK I+ + +G  A 
Sbjct: 129 GGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGAS 188

Query: 210 IGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIG 269
            GA LG   +G+  T     W WA+Y Y+IAA +   LS Y++P  I T  +   ++ +G
Sbjct: 189 TGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNI-TKKNKPCLNGLG 247

Query: 270 -SXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAV 328
                       N   N A ++  N ++                 +E++F++ P+  + +
Sbjct: 248 WFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKEL 307

Query: 329 IKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLV 388
             +  +  ++ ++FFGWG++GI++ Y+F+F LN+R Y+ L AG TY   +I G +A + +
Sbjct: 308 FTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGI 367

Query: 389 GFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSI 448
              +K   P +FL FS + F    I+ SVTP+H++YFR+ LG+MI L+ G+D SFP+S+I
Sbjct: 368 SMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAI 427

Query: 449 IFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIG 508
           I  + LP +Y  M   L N + NY++S   G+  +    ++S    L+K YR   Y  IG
Sbjct: 428 ILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSSI--ELIKYYRYVYYFAIG 485

Query: 509 LASLACMISGLYMVESFIKGRRAR 532
           L+++    +G+ +  + I   R +
Sbjct: 486 LSAIGLFAAGIQLARASIMYYRGK 509

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  285 bits (730), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 167/456 (36%), Positives = 248/456 (54%), Gaps = 14/456 (3%)

Query: 57  QNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFP 115
           QN   +    +E   I     +QL+ QAG  Q++  + I+ DSFG +   + SW  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 116 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGI 175
           L  G+FILI+GRLGD +G KK  ++G++   +WS++ G + YS +  FF   RAFQG+G 
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGP 136

Query: 176 AFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFY 235
           AF LPN + II   Y  G  ++N++ S  GA AP G  +G +F+ L+   +   WPWA++
Sbjct: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193

Query: 236 AYSIAAFINFVLSIYAIPSTIPTNIHHFS-----MDWIGSXXXXXXXXXXNFVWNQAPIS 290
              I  F+  V     IP   P +          +D  GS          NF WNQ P+ 
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 291 GWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLP-RAVIKDRHMIQIMLALFFGWGSFG 349
           GW  +Y                  E R AK PLLP R +  D   I +M  +  GW SFG
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDT--IFVMGCIAAGWSSFG 310

Query: 350 IFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFN 409
           I+ +Y +Q   N+R    L +   +    I G+ AA+   F +   SPS  +  +M+AF 
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 410 VGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTV 469
           VGSI+ +  PV +TY+     ++I++ +GMD+SFPA++II S  +P  +QG+A SLVNT+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 470 VNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYL 505
           +NYS+S+ LG   T+E+Q++     LLKGYRGA Y+
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYM 466

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  213 bits (541), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 145/514 (28%), Positives = 246/514 (47%), Gaps = 23/514 (4%)

Query: 26  KSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAG 85
           +   D+N+ +   +    +  D      +   N +       E +F+     SQ+L  AG
Sbjct: 40  RRDSDDNVSDINKSAPAPEEHDPPCTGEEATLNMSLL----HEIIFVLLVSSSQVLGLAG 95

Query: 86  TTQTLSIMNILSDSFGSEGNSKS-WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVL 144
             Q +  M+++ + F     S S W    +    GSF+LI+G++GD+ G K M L+GY  
Sbjct: 96  AVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAW 155

Query: 145 VIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFV 204
           + +WSL+ G ++Y  S  FF   RA QG+G AF   + L I+G  Y     RKN + SF 
Sbjct: 156 LALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPPCK-RKNFIFSFF 214

Query: 205 GAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTI-----PTN 259
           GA    G  LG +F+ L        W WA+++ +IA  +  +LSI+ IP  +      +N
Sbjct: 215 GACGSFGVVLGMVFSALF--TQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSN 272

Query: 260 IHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFA 319
           + +F  D++G+          +  WNQAP  G+ + Y                  E +  
Sbjct: 273 VFYF--DYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETK-V 329

Query: 320 KTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLI 379
             PLLP   I   + ++++LA+FF + SF ++  Y F+F L  +  T L A        +
Sbjct: 330 DDPLLPWTHIS-ANTLKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAV 388

Query: 380 WGIIAALLVGFTIK-NVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFG 438
            G+ AAL     +  +V   + +  S++AF V  I+ +     +TY+     T I++SFG
Sbjct: 389 SGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFG 448

Query: 439 MDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSD-----GK 493
           +D+SFP+++++ S+ +P +++G+  SLV  V+NY+ +L     A+V      D     G 
Sbjct: 449 LDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGN 508

Query: 494 HLLKGYRGAQYLGIGLASLACMISGLYMVESFIK 527
              K      Y+GIG A L  +++   ++  + K
Sbjct: 509 AFTKTINIIGYVGIGTAGLGTLVAIFGVITEYPK 542

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  181 bits (459), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 123/190 (64%), Gaps = 34/190 (17%)

Query: 76  MISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLK 135
           M+SQLLNQ GTTQTL ++N+LS  F S    ++ L+AS PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 136 KMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTF 195
             LL GY  VI+WS ICG+T+Y+GS  FF+I+RAFQGLG+AFVLPNV+G + N+Y+ G+ 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 196 RKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST 255
           RKN+V                                  YAY++A  +N  L ++A+P  
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 256 IPTNIHHFSM 265
           IPTN+   +M
Sbjct: 147 IPTNVRGQAM 156

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 6/44 (13%)

Query: 453 NLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLL 496
           N+P   +G A      ++ YSM +CLG+  TVE +V+  G   L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  164 bits (416), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 138/528 (26%), Positives = 246/528 (46%), Gaps = 28/528 (5%)

Query: 16  YENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTC 75
           +E+E  L    +S      E  +      S +E++      ++P   ++  +E + +   
Sbjct: 4   HESEETL----TSSKLQPHEPTSPVKVVPSHNEILSKTD--EHPLNMQF--KEIIIVLLI 55

Query: 76  MISQLLNQAGTTQTLSIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIY 132
              Q ++  G  Q +  M  ++ +F    +      W  A++   + +F++I+G+LGDI 
Sbjct: 56  SSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDIN 115

Query: 133 GLKKMLLVGYVLVIIWSLICGITKYSGSD-TFFIISRAFQGLGIAFVLPNVLGIIGNIYV 191
           G K M + GY  + +WSL+ G +KY+ ++  FF   R  QG+G AF+ P  L ++G  Y 
Sbjct: 116 GHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYP 175

Query: 192 GGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYA 251
               RKN V SF GA  P G   G +F+ L        W W +++ ++   I  +LS   
Sbjct: 176 PCK-RKNYVFSFYGACGPFGIVAGSVFSALF--TQLTTWAWTYWSMAVTCLIITILSYIF 232

Query: 252 IP-STIPTNIHH--FSMDWIGSXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXX 308
           IP    P       +S D++G           + VWNQAP+S +   Y            
Sbjct: 233 IPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFM 292

Query: 309 XXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTAL 368
                 + R  K PL+P   +   ++I+ ++ +FFG+  F I+ FY ++F L  +  + L
Sbjct: 293 TMALIIDSR-VKDPLIPWKSMCS-NVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLL 350

Query: 369 WAGGTYFMFLIWGIIAALL-VGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRT 427
            A   +    I GI AA   V    K V   + L  ++ AF + +I+ S   + ETY+  
Sbjct: 351 LAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGN 410

Query: 428 QLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV--- 484
                +I++ G+D++FP+++++ S+ +  E QG+A +L  T +NY  +L  G+   +   
Sbjct: 411 AFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITY 470

Query: 485 ---ETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGR 529
              +    SDG+  +     A Y+ IG A +A +++    +  + K R
Sbjct: 471 QCDDCLARSDGR-FVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKER 517

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  162 bits (409), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 123/426 (28%), Positives = 209/426 (49%), Gaps = 23/426 (5%)

Query: 66  WQEYLFIFTCMIS-QLLNQAGTTQTLSIMNILSDSFGSE---GNSKSWLMASFPLVSGSF 121
           W   +F+   +IS QL+   G  Q + I   L + +  E   G    W  AS+ L S   
Sbjct: 35  WIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVM 94

Query: 122 ILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYS-GSDTFFIISRAFQGLGIAFVLP 180
           +LI+G+LGD+ G K+M++ G++ + IWSLI G + Y  G+  F+  +RA QG+G  F++P
Sbjct: 95  VLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVP 154

Query: 181 NVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIA 240
           N L I+G  Y     +K I+ S  G M   G  +G  F+ L       +W W ++A +  
Sbjct: 155 NSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQL--TKWAWNYWALACV 212

Query: 241 AFINFVLSIYAIPSTIPTNIHHFS--------MDWIGSXXXXXXXXXXNFVWNQAPISGW 292
             +  V +I  IP   P NI H           D++G+          +  + QA   GW
Sbjct: 213 CVLYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGW 269

Query: 293 NQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFT 352
           +  +                  + R    PL+P   ++   ++ I++ ++FG+ SF I+ 
Sbjct: 270 SPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQHLR-ADVVVILICVYFGFLSFVIWA 327

Query: 353 FYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIK-NVSPSVFLFFSMVAFNVG 411
            +++QF   +   + L          I  I AA+     ++ N+     +  SMV F V 
Sbjct: 328 NWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVP 387

Query: 412 SI-MASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVV 470
           +I MA+VTP + TY+     + II  F +D++ P ++++FSD++  E QG+A SL+ TV+
Sbjct: 388 NILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVI 446

Query: 471 NYSMSL 476
           +Y++S+
Sbjct: 447 SYAISI 452

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  150 bits (379), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 130/503 (25%), Positives = 231/503 (45%), Gaps = 41/503 (8%)

Query: 44  QSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSE 103
           Q++D++   N     P+  +    E +FI     SQ ++ A  +Q +  M+ ++  F   
Sbjct: 52  QAQDQLESMNPP-PGPSRLR----ECMFIVIIASSQFISLAAASQAILQMDAITAWFQLP 106

Query: 104 GN---SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYS-- 158
            +      W  A+F +  G+FI+ +G+L D+ G K + + GY    +WSL+ GI++Y+  
Sbjct: 107 ADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPK 166

Query: 159 GSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLF 218
           G  TFF   R  QG+G A + P+ L ++G  Y   + +KNIV S  G   P+G  +G +F
Sbjct: 167 GQATFFFFGRGCQGIGAAALFPSSLALLGK-YYPPSCKKNIVFSLYGFCVPLGVVVGGVF 225

Query: 219 AGLIGTEDPKQWPWAFYAYSI-AAFINFVLSIYAIPSTIPTN---------IHHFSMDWI 268
           + +        W W +++ +I +AF   +   Y  P  I  +          H    D++
Sbjct: 226 SAIF--TQLAHWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYL 283

Query: 269 GSXXXXXXXXXXNFVWNQAPISGWN----QAYXXXXXXXXXXXXXXXXXYEIRFAKTPLL 324
           G+             WNQA  +G+     Q Y                 +   +   P++
Sbjct: 284 GTFLYVASLLLFAVCWNQA--TGFKFKSVQVYVTLIVSLVCFVAMVIVEF---YVDDPII 338

Query: 325 PRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIA 384
           P   I  +  I+ +L +FF + SF I+ FY +++   +R  T L     +    I G IA
Sbjct: 339 PARKIHPQ-TIKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIA 397

Query: 385 ALLVGFTIKNVSP-SVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSF 443
           AL     I    P  + L     +F +  I+       E+Y+     T+II+S G+D+SF
Sbjct: 398 ALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISF 457

Query: 444 PASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV------ETQVNSDGKHLLK 497
           P+++++ S+ +P E +G++ +LV T +NY   +   +  T+      +   + D    +K
Sbjct: 458 PSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVK 517

Query: 498 GYRGAQYLGIGLASLACMISGLY 520
               A  +GIG + +A ++ GLY
Sbjct: 518 AIHIAAAVGIGASGIAVVV-GLY 539

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  132 bits (333), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 131/561 (23%), Positives = 237/561 (42%), Gaps = 86/561 (15%)

Query: 35  ESLTATAFTQSEDEMVDSN----QKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTL 90
            ++T T   Q   ++  S+    QK Q+P        + +FIF    SQ +  A  +Q +
Sbjct: 36  PTVTETVQDQQSHKVTHSSLIRLQKLQSPT--NSYLNDIIFIFLICSSQFITLASASQAI 93

Query: 91  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
             M+ LS  F     S     W+ ASF +  G+FI+++G+L DI   + + + GYV   +
Sbjct: 94  LQMDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSL 153

Query: 148 WSLICGITKYSGSDTFFI-ISRAFQGLGIAFVLPNVLGIIGNIYVGGTF----------- 195
           W+LI G   Y   +  F+ I R  QG+G A + P+ L ++   Y                
Sbjct: 154 WTLITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPT 213

Query: 196 -----------------------------------RKNIVISFVGAMAPIGATLGCLFAG 220
                                               K+I  S  GA AP+G  +G +F+ 
Sbjct: 214 TSAPSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSA 273

Query: 221 LIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPT-----------NIHHFSMDWIG 269
           +        WPW +++ SI   +  +LS + +   IP            N  +F  D++G
Sbjct: 274 IF--TQLATWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNF--DFLG 329

Query: 270 SXXXXXXXXXXNFVWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVI 329
                         W+QA +  +   +                 +E  F   P++P   I
Sbjct: 330 VILGISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYF-NNPIIP---I 385

Query: 330 KDRH--MIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALL 387
           +  H   I+ +L +FF + SF  + FY ++    ++  + +     +    + GII+A  
Sbjct: 386 RQIHPGTIKALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATF 445

Query: 388 -VGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPAS 446
            +   +K V   + L     +F +  I+     +  +Y+  Q  ++I +S G+D+SFP++
Sbjct: 446 SILLIVKRVPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSA 505

Query: 447 SIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT-VETQVNS------DGKHLLKGY 499
           +++ ++ +P E QG+  +LV +V+NY  ++   +  T ++ Q  S      D K  LKG 
Sbjct: 506 TLLLTNGIPPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGI 565

Query: 500 RGAQYLGIGLASLACMISGLY 520
             A  +G+G + +A +I G+Y
Sbjct: 566 HIAGAVGVGCSGIAVLI-GIY 585

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 72/149 (48%), Gaps = 6/149 (4%)

Query: 73  FTC-MISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDI 131
           F C +I+  L+ A     + ++  +   F        W + S+ +    FI   GR+GDI
Sbjct: 25  FICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDI 84

Query: 132 YGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV 191
            G   M+ V  V+  I+SL+C +     + T F   RAFQG+  A ++P    ++  ++ 
Sbjct: 85  VGNGIMMCVFSVIFGIFSLLCAVVPNFIAFTVF---RAFQGMAGAGIVPCAYALVNKMFQ 141

Query: 192 GGTFRK--NIVISFVGAMAPIGATLGCLF 218
           G   ++  +I+ S + AMA +G  +G  F
Sbjct: 142 GPNLQRYFSILSSVISAMAGVGFIIGGAF 170

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 66/130 (50%), Gaps = 7/130 (5%)

Query: 45  SEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEG 104
            E E++   QK+   N    A  ++  +F+  +   L+   +T   +IMN +++ F SE 
Sbjct: 15  EEAEVLPLEQKYHEYNL---ALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SES 70

Query: 105 NSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFF 164
           + K W+  SF L + +F  + G+L DI G +  LL        + L C +T ++ + T F
Sbjct: 71  SKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQ---FFFGLGCLMTCFARNVTEF 127

Query: 165 IISRAFQGLG 174
            I+RA  G+G
Sbjct: 128 SIARAVCGIG 137

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 3/122 (2%)

Query: 60  NYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSG 119
           N+   ++  Y+ +   M+S   +    T  LS    + +++  E  + SW + ++ +   
Sbjct: 15  NFQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFA 74

Query: 120 SFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVL 179
            FI   GR+GDI G   + +    L  I SLIC +    G+   F + RA QG+  A ++
Sbjct: 75  GFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFRALQGIAAAGIV 131

Query: 180 PN 181
           P+
Sbjct: 132 PS 133

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/213 (19%), Positives = 90/213 (42%), Gaps = 7/213 (3%)

Query: 323 LLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGI 382
           L+P+ V+  ++ I I +A+F  +G      +   Q+   + + + L A       ++  +
Sbjct: 303 LIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSML 362

Query: 383 IAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVH----ETYFRTQLGTMIILSFG 438
           I  +++      +SP   +        +GSI+  +  +H      Y++    +  +++FG
Sbjct: 363 IPNVVIAIKSDLISPRKAVVLGFFIMFIGSII--LIQLHLITDNLYWKIFFCSQSLIAFG 420

Query: 439 MDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNS-DGKHLLK 497
             + FP S  I     P EY+G+A  ++ T   + + +   +  ++   +N   GK    
Sbjct: 421 AAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKSGSA 480

Query: 498 GYRGAQYLGIGLASLACMISGLYMVESFIKGRR 530
           G    ++      +LA  + GL     F+K  +
Sbjct: 481 GIYKTRFQNCTYFTLASSVVGLISTAFFVKENK 513

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 7/130 (5%)

Query: 45  SEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEG 104
            E E +   QK+   N    A  ++  +F+  +   L+    T   +IMN +++ F SE 
Sbjct: 15  EEVETLPLEQKFHEYNL---ALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF-SES 70

Query: 105 NSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFF 164
           + K W+  SF L + +F  + G+L DI G K  LL  +     + + C +T ++ + T F
Sbjct: 71  SRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAH---FFFGIGCLLTCFARNVTEF 127

Query: 165 IISRAFQGLG 174
            I+RA  G+G
Sbjct: 128 SIARAICGIG 137

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 62/118 (52%), Gaps = 4/118 (3%)

Query: 57  QNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPL 116
           Q  + +  A  ++  +F+  +   L+   +T   +IMN +++ F SE + K W+  SF L
Sbjct: 24  QKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLL 82

Query: 117 VSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLG 174
            + +F  + G+L DI G K  LL+       + L C +T ++ + T F I+RA  G+G
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALLIAQ---FFFGLGCLLTCFARNVTEFSIARAICGIG 137

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 57  QNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPL 116
           Q  + +  A  ++  +F+  +   L+   +T   +IMN +++ F SE + K W+  SF L
Sbjct: 24  QKFHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLL 82

Query: 117 VSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLG 174
            + +F  + G+L DI G K  LL        + L C +T ++ + T F I+RA  G+G
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALLTAQ---FFFGLGCLLTCFARNVTEFSIARAICGIG 137

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 59/126 (46%), Gaps = 8/126 (6%)

Query: 55  KWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASF 114
           K QN  Y +      L  F C    LLN AG    +S++  L +++       SW + S+
Sbjct: 18  KCQNSRY-QLGINITLIFFGCTF-DLLNVAGV---ISVIEDLGETYKLGYTGASWALTSY 72

Query: 115 PLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLG 174
            +    FI   GRLGDI G   +  +   L  ++SL+C + +   +   F + RA QG+ 
Sbjct: 73  AITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPT---FAVFRALQGIS 129

Query: 175 IAFVLP 180
            A ++P
Sbjct: 130 AAGIVP 135

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 102/239 (42%), Gaps = 14/239 (5%)

Query: 31  NNIGESLTATAFTQSEDEMVDSNQKWQN-PNYFKYAWQEYLFIFTCMISQLLNQAGTTQT 89
           N +G+  T++  +  E E     +  QN P+      Q++  +F   I+   +  G+   
Sbjct: 51  NELGDDDTSSECSHDEQEQQHIVEGEQNYPHTLLTYRQKWFMVFLMTITGFWSSLGSPIY 110

Query: 90  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 149
              +  L   F  + N  +  +  + L  G    ISG L D+YG + ++L G ++ ++ S
Sbjct: 111 YPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVAS 170

Query: 150 LICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA--- 206
           +  GI K + S    +  R  Q +GI+  +    G++ +  V     K    +FVGA   
Sbjct: 171 I--GIAK-APSYGVIVFLRCIQSIGISPTIAISSGVVSDFTV-----KRERGTFVGATSG 222

Query: 207 MAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSM 265
           +  IG  +G L   +I       W   F+  +I      ++  + +P T  T + + S+
Sbjct: 223 LVLIGQGIGPLLGAVITAA--LHWRAVFWFLTIGCGSCMIIGFFLLPETKRTIVGNLSI 279

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 119/299 (39%), Gaps = 43/299 (14%)

Query: 1   MGNQSLVVLTESKGEYENET--------------ELPVKK-------------SSRDNNI 33
           M N+S++   E    ++ ET              E+P  K             ++R+ N 
Sbjct: 1   MSNESIIYTDEEDESFQEETRTYEGDIKAKKDNIEIPATKDGLYHLHGTLSRTTTREINE 60

Query: 34  GESLTATAFTQSEDEMVDSNQKWQN-----PNYFKYAWQEYLFIFTCMISQLLNQAGTTQ 88
           GE         S D + D  +  Q      P       Q++  +F  ++    +  G+  
Sbjct: 61  GEDDEEDGEDSSLDTVPDEEKLEQTSESTAPYTLLSYKQKWGMVFLLVMCGFWSSLGSPI 120

Query: 89  TLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIW 148
               +  L   F  + N  +  +  + L  G    +SG L D++G + ++L G V+ ++ 
Sbjct: 121 YYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVA 180

Query: 149 SLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMA 208
           S+        G   F    R  Q +GI+  +    G++G+  +     K+   +FVGA +
Sbjct: 181 SIGLACAPSYGVICFL---RCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATS 232

Query: 209 PIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAAFINFVLSIYAIPSTIPTNIHHFSM 265
            +   LG  F  LIG     +W W   F+  +I + +  +++ + +P T  T + + S+
Sbjct: 233 GL-VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 10/146 (6%)

Query: 36  SLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNI 95
           ++  TA  +  + + +  ++ QN  Y +      L    C    LLN AG    +S++  
Sbjct: 3   NMHTTAAPKLSEGIYNLRRRCQNSKY-QLIINMALIFLGCTF-DLLNVAGV---ISVIED 57

Query: 96  LSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICG-I 154
           L +++G E  + SW + S+ +     I   GRLGDI G   +  +      ++ L+C  +
Sbjct: 58  LGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVV 117

Query: 155 TKYSGSDTFFIISRAFQGLGIAFVLP 180
           T +      F + RA QG+  A ++P
Sbjct: 118 TNFPA----FAVLRALQGIAAAGLVP 139

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 45/226 (19%), Positives = 88/226 (38%), Gaps = 13/226 (5%)

Query: 323 LLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGI 382
           L+PR V+   + I I L      G      +   Q+   + + + L AG      +I  +
Sbjct: 310 LIPRDVLFMTNFIPITLGFLCNGGCLYSNIYIIDQYSQYVDKNSPLLAGVKLVPLIITMV 369

Query: 383 IAALLVGFTIKNVSPSVFLFFSMVAFNVGSI-MASVTPVHET-YFRTQLGTMIILSFGMD 440
           I   +       + P + +    ++   GSI +  +  V E  Y++    + I++ FG  
Sbjct: 370 IGNTICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVEENLYWKIMFCSQILVGFGAA 429

Query: 441 LSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE---TQVNSDG---KH 494
           + +P +  +   + P   +G+A  +  T     + +   +  +V    TQV S     + 
Sbjct: 430 IFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVSVLGNITQVKSRPDSFER 489

Query: 495 LLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYDCT 540
              G++   Y      +LA    GL +   F++G R    +  D T
Sbjct: 490 FRDGFQKCTYF-----TLASGAFGLVLTTFFVRGPRFSNGSPKDAT 530

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 79/172 (45%), Gaps = 11/172 (6%)

Query: 96  LSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT 155
           L   FG + N  +  +  + L  G    ISG L D++G + ++L+G ++ ++ S+     
Sbjct: 117 LEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGLACA 176

Query: 156 KYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG 215
              G   F    R  Q +GI+  +    G++G+  +     K+   +FVGA + +   LG
Sbjct: 177 PSYGVIVFL---RIIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGL-VLLG 227

Query: 216 CLFAGLIGTEDPKQWPWA--FYAYSIAAFINFVLSIYAIPSTIPTNIHHFSM 265
             F  LIG      W W   F+  +I    +F+++   +P T  T + + S+
Sbjct: 228 QCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPETKRTLVGNLSI 279

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 88/205 (42%), Gaps = 24/205 (11%)

Query: 17  ENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCM 76
           E  + LP++ S  D   GE          ED  ++      N +  K+       + +  
Sbjct: 6   ETSSLLPIRSSIED---GE----------EDNGLEEQYHEYNLSLPKFP-----ILLSLW 47

Query: 77  ISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKK 136
           +   L+   +T   +IMN +++ F  E + K W+  SF L + +F  + G+L DI G K 
Sbjct: 48  LGSFLSSLDSTIVANIMNKVAEEF-EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 106

Query: 137 MLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFR 196
            +L  +     + L C +T ++ + T F I+RA  G+G   V  N +  I    +  T  
Sbjct: 107 AVLTSH---FFFGLGCFLTCFAQNITQFSIARAICGIGAGGV--NAMSSITVSDICSTRE 161

Query: 197 KNIVISFVGAMAPIGATLGCLFAGL 221
           + I   +   +  +G  LG    GL
Sbjct: 162 RGIYQGYANIVFGLGQLLGAPLGGL 186

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 103/511 (20%), Positives = 190/511 (37%), Gaps = 68/511 (13%)

Query: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKML 138
            LLN A     +S+++ L+ ++     + SW + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVA---SMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 139 LVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKN 198
            +      + SL+C +     +   F + RA QG+  A ++P    +I  +      +K 
Sbjct: 98  TISCSCFAVLSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 199 IVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINF--------VLSIY 250
             I   G  + IG  LG +  G   T         +  +++   I+         V  + 
Sbjct: 155 FSIVSCGFSSTIG--LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLN 212

Query: 251 AIPSTIPTNIHHFSMDWIGSXXXXXXXXXXNF-------VWNQAPIS------------- 290
             P     +    S+D+IGS                    WN+ P++             
Sbjct: 213 KKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNR-PVTYVTLVIGIILFFG 271

Query: 291 --GWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLL-PRAVIKDRHMIQIMLALFFGWGS 347
              WN  Y                 +E    K  LL P  V+  ++ I I+LA  F   +
Sbjct: 272 FFVWNCTYTKIVRGFKYCGIDTSKYFE----KVQLLIPIDVLFMKNFIPIVLA--FALNN 325

Query: 348 FGIFTFYYF--QFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFL---F 402
             +F+  Y   Q+     + + L AG      +I  +I   L  F    + P V +   F
Sbjct: 326 ACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGF 385

Query: 403 FSMVAFNVGSIMASVTPVHETYF-RTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGM 461
           F  +A ++  I+  +  V E  F +       ++ FG+ + +P +  I     P E +G+
Sbjct: 386 FLALAGSI--ILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGI 443

Query: 462 AGSLVNTVVNYSMSLCLGMGATVETQVNS-DGK-----HLLKGYRGAQYLGIGLASLACM 515
           A  +  T     + +   + A+V   +N   GK         G++   Y  + + +L  +
Sbjct: 444 ASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFL 503

Query: 516 ISGLYMVE--------SFIKGRRARAAAEYD 538
           ++ + + +        S ++    R   E+D
Sbjct: 504 VTAICIRDIPPLNDDMSDLESSVHRTKVEFD 534

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 69/146 (47%), Gaps = 8/146 (5%)

Query: 27  SSRDNNIGESLTATAFTQS-EDEMVDSNQKWQNPNYFKYAWQ--EYLFIFTCMISQLLNQ 83
             R N + ++L   + + + EDE    N   +   Y K+     +   +F+  +   L  
Sbjct: 7   DERTNLLPDTLDPQSLSLNLEDEFNRKNSSLEE-EYHKHNLDLPKLPIVFSLWMGSFLGA 65

Query: 84  AGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYV 143
              T   +IMN +++ F  E + K W+  SF L + +F  + G+L DI G K  LLV + 
Sbjct: 66  LDGTIVANIMNRVAEEF-QESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHT 124

Query: 144 LVIIWSLICGITKYSGSDTFFIISRA 169
               + L C +T ++ + T F I+RA
Sbjct: 125 F---FCLGCLLTCFARNVTEFSIARA 147

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 100/240 (41%), Gaps = 8/240 (3%)

Query: 19  ETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMI- 77
           E+E  ++K S++    E   ATA +  E  +  +N+  + P Y  ++ ++ L IF  +I 
Sbjct: 88  ESEEDIEKKSKEELKIEKRIATATSTEETSLKSANRSKEPPPYTAFSKKQRLIIFLVIIY 147

Query: 78  SQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKM 137
              L        +  + +L +SF     + +  ++ F  V     L      D  G K +
Sbjct: 148 VGFLGPLSGNIYIPALPLLQESFNVSATTINATVSVFMAVFSVGPLFWALFADFGGRKFL 207

Query: 138 LLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRK 197
            +V  +L II +++      +    FF+  R  Q  G + V+   +G + +I    +  +
Sbjct: 208 YIVSLLLTIIVNILLSAVPTNIGALFFL--RIAQAFGSSSVMSLGIGTVSDITPPKSRGR 265

Query: 198 NIVISFVGA-MAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTI 256
            +    +G  M PI   L  + AGLI       W W F    I + I   L +  +P T+
Sbjct: 266 AVSYFMLGPNMGPI---LAPIIAGLILMSS-NNWRWLFGFICIISGIALFLVVLLLPETL 321

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 102/259 (39%), Gaps = 28/259 (10%)

Query: 2   GNQSLVVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNY 61
           G  S     E +G+ ++ET       S D+ +  +   TA T++   ++   QKW     
Sbjct: 50  GTLSKTTTREIEGDLDSETS----SHSSDDKVDPTQQITAETKAPYTLLSYGQKWG---- 101

Query: 62  FKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSF 121
                     +    +    +  G+      +  L   F  + N  +  +  + L  G  
Sbjct: 102 ---------MVAILTMCGFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGIS 152

Query: 122 ILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPN 181
             +SG L D +G + ++L G ++ +I S+        G   F    R  Q +GI+  +  
Sbjct: 153 PTVSGGLADCFGRRPIILAGMLIYVIASIGLACAPSYGVIIFL---RCIQSIGISPTIAI 209

Query: 182 VLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSI 239
             G++G+  +     K+   +FVGA +     LG  F  LIG     +W W   F+  +I
Sbjct: 210 SSGVVGDFTL-----KHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDWRAIFWFLTI 263

Query: 240 AAFINFVLSIYAIPSTIPT 258
                F+++   +P T  T
Sbjct: 264 GCGSCFLIAFLILPETKRT 282

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 100/259 (38%), Gaps = 28/259 (10%)

Query: 2   GNQSLVVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNY 61
           G  S     E +G+ E+ET       S D+ I      TA T +   ++   QKW     
Sbjct: 50  GTLSKATTREIEGDLESETS----SHSGDDKIDPQQQITAETGAPYTLLSYGQKWG---- 101

Query: 62  FKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSF 121
                     +    +    +  G+      +  L   F  + N  +  +  + L  G  
Sbjct: 102 ---------MVAILTMCGFWSSLGSPIYYPALRQLEKQFNVDENMINITVVVYLLFQGVS 152

Query: 122 ILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPN 181
             ISG L D +G + ++L G ++ ++ S+        G   F    R  Q +GI+  +  
Sbjct: 153 PTISGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFL---RCIQSIGISPTIAI 209

Query: 182 VLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSI 239
             G++G+  +     K+   +FVGA +     LG  F  LIG     +W W   F+  +I
Sbjct: 210 SSGVVGDFTL-----KHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDWRSIFWFLTI 263

Query: 240 AAFINFVLSIYAIPSTIPT 258
                F+++   +P T  T
Sbjct: 264 GCGSCFLIAFLVLPETKRT 282

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 6/136 (4%)

Query: 86  TTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLV 145
           +T   +IMN +++ F +E + K W+  SF L + +F  + G+L DI G K  +L  +   
Sbjct: 60  STIVANIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFF- 117

Query: 146 IIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVG 205
             + L C +T ++ + T F I+RA  G+G   +  N +  I    +  T  + I   +  
Sbjct: 118 --FGLGCLLTCFAQNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYAN 173

Query: 206 AMAPIGATLGCLFAGL 221
            +  +G  LG    GL
Sbjct: 174 IVFGMGQVLGAPLGGL 189

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 7/138 (5%)

Query: 37  LTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNIL 96
           L +   T S  +  D  + +   N    A  +   +++  +   L    +T   +IMN +
Sbjct: 11  LLSNRITSSSADEDDLEEMYHRHNL---ALPKGPILYSLWMGSFLGSLDSTIVANIMNKV 67

Query: 97  SDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITK 156
           ++ F  E + K W++ SF L + +F  + G+L D+ G K  L+V +   ++    C  T 
Sbjct: 68  AEEF-EESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVG---CLFTA 123

Query: 157 YSGSDTFFIISRAFQGLG 174
            S +   F I+RA  G+G
Sbjct: 124 LSRNLVEFSIARAVCGMG 141

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           +IMN +++ F SE + K W+  SF L + +F  + G+L D+ G K  LL+ Y  ++I   
Sbjct: 57  NIMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG-- 113

Query: 151 ICGITKYSGSDTFFIISRA 169
            C +T  + + T F ++RA
Sbjct: 114 -CLLTCLARNVTEFAVARA 131

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 94/484 (19%), Positives = 179/484 (36%), Gaps = 60/484 (12%)

Query: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKML 138
            LLN A     +S+++ L+  +     + SW + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVA---SMISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 139 LVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKN 198
            +      I SL+C +     +   F + RA QG+  A ++P    +I  +      +K 
Sbjct: 98  TISCSCFAILSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 199 IVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAI------ 252
             I   G  + IG  LG +  G             +  +++ + I+ +   +        
Sbjct: 155 FSIVSCGFSSTIG--LGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFD 212

Query: 253 --PSTIPTNIHHFSMDWIGSXXXXXXXXXXNF-------VWNQAPIS------------- 290
             P  I       S+D+IGS                    WN+ P++             
Sbjct: 213 KKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNR-PVTYVTLIIGILLFFG 271

Query: 291 --GWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLL-PRAVIKDRHMIQIMLALFFGWGS 347
              WN  Y                 +E    K  LL P  V+  ++ I I+LA  F   +
Sbjct: 272 FFVWNCTYAKIVRGIRFVGIDTSKYFE----KVQLLIPVDVLFMKNFIPIVLA--FALNN 325

Query: 348 FGIFTFYYF--QFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSM 405
             +F+  Y   Q+     + + L AG      +I  ++   L  F    + P V +    
Sbjct: 326 ACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGF 385

Query: 406 VAFNVGSIMASVTPVH----ETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGM 461
                GSI+  +  +H      +++    +  ++ FG+ + +P +  I     P + +G+
Sbjct: 386 SLALAGSII--LIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGI 443

Query: 462 AGSLVNTVVNYSMSLCLGMGATVETQVNS-DGK-----HLLKGYRGAQYLGIGLASLACM 515
           A  +  T     + +   + A+V   +N   GK     +   G++   Y  + + +L  +
Sbjct: 444 ASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFL 503

Query: 516 ISGL 519
           ++ +
Sbjct: 504 VTAI 507

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 6/131 (4%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           +IMN +++ F  E +   W+  SF L S  F  I G+L D+ G + +L++ Y L +   L
Sbjct: 69  NIMNSVTEEF-KESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFL---L 124

Query: 151 ICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 210
            C +T Y+ +   F   RA  G+G   +    +  +G+++      ++I  S+   +  I
Sbjct: 125 GCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMF--SVKEQSIYQSYAHIIYTI 182

Query: 211 GATLGCLFAGL 221
           G  LG    G+
Sbjct: 183 GEVLGAPIGGI 193

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/259 (21%), Positives = 101/259 (38%), Gaps = 28/259 (10%)

Query: 2   GNQSLVVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNY 61
           G  S     E +G+ E+ET       S D+ +  SL  T  T +   ++   QKW     
Sbjct: 50  GTLSKATTREIEGDLESETS----SHSGDDKLDPSLPITTETGAPYTLLSYGQKWG---- 101

Query: 62  FKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSF 121
                     +    +    +  G+      +  L   F  + N  +  +  + +  G  
Sbjct: 102 ---------MVAVLTMCGFWSSLGSPIYYPALRQLEKEFNVDENMINITVVVYLMFQGIA 152

Query: 122 ILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPN 181
             + G L D +G + ++L G ++ ++ S+        G   F    R  Q +GI+  +  
Sbjct: 153 PTVCGGLADCFGRRPIILGGMLVYVVASVGLACAPSYGVIIFL---RCVQSIGISPTIAI 209

Query: 182 VLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSI 239
             G++G+  +     K+   +FVGA +     LG  F  LIG     +W W   F+  +I
Sbjct: 210 SSGVVGDFTL-----KHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDWRSIFWFLTI 263

Query: 240 AAFINFVLSIYAIPSTIPT 258
                F+++ + +P T  T
Sbjct: 264 GCGTCFLIAFFILPETKRT 282

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 3/91 (3%)

Query: 86  TTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLV 145
            +  +S+++ LS  +     + SW + S+ +    FI   GRLGDI G  ++  V     
Sbjct: 45  VSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCF 104

Query: 146 IIWSLICGITKYSGSDTFFIISRAFQGLGIA 176
            I SL+CG+     +   F + RA QG+  A
Sbjct: 105 AILSLLCGLMPNFEA---FAVMRALQGIAAA 132

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 99/479 (20%), Positives = 178/479 (37%), Gaps = 54/479 (11%)

Query: 79  QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKML 138
            LLN A     +S+++ L+  +     + SW + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVA---SMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILF 97

Query: 139 LVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKN 198
            V      I SL+C +     +   F + RA QG+  A ++P    +I  +      +K 
Sbjct: 98  TVSCFFFAILSLLCAVMPNFPA---FAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQKY 154

Query: 199 IVISFVGAMAPIGATL---GCLFAGLIGTEDPKQWPWA-FYAYSIAAFINF--VLSIYAI 252
             I   G  + IG  L   G   A  IG +      +A  +  SI AF     V ++   
Sbjct: 155 FSIVSCGFSSTIGLGLIIGGAFAATKIGYKGIFYLTFAVMFLISIVAFFFTYGVENLSEP 214

Query: 253 PSTIPTNIHHFSMDWIGSXXXXXXXXXX-------NFVWNQAP--------------ISG 291
           P          S+D+IGS                    WN+                   
Sbjct: 215 PRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEGGESWNRPATYVTLVIGIILFFGFFF 274

Query: 292 WNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLL-PRAVIKDRHMIQIMLALFFGWGSFGI 350
           WN +Y                 +E    K  LL P  V+  ++ I I+LA  F   +  +
Sbjct: 275 WNCSYARIVRGIRCCGIDTSRYFE----KVQLLIPVDVLFMKNFIPIVLA--FALNNACL 328

Query: 351 FTFYYF--QFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAF 408
           F+  Y   Q+     + + L+AG      +I  +I   L  F    + P V +       
Sbjct: 329 FSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCAFESTKLKPKVGVVLGFSLA 388

Query: 409 NVGSIMASVTPVH----ETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGS 464
             GSI+  +T +H    + +++    +  ++ FG+ + +P +  I     P   +G+A  
Sbjct: 389 LAGSII--LTQLHLIKEDMFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDRSKGIASG 446

Query: 465 LVNTVVNYSMSLCLGMGATVETQVN------SDGKHLLKGYRGAQYLGIGLASLACMIS 517
           +  T     + +   + A+V   ++         +    G++   Y  + + +L  +++
Sbjct: 447 VAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRTGFQNCTYFTVAVGALGFLVT 505

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 69/147 (46%), Gaps = 13/147 (8%)

Query: 31  NNIGES---LTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTT 87
            N+ E+   L  T  T  +D +    Q++   N    +  +   + +  +   L+    T
Sbjct: 2   ENLDETTGLLEQTPDTTEQDAL---EQEYHEHNL---SLPKLPIVLSLWLGSFLSSLDGT 55

Query: 88  QTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
              +IMN +++ F  E + K W+  S+ L + +F  + G+L D+ G K  +L  +     
Sbjct: 56  IVANIMNRVAEEF-QESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAH---FF 111

Query: 148 WSLICGITKYSGSDTFFIISRAFQGLG 174
           + L C +T ++ S T F I+RA  G+G
Sbjct: 112 FGLGCLLTCFANSVTQFAIARAICGVG 138

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 68/144 (47%), Gaps = 11/144 (7%)

Query: 124 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVL 183
           ISG L D+YG + ++L G ++ ++ S+    +   G   F    R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFL---RCVQSAGISPLIAISS 208

Query: 184 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAA 241
           G++G+        K+   SFVGA++   A +G  F  LIG      + W   F+  +I  
Sbjct: 209 GVVGDFTT-----KSERGSFVGAVSGF-ALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 242 FINFVLSIYAIPSTIPTNIHHFSM 265
              FV++ + +P T  T   + S+
Sbjct: 263 GTCFVINFFLLPETKRTITGNLSI 286

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 91  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
           +I+  L D   SE N     SW+  ++ L S +F  + G+L DI+G + +L+   ++  +
Sbjct: 158 TIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCL 217

Query: 148 WSLICGITK 156
            +LICG++K
Sbjct: 218 GALICGMSK 226

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 99/246 (40%), Gaps = 37/246 (15%)

Query: 11  ESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVD---SNQKWQNPN----YFK 63
           E  GE +   E+ V   S    I  S+   +   +E+   D   SN   + PN    Y K
Sbjct: 7   ELTGEGKKNPEILVSIDSF--GIEPSMEIASHGINEESGTDAEVSNHVEKKPNFNSKYGK 64

Query: 64  YAWQEYL----FIFTCMISQLLNQAGTTQTL----SIMNILSDSFGSEGNSKSWLMASFP 115
            A  E L     ++TC  S  L        +    +I+  ++  FG+   +  W+ A + 
Sbjct: 65  NAMGEDLPSGIVLYTCAFSLALAIFLAALDIMIVSTIIEDVAKKFGAYSKT-GWIFAGYS 123

Query: 116 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLG- 174
           L +    L+ GR+  I G K  +L   ++  I SLI G+   + S    I  R   G+G 
Sbjct: 124 LPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGV---ANSMNMLIGGRVIAGVGG 180

Query: 175 -----IAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQ 229
                +AFV       IG+  V    R+ ++I+ + +   + + +G    G   T     
Sbjct: 181 SGIQSLAFV-------IGSNLVDER-RRGLIIACMSSAFAVASVIGPFLGGAFTTH--AT 230

Query: 230 WPWAFY 235
           W W FY
Sbjct: 231 WRWCFY 236

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 81  LNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLV 140
           L  A  T   +IM  ++  F +E    SW+  ++ L S +F  + G+L DI+G K +L++
Sbjct: 91  LAAADGTLVSTIMAHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLML 149

Query: 141 GYVLVIIWSLICGIT 155
             ++ ++  L+CG+T
Sbjct: 150 NNIVFLVGCLMCGLT 164

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 11/106 (10%)

Query: 69  YLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRL 128
           YL IF   I   +    +    S  N LS          SW+  S+ L S +F  + G++
Sbjct: 118 YLGIFLAAIDNTIVSTTSAHVASEFNQLSKV--------SWIATSYLLSSATFQPLYGKV 169

Query: 129 GDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLG 174
            DI+G K +L+   V  +I  L+CG++K   S  + +I+R   G+G
Sbjct: 170 SDIFGRKCLLVFTNVAFLIGCLMCGLSK---SFWWLVIARFVAGVG 212

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           +IMN +++ F  E + K W+  SF L + +F  + GR  DI G K  LL+     ++ +L
Sbjct: 66  NIMNKIAEEF-HESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTL 124

Query: 151 ICGITKYSGSDTFFIISR 168
              +T ++ + T F I+R
Sbjct: 125 ---LTCFARNVTEFAIAR 139

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 61/143 (42%), Gaps = 10/143 (6%)

Query: 96  LSDSFGSEGNSKS---WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC 152
           L D+ G E N  +   WLMA + L +  F+L+ GR+  + GLK  L+   V+    SL+ 
Sbjct: 30  LYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMA 89

Query: 153 GITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGA 212
           G     G     I +R   G G + +   V G +G   V    R   VI+ +G    +  
Sbjct: 90  GAANSMG---MLIGARVISGFGGSGIESLVYG-VGTSIVEEKHRAR-VITVLGIAYMLAE 144

Query: 213 TLGCLFAGLIGTEDPKQWPWAFY 235
             G    G  G  +   W W FY
Sbjct: 145 GAGPFVGG--GLAEHVSWRWCFY 165

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 11/110 (10%)

Query: 124 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVL 183
           ISG L D+YG + ++L+G ++ +I S+    +K  G+  F    R  Q  GI+ ++    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINS 193

Query: 184 GIIGNIYVGGTFRKNIVISFVGAMAPIGATL-GCLFAGLIGTEDPKQWPW 232
           G+ G+  V     K+   +FVGA++  G TL G  F  LIG      + W
Sbjct: 194 GVAGDFTV-----KSERGTFVGAVS--GFTLMGQAFGSLIGAALTAAYDW 236

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 58/113 (51%), Gaps = 6/113 (5%)

Query: 44  QSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSE 103
           +SEDE  +  Q  +         + ++ I +  +   L     T   ++++ ++  F +E
Sbjct: 41  ESEDEAREGLQVSEMSRA-----RLHIIISSMCLGSFLAALDNTIVTTLLSHIASEF-NE 94

Query: 104 GNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITK 156
            +  SW+  ++ L S +F  + G++ DI+G + ++++  +  I+  LICG++K
Sbjct: 95  LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 100/252 (39%), Gaps = 17/252 (6%)

Query: 13  KGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQN----PNYFKYAWQE 68
           +G Y N      K ++R+  I   L +   + S D   DS Q+       P       Q+
Sbjct: 41  EGAYTNSHGTLSKATTRE--IEGDLESETSSHSGDVKGDSTQQITTEIGAPYTLLSYGQK 98

Query: 69  YLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRL 128
           +  +    +    +  G+      +  L   F  + N  +  +  + L  G    +SG L
Sbjct: 99  WGMVAILTMCGFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGL 158

Query: 129 GDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 188
            D +G + ++L G ++ ++ S+        G   F    R  Q +GI+  +    G++G+
Sbjct: 159 ADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFL---RCIQSIGISPTIAISSGVVGD 215

Query: 189 IYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAAFINFV 246
             +     K+   +FVGA +     LG  F  LIG     +W W   F+  +I     F+
Sbjct: 216 FTL-----KHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFL 269

Query: 247 LSIYAIPSTIPT 258
           ++   +P T  T
Sbjct: 270 IAFLILPETKRT 281

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 90  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 149
           ++I+N ++D F +  +   WL+  + L +  F L+ GR   I+G K  L+V  ++  I S
Sbjct: 41  VTILNTIADKFNAY-SKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 150 LICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 209
           L+  +   S S    I  R   G G + +   V  I  ++    T  +  +++ +     
Sbjct: 100 LVIAV---SNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSYA 154

Query: 210 IGATLGCLFAGLIGTEDPKQWPWAFY 235
           + + LG    G +   +   W W FY
Sbjct: 155 VASALGPYIGGAL--TEYVTWRWCFY 178

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 8/145 (5%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           +I++++++ FG+   +  WL+  + L +    LI GR   I G +  L++  ++    SL
Sbjct: 59  TIIDVVAEQFGNYSKT-GWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 151 ICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 210
           I  +   + S    I  R   G+G    L  +  +IG   VG   R  +VIS +     +
Sbjct: 118 IAAL---ASSMNMLIFGRVVAGVG-GSGLQTLCFVIGCTMVGERSRP-LVISILSCAFAV 172

Query: 211 GATLGCLFAGLIGTEDPKQWPWAFY 235
            A +G +  G   T     W W FY
Sbjct: 173 AAIVGPIIGGAFTTH--VTWRWCFY 195

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 6/114 (5%)

Query: 58  NPNYFKY--AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFP 115
           +  Y KY  +  ++  + +  +   L+   +T   +IMN +++ F  E   K W+  SF 
Sbjct: 21  DEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEEF-QESQEKQWIATSFL 79

Query: 116 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRA 169
           L + +F  + G+L DI G K  LL        + L C +T  S +   F I+RA
Sbjct: 80  LTNTAFQPLYGKLSDITGRKFALLTALSF---FGLGCFLTSLSTNIKQFAIARA 130

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 99/247 (40%), Gaps = 38/247 (15%)

Query: 8   VLTESKGEYENETELPVKKSSRDNNIGE-------SLTATAFTQSEDEMVDSNQKWQN-- 58
           +L+ES  +  N  E  V + + D N  +        +T      S  E ++ +    +  
Sbjct: 10  ILSESDAQSANHLEKEVHQLNHDGNKHKYEQDAPSRVTTHEMKGSSSESIEGHDIAHDNA 69

Query: 59  --PNYFKYAW----QEYLFIFTCMISQLLNQAGTTQTL------SIMNILSDSFGSEGNS 106
             P +  Y      Q++     CM++ LL  AG   +L        +  L   F      
Sbjct: 70  PLPQHAPYTLLSNAQKW-----CMVA-LLTSAGFWSSLGSPIYYPALKQLEKQFSVSEEL 123

Query: 107 KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFII 166
            +  +  + +  G    ISG L D+YG + ++L+G ++ +  S+    +   G   F   
Sbjct: 124 VNITVVVYLIFQGVAPTISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFL-- 181

Query: 167 SRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATL-GCLFAGLIGTE 225
            R  Q  GI+ ++    G++G+  V     K    +FVGA++  G TL G  F  LIG  
Sbjct: 182 -RCLQSAGISPIIAINSGVVGDFTV-----KQERGTFVGAVS--GFTLMGQAFGSLIGAA 233

Query: 226 DPKQWPW 232
               + W
Sbjct: 234 LTAAFDW 240

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 79/186 (42%), Gaps = 28/186 (15%)

Query: 75  CMISQLLNQAGTTQTLSIMNILSDSFG---SEGNSKSWLMASFPLVSGSFILISGRLGDI 131
           C+IS LL        + I+  L D+ G    +  +  WL+  + L +  F+L+ GRL +I
Sbjct: 10  CVISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEI 69

Query: 132 YGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV 191
            G K+ L++  ++  I SLI  +   S S    I  R   G G +       GI    +V
Sbjct: 70  LGTKECLMISVIVFEIGSLISAL---SNSMATLISGRVVAGFGGS-------GIESLAFV 119

Query: 192 GGT--FRKN---IVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFY--------AYS 238
            GT   R+N   I+I+ +     I   +G    G     +   W W FY        A+ 
Sbjct: 120 VGTSIVRENHRGIMITALAISYVIAEGVGPFIGG--AFNEHLSWRWCFYINLPIGAFAFI 177

Query: 239 IAAFIN 244
           I AF N
Sbjct: 178 ILAFCN 183

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 15/135 (11%)

Query: 105 NSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFF 164
           N   WL+  + L S  F L+ GR+  + GLK  L++  ++  I SLI  ++   G     
Sbjct: 78  NDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMG---ML 134

Query: 165 IISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVI----SFVGAMAPIGATLGCLFAG 220
           I  R   G G + +  +++ I+G   V    R  +++    +FVG+ A      G +  G
Sbjct: 135 IAGRVVAGAGGSGI-QSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAG-----GPILGG 188

Query: 221 LIGTEDPKQWPWAFY 235
            +   +   W W F+
Sbjct: 189 AL--NEHASWRWCFF 201

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           +IMN +++ F  E + K W+  SF L + +F  + G+L DI G +  LL  +     + L
Sbjct: 55  NIMNRVAEEF-EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAH---FFFGL 110

Query: 151 ICGITKYSGSDTFFIISRA 169
            C +T ++ S   F ++RA
Sbjct: 111 GCLLTCFAQSVEQFALARA 129

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 62/134 (46%), Gaps = 4/134 (2%)

Query: 36  SLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNI 95
           SL         +++ D  +  Q  +    A  +   + +  +   ++    T   +IMN 
Sbjct: 9   SLLPDPVESCPNDLPDDTKLEQEYHRDNMALPKGPILLSLWLGSFVSALDGTVVANIMNS 68

Query: 96  LSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT 155
           ++  F +E + K W+  S+ L + +F  + G+L DI G K  ++  +     ++L C +T
Sbjct: 69  IAAEF-AESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAH---FFFALGCLLT 124

Query: 156 KYSGSDTFFIISRA 169
            ++ + T F I+RA
Sbjct: 125 CFAQNVTQFSIARA 138

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 70/145 (48%), Gaps = 13/145 (8%)

Query: 124 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVL 183
           ISG L D+YG + ++L+G ++ +  S+    ++  G   F    R  Q  GI+ ++    
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFL---RCLQSAGISPIIAINS 197

Query: 184 GIIGNIYVGGTFRKNIVISFVGAMAPIGATL-GCLFAGLIGTEDPKQWPWA--FYAYSIA 240
           G++G+  +     K+   +FVGA++  G TL G  F  LIG      + W   F+  +I 
Sbjct: 198 GVVGDFTL-----KHERGTFVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIG 250

Query: 241 AFINFVLSIYAIPSTIPTNIHHFSM 265
                +++   +P T  T + + S+
Sbjct: 251 CGTCMIINFLILPETKRTLVGNLSI 275

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 91  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
           +I++ L     SE N     SW+  ++ L S +F  + G++ DI+G K +L+   V+  +
Sbjct: 147 TIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFAL 206

Query: 148 WSLICGIT 155
             LICG++
Sbjct: 207 GCLICGLS 214

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 92/225 (40%), Gaps = 12/225 (5%)

Query: 27  SSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGT 86
           S+ ++N  + L   A   S  E+V+ N+K  + +     +  Y  + +  ++  L+    
Sbjct: 2   SALEDNSSKELCTQA-ESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDI 60

Query: 87  TQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVI 146
               +I+  +S  F +E +   WL+  + L +    L+ GR   I G K  +L+  ++  
Sbjct: 61  LIVSTIIETVSRDF-NEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFE 119

Query: 147 IWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA 206
           + SL+  +   + S    I  R   G+G + +      II  +       + + IS +  
Sbjct: 120 VGSLVSAL---ANSMNMLIGGRVISGVGGSGLQTLCFLIISTLV--NERSRGMAISVLSC 174

Query: 207 MAPIGATLGCLFAGLIGTEDPKQWPWAFY---AYSIAAFINFVLS 248
              + + +G    G   T     W W FY        AF+ FVLS
Sbjct: 175 SFAVASIVGPFLGGAFTTH--VTWRWCFYINLPIGGLAFLVFVLS 217

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 100/245 (40%), Gaps = 19/245 (7%)

Query: 18  NETELPVKKSSRDNN---IGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFT 74
            +T+    KS  + +     E    TAFT  E E+        NP Y  ++  + + I  
Sbjct: 62  KDTDFDSDKSKEEQSSIVRNEKHPETAFTALEPEIA------YNPPYSAFSNYQVVSILL 115

Query: 75  CMIS-QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYG 133
            +I    L        +  + IL   F +   + +  +A+F  V      +     D  G
Sbjct: 116 IIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAINGTVAAFMGVFAVGPFLWAVHADFGG 175

Query: 134 LKKMLLVGYVLVIIWS-LICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVG 192
            K + +   ++ +I + L+  + K+  +     I R FQ +G + V+P  +G + ++   
Sbjct: 176 RKFLYIFSLMIALIANVLLAAVPKHLAA---LYILRVFQAIGTSAVIPLGVGTVSDLISP 232

Query: 193 GTFRKNIVISFVGA-MAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYA 251
               K +    +G  M PI   LG +F GLI   +  QW W F   SI   +  +L +  
Sbjct: 233 MNRAKGVSYFMLGPNMGPI---LGPIFGGLI-LMNGNQWRWLFGFTSITTGVGLILIVTF 288

Query: 252 IPSTI 256
           +P T+
Sbjct: 289 LPETL 293

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 18/130 (13%)

Query: 49  MVDSNQKWQNPNYFKYAWQE-YLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK 107
           ++D+++   +P   + A    YL IF   +S L N        +I++ L    GSE N  
Sbjct: 81  ILDNDKNNLSPTRLRLAMSSMYLGIF---LSALDN--------TIVSTLLARIGSEFNEL 129

Query: 108 ---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFF 164
              SW+  ++ L S +F  + G++ DI+G K +L    V   I  LICG  K   S    
Sbjct: 130 PRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAK---SFWVL 186

Query: 165 IISRAFQGLG 174
           +I R   G+G
Sbjct: 187 VIGRFISGVG 196

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 57/132 (43%), Gaps = 17/132 (12%)

Query: 109 WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISR 168
           WL+  + L +  F L+ GRL  I GLK  L    V+  I SLI  ++   G     I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMG---MIIGGR 102

Query: 169 AFQGLGIAFVLPNVLGIIGNIYVGGT-----FRKNIVISFVGAMAPIGATLGCLFAGLIG 223
              G G +       GI   ++V GT       + +VI+ +G    +   +G +  G   
Sbjct: 103 VVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAF- 154

Query: 224 TEDPKQWPWAFY 235
           TE+   W W FY
Sbjct: 155 TENVS-WRWCFY 165

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 91  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
           +I++ L     SE N     SW+  ++ L S +F  I G++ DI+G K +L+   +   +
Sbjct: 139 TIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFV 198

Query: 148 WSLICGIT 155
            SLICG++
Sbjct: 199 GSLICGLS 206

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 81/175 (46%), Gaps = 24/175 (13%)

Query: 314 YEIRFAKTPLLPRAVIKDRHMI-QIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGG 372
           +E +FAK PL P  ++KDR +   +++ALF  +  +   T+ Y    ++    T L A  
Sbjct: 324 WEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYKYTVLLVSFDT-TVLAATR 382

Query: 373 TYFMFLIWGIIAALLVG-FTIKNVSPSV-FLFF--SMVAFNVGSIMASVTPVHETYFRTQ 428
           T  MF   G+I A L+G F  K +  +  F+FF  SM   + G +       H      +
Sbjct: 383 TNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVSTGLLYRYRIGAH-----AK 437

Query: 429 LGTMI---ILSFGMD-LSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 479
           +GT++   +L FG   L FPA + I         Q  A +  N  +  S+ L LG
Sbjct: 438 VGTIVACCLLGFGNGFLKFPARASI---------QAAAYTHKNLAIITSLFLALG 483

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 91  SIMNILSDSFGSEGNS---KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
           +I++ L    GSE NS    SW+  S+ L S +   + G+L D  G K +L+   V+  I
Sbjct: 100 TIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSI 159

Query: 148 WSLICGITKYSGSDTFFIISRAFQGLG 174
             LICG+   S S  + ++ R   G+G
Sbjct: 160 GCLICGM---STSIWWVVVGRFVSGIG 183

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 109 WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISR 168
           WL+  + L +  F+L+ GRL +I G  + L++  V+  I SLI  ++   G+     +  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIA 106

Query: 169 AFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPK 228
            F G GI     ++  ++G   V   +R  I+I+ +     I   +G    G     +  
Sbjct: 107 GFGGSGI----ESLAFVVGTSIVQENYR-GIMITALAVSYVIAEGVGPFIGG--AFNEHL 159

Query: 229 QWPWAFY 235
            W W FY
Sbjct: 160 SWRWCFY 166

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 55/264 (20%), Positives = 99/264 (37%), Gaps = 30/264 (11%)

Query: 9   LTESKGEYENETELPVKKSSRDNNIGESLT----ATAFTQSEDEMVDSNQK--------- 55
           L     + E E    V     DN+ G S T    A  F Q    +   N K         
Sbjct: 8   LEPEPKKCEQEFVEDVNSPVEDNSSGTSPTGISPAEKFRQESSSIHTVNGKRVLQEYEVY 67

Query: 56  ----WQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLM 111
               ++ P + K  W     IF C +S   N +     LS+   +S  F     + +   
Sbjct: 68  DKLGYEFPQWKK--WSIVTVIFVCQLSMNFNGSVYPHALSL---ISKEFHVSSQAANTSQ 122

Query: 112 ASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQ 171
             F +  G    +     + YG + ++ +      IW ++ G     G+    I++R   
Sbjct: 123 MIFKVAYGFGCELWAPWSEEYGRRNIMQLSLFFTNIWQILGGKAPNFGT---IIVARFLG 179

Query: 172 GLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWP 231
           G+  A      LG++ +++          +++V   + +GA +G +F GL+  E+   W 
Sbjct: 180 GISQAGG-SVTLGVVADMWQPQD--HGYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWH 234

Query: 232 WAFYAYSIAAFINFVLSIYAIPST 255
           W F+   I   +  +L  + +P T
Sbjct: 235 WNFWIQLIFGGVTQLLHFFLVPET 258

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 52/250 (20%), Positives = 96/250 (38%), Gaps = 21/250 (8%)

Query: 10  TESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEY 69
           T     Y N+ +     +  D N    L  T   Q+E ++        +P Y ++   E 
Sbjct: 25  THKVRSYHNDDDDESVINISDINPKNQLCQTKSNQNEPDIA-------SPPYSRFGTTEK 77

Query: 70  L-FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRL 128
           +  +  C  +   +         +++++ + F       +  +  + +  G    I G L
Sbjct: 78  MILVIQCAFTGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGL 137

Query: 129 GDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 188
            D  G + ++L     V+++   C     S +    I+ R  Q  GI+ V+    GI+G+
Sbjct: 138 ADSMGRRPVVLSS---VLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGD 194

Query: 189 IYVGGTFRKNIVISFVGAMAPIGATLGCLF-AGLIGTEDPKQWPWA--FYAYSIAAFINF 245
           I       +   + +V     IG+  G L  AGL  T     W W   F+  +I + +  
Sbjct: 195 ITTRA--ERGGYVGYVSGFQVIGSAFGALIGAGLSAT-----WSWRSIFWFLAIGSGVCL 247

Query: 246 VLSIYAIPST 255
           V SI  +P T
Sbjct: 248 VASIIILPET 257

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 59/149 (39%), Gaps = 20/149 (13%)

Query: 93  MNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC 152
           + ++++ F     S  W+++ + L      L+ GR   I G K  LLV  ++    SLI 
Sbjct: 142 IEVIAEQFKDYSKS-GWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 153 GITKYSGSDTFFIISRAFQGLG------IAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA 206
            I   S S    I  R   G+G      + FV+ + L             + I+IS +  
Sbjct: 201 AI---SNSMNMLIGGRVVAGIGGSGIQSLCFVIASTL--------TPDRSRVIIISVLSC 249

Query: 207 MAPIGATLGCLFAGLIGTEDPKQWPWAFY 235
              + A +G    G + T     W W FY
Sbjct: 250 SYAVAAVVGPFLGGALTTH--VTWRWCFY 276

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 51/253 (20%), Positives = 105/253 (41%), Gaps = 30/253 (11%)

Query: 15  EYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKY-AWQEYLFIF 73
           E ++E    + K++ D  + E +  T   Q+E ++ ++      P Y ++ A  +   + 
Sbjct: 32  EVDSEDNDKMIKTNEDEAVKEPIYRTRSNQTEPDIANA------PPYSRFDAKYKMALVL 85

Query: 74  TCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYG 133
            C  + L +         +++++   F       +  +  + +  G    + G L D  G
Sbjct: 86  QCAYTGLFSTMAGAIYYPVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLG 145

Query: 134 LKKMLLVGYVLVIIWSLICGITKYSGSDTF--FIISRAFQGLGIAFVLPNVLGIIGNIYV 191
            + ++L  + + + +    G+   + + T+   ++ R  Q  GI+ V+    GIIG++  
Sbjct: 146 RRPVVL--FAVTVYFGACIGL---ACAQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTT 200

Query: 192 ----GGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAAFINF 245
               GG         +VG ++     LG  F  LIG     +W W   F+  +I + +  
Sbjct: 201 RAERGG---------YVGYISGF-QVLGSAFGALIGAGLSSRWGWRSIFWFLAIGSGVCL 250

Query: 246 VLSIYAIPSTIPT 258
           V SI  +P T  T
Sbjct: 251 VFSIIMLPETKRT 263

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 71/164 (43%), Gaps = 10/164 (6%)

Query: 75  CMISQLLNQAGTTQTLSIMNILSDSFG---SEGNSKSWLMASFPLVSGSFILISGRLGDI 131
           C+IS LL        + I+  L D+ G    +  +  WL+  + L +  F+L+ GRL +I
Sbjct: 10  CIISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEI 69

Query: 132 YGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV 191
            G  + L++  ++  + SLI  ++   G+    I  R   G G + +  ++  ++G   V
Sbjct: 70  LGTNECLMISVIIFEVGSLISALSNSMGT---LISGRLIAGFGGSGI-ESLAFVVGTSIV 125

Query: 192 GGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFY 235
               R  ++ +   +   I   +G    G     +   W W FY
Sbjct: 126 QENHRGTMITALATSYV-IAEGVGPFIGG--AFNEHLSWRWCFY 166

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 97/241 (40%), Gaps = 18/241 (7%)

Query: 28  SRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTT 87
           S D++I  SL     T  E+      Q+   P+     W ++  +    +    +  G+ 
Sbjct: 62  SDDSSIDTSLDGELSTPDEEA-----QEHTPPHSMLSYWNKWGMVAVLTMCGFWSSLGSP 116

Query: 88  QTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
                +  L   F  + N  +  +  + +  G    +SG L DIYG + ++L G ++ ++
Sbjct: 117 IYYPALKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRPVILFGMLVYVV 176

Query: 148 WSL-ICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA 206
            S+ I     Y       I  R  Q  GI+ ++    G +G+  V     K    +FVGA
Sbjct: 177 ASIGIAACNSYG----VIIFLRCLQSTGISPLIAISSGAVGDFTV-----KAERGTFVGA 227

Query: 207 MAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAAFINFVLSIYAIPSTIPTNIHHFS 264
           ++ +   +G  F  LIG      + W   F+  +I       ++   +P T  T + + S
Sbjct: 228 VSGL-VLMGQAFGSLIGAALAAAYNWRAIFWFLAIGCGACMAIAGIVLPETKRTLVGNLS 286

Query: 265 M 265
           +
Sbjct: 287 V 287

>Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 96/239 (40%), Gaps = 15/239 (6%)

Query: 17  ENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCM 76
           + E +L ++ SS  N+ G       F    +++ D     ++ +  +  +   L  FT M
Sbjct: 28  DREAKLDLELSSERNDDGGKEHEVIF---REDLADPEDIARHMSTVRRYYISSLITFTSM 84

Query: 77  ISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKK 136
           +  +++ + T  +  I+   S     E ++    +  F L  G   L    L ++YG + 
Sbjct: 85  VITMISSSWTLPSAHIIK--SFHISHEVSTLGITLYVFGLGIGPLFL--SPLSELYGRRI 140

Query: 137 MLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFR 196
             L    L IIW     +T +S + T  +  R   G   +  L    G I +I+     +
Sbjct: 141 TFLYALTLSIIWQC---LTIWSRTITGVMFGRFLSGFFGSAFLSVAGGAIADIFDKD--Q 195

Query: 197 KNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPST 255
             I ++     A +G +LG +  G +  E  K   W F    I +    VL ++ IP T
Sbjct: 196 IGIPMAIYTTSAFLGPSLGPIIGGALYHESYK---WTFITLLITSGCCLVLIMFTIPET 251

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 101/244 (41%), Gaps = 37/244 (15%)

Query: 32  NIGESLTATA-FTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTL 90
            IGE+  +T+  ++    M+  +QKW                   M+  LL  AG   +L
Sbjct: 44  KIGEACVSTSEISKIPHSMLRYSQKW-------------------MMVALLTSAGFWSSL 84

Query: 91  ------SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVL 144
                   +  L   FG   +  +  +  + L  G    +   L D YG + ++L+G ++
Sbjct: 85  GSPAVYPALRNLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVILMGMLI 144

Query: 145 VIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFV 204
            I+ S+  GI   S S    I  R  Q  GI+ ++    G++G+  +     K+   +F+
Sbjct: 145 FIVSSI--GIA-CSNSFALVIALRCIQSSGISPIIAINSGVVGDFTL-----KSERGTFI 196

Query: 205 GAMAPIGATLGCLFAGLIGTEDPKQWPW--AFYAYSIAAFINFVLSIYAIPSTIPTNIHH 262
           GA++ +   LG  F  LIG      + W   F+  +I   + F+ +   +P T    + +
Sbjct: 197 GAVSGL-TLLGQAFGSLIGASLTAAYNWRAVFWFMTIGCGVCFLANFLFLPETHRCIVGN 255

Query: 263 FSMD 266
            S+ 
Sbjct: 256 LSLK 259

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 10/167 (5%)

Query: 72  IFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKS---WLMASFPLVSGSFILISGRL 128
           ++ C+IS +L+       + I++ + ++   E    S   W+ A + L S    LI GR+
Sbjct: 54  LYACVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRI 113

Query: 129 GDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 188
             + G K  +L   ++  + SL+  +   + S    I  R   GLG + +      II  
Sbjct: 114 AAVCGFKSSMLTAIIIFEVGSLVAAL---ANSMDMLIGGRVIAGLGGSGIQTLCFVIIST 170

Query: 189 IYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFY 235
           +      ++ ++I+ +G+   I + +G    G   T     W W F+
Sbjct: 171 LVEES--KRGLLIACMGSAFGIASVVGPFLGGAFTTH--VTWRWCFW 213

>ZYRO0D11462g Chr4 (965863..967644) [1782 bp, 593 aa] {ON} similar
           to uniprot|Q12171 Saccharomyces cerevisiae YOR147W MDM32
           Mitochondrial Distribution and Morphology
          Length = 593

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 56/133 (42%), Gaps = 18/133 (13%)

Query: 316 IRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYF 375
           IRF K  L      +  HM Q      F +       F+  + +LN+ ++  LW  G   
Sbjct: 184 IRFNKVEL---KTSQQEHMEQDEKEPKFEFD----LKFHQIELKLNLMKW--LWGNGLIQ 234

Query: 376 MFLIWGIIAALLVGFTIKNVSPSVFL--FFSMVAFNVG--SIMASVTPVHETYFRTQLGT 431
              ++G+     V +  K+ SP  FL  +FS   +++G   I  S   VH+     Q+GT
Sbjct: 235 DISVFGMKGDAKVNYAYKSKSPKDFLIDWFSNKEYHLGRVQITDSSVNVHD----KQMGT 290

Query: 432 MIILSFGMDLSFP 444
              LS   DL  P
Sbjct: 291 KFKLSI-YDLEMP 302

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 13/135 (9%)

Query: 128 LGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 187
           L D  G + + ++ + L++++S+    T +S +   FII R   G   A V     G I 
Sbjct: 154 LADKNGRRTVYVLSFALLVVFSV---GTAFSRNIETFIILRILCGAASASVQSVGAGTIA 210

Query: 188 NIYVGGTFRKNIVISFVGA-MAPIGATLGCLFAGLIGTEDPKQWPWAFYAY--SIAAFIN 244
           ++YV     +N+   ++G  MAP       L + ++ +    +W W    +   I A + 
Sbjct: 211 DLYVPEERGRNLGYYYLGPLMAP-------LLSPIVSSLLVNRWSWRSTQWFMVILAALT 263

Query: 245 FVLSIYAIPSTIPTN 259
           F+L ++A+P T+ T 
Sbjct: 264 FLLLVFALPETLRTQ 278

>TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.242
           YNL065W
          Length = 602

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 97/249 (38%), Gaps = 19/249 (7%)

Query: 16  YENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQK-----WQNPNYFKYAWQEY- 69
           YENET   V  ++ D+N    L   +   S+    + N K       +P + ++   +  
Sbjct: 64  YENETMSHVNTNASDSNYMMELGDVSDQSSDKSNKNLNNKIDELDENSPPHSRFTRNDKI 123

Query: 70  LFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLG 129
           + I  C  +   +         ++ ++   F       +  +  + +  G   +I G L 
Sbjct: 124 MLIAQCAFTGFFSSIAGAIYYPVLTLIEGLFKITEEQANISVVVYFIFQGIAPIIVGNLA 183

Query: 130 DIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTF--FIISRAFQGLGIAFVLPNVLGIIG 187
           D  G + ++L    L+I +   C     +  +T+   I  R  Q  GIA V+    GI G
Sbjct: 184 DTNGRRPLIL--SCLLIYF---CACVGLASCNTYAQLIGLRCLQAAGIAPVIAINSGIAG 238

Query: 188 NIYVGGTFRKNIVISFVGAMAPIGATLGCLF-AGLIGTEDPKQWPWAFYAYSIAAFINFV 246
           +I       +   I +V     IG+  G L  AGL  T D   W   F+  +I + +  +
Sbjct: 239 DITTRR--ERGSYIGYVSGFVVIGSAFGALIGAGLSSTWD---WRAIFWFLAIGSGVCVI 293

Query: 247 LSIYAIPST 255
            SI   P T
Sbjct: 294 YSIILFPET 302

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 91  SIMNILSDSFGSEGNS---KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
           +I++ L    GSE NS    SW+  S+ L S +   + G+L D  G K +L+    +  I
Sbjct: 104 TIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAI 163

Query: 148 WSLICGITK 156
             LICG++ 
Sbjct: 164 GCLICGLSN 172

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 91  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
           +I++ L D   SE  +    SW+ AS+ L +  F  + G+L DI+G K +LL   ++  +
Sbjct: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229

Query: 148 WSLICG 153
             L+CG
Sbjct: 230 GCLVCG 235

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 63/146 (43%), Gaps = 7/146 (4%)

Query: 126 GRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGI 185
           G   D+ G K + L   +LV + +L+  +   + +  F +  R FQ  G + V+    G 
Sbjct: 167 GVYADVCGRKWLYLCSLILVTVINLLLAVLPANLASLFVL--RVFQAFGSSSVITLGSGT 224

Query: 186 IGNIYVGGTFRKNIVISFVGA-MAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFIN 244
           + +I       K I    +G  M PI   LG + AGLI   +   W W F    I + I 
Sbjct: 225 VTDITPMKHRGKAIAYFMLGPNMGPI---LGPIIAGLILI-NGDYWRWLFGFTCIMSAIG 280

Query: 245 FVLSIYAIPSTIPTNIHHFSMDWIGS 270
           F+L +  +P T+   + +    W  S
Sbjct: 281 FLLVLIFLPETLRCIVGNGDPRWRNS 306

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 8/119 (6%)

Query: 29  RDNNIGESLTATAFTQSEDEMV-----DSNQKWQNPNYFKY--AWQEYLFIFTCMISQLL 81
           ++N +  S T+ A +   + +V     DSN K +     KY  +  +   + +  +   L
Sbjct: 19  KNNAVNNSDTSLAKSGGYNSIVSGASSDSNNKPKLDPITKYNLSLSKGPILTSLWLGSFL 78

Query: 82  NQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLV 140
           +    T    IMN +++ F +  N K W+  S+ L + +F  + GRL DI G K   L+
Sbjct: 79  SALDATIVAVIMNRVAEDFNAS-NQKQWIATSYLLTNTAFQPLYGRLSDIIGRKYTQLI 136

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 91  SIMNILSDSFGSEGN---SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
           ++++ L    GSE N      W+  S+ L S  F  + G+L DI+G K +L+   ++   
Sbjct: 415 TVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFF 474

Query: 148 WSLICGITKYSGSDTFFIISRAFQGLG 174
             +ICG+   S S    +  R   G+G
Sbjct: 475 GCIICGM---SNSLNMLVWGRFVAGIG 498

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 61/136 (44%), Gaps = 22/136 (16%)

Query: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTF--FIISRAFQGL---GIAF 177
           L  GRLGDIYG K    +G + VI+  ++  + + + +D +  + I R   G+   GIA 
Sbjct: 122 LTLGRLGDIYGRK----IGLMCVILVYIVGIVIQIASTDKWYQYFIGRIISGMGVGGIAV 177

Query: 178 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTEDPKQWPWAFYA 236
           + P ++      ++ GT      +SF   M  +G  LG C   G     +  QW      
Sbjct: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSIQW------ 226

Query: 237 YSIAAFINFVLSIYAI 252
             +   +NF  +I+ I
Sbjct: 227 -RVPLGMNFAFAIFMI 241

>Smik_3.206 Chr3 complement(303825..304154) [330 bp, 109 aa] {ON}
           YBR008C (REAL)
          Length = 109

 Score = 31.6 bits (70), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 210 IGATLGCLFAGLIGTED--PKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNI 260
           IGA L  + A L+G      K W + F+  +  A  NFVL  + +P T+  N+
Sbjct: 6   IGAVLAPVMAPLLGASMMVAKGWRYIFWLLTWVATANFVLLFFFLPETLSDNV 58

>YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON}
           MCH5Plasma membrane riboflavin transporter; facilitates
           the uptake of vitamin B2; required for FAD-dependent
           processes; sequence similarity to mammalian
           monocarboxylate permeases, however mutants are not
           deficient in monocarboxylate transport
          Length = 521

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 83/185 (44%), Gaps = 27/185 (14%)

Query: 40  TAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMIS-----QLLNQAGTTQTLSIMN 94
           T+ T   D+  DSN++ ++  + +  ++ ++  F C +       LLN  G  ++    +
Sbjct: 80  TSSTHDSDKEEDSNEEIES--FPEGGFKAWVVTFGCFLGLIACFGLLNSTGVIES----H 133

Query: 95  ILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICG 153
           +  +   SE  S   WL + F  V  +  +ISG   D  G + +++VG V       + G
Sbjct: 134 LQDNQLSSESVSTIGWLFSLFLFVCSASCIISGTYFDRNGFRTIMIVGTVF-----HVAG 188

Query: 154 ITKYSGSDTF--FIISRAF-QGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 210
           +   + S  +  FI+S A   G G   VL  ++ +  + +     R+   +    AMA I
Sbjct: 189 LFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYFFK---RRGTAL----AMATI 241

Query: 211 GATLG 215
           G ++G
Sbjct: 242 GGSVG 246

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           ++MN +++ F  E + K W+  SF L + +F  + G+L D+   +K+  +         L
Sbjct: 62  NVMNRIAEEF-QESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGL 120

Query: 151 ICGITKYSGSDTFFIISRAFQGLG 174
           I  I+ ++ + T F I RA  G+G
Sbjct: 121 I--ISCFAQNVTQFAIGRAVCGIG 142

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 21/29 (72%)

Query: 314 YEIRFAKTPLLPRAVIKDRHMIQIMLALF 342
           +E +FA+ PL PR+V+KDR +I  ++  F
Sbjct: 320 WEAKFARFPLTPRSVLKDRGVIAALVIAF 348

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 83/190 (43%), Gaps = 11/190 (5%)

Query: 45  SEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEG 104
           ++DE  D + +    +   + W     ++T   +  L+   +T T S    + + F +  
Sbjct: 46  NDDEQGDLDDETTPLSRIPHLWLIEAALYT---NVFLSGFDSTVTASTYQTIGNEF-NHM 101

Query: 105 NSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFF 164
           +  SW+ AS+ + S SF  + G   D+ G +K L    ++  I  L CGI   S +  + 
Sbjct: 102 DLSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGI---SINILWL 158

Query: 165 IISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGT 224
              RAF G+G   +    L  I N  +  T ++ I  +F   +  +GA  G  F G+I +
Sbjct: 159 SFMRAFTGIGGGGL--ITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVITS 216

Query: 225 EDPKQWPWAF 234
                W W F
Sbjct: 217 S--IGWRWCF 224

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 1/93 (1%)

Query: 314 YEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGT 373
           +EI+FA+ PL P+  +K+R ++  ++ + F   ++ + + Y +   L     +   A   
Sbjct: 324 WEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRI 383

Query: 374 YFMFLIWGIIAALLVGFTIKNVSPSV-FLFFSM 405
             +F    +I   L GF +  V  +  F+FF +
Sbjct: 384 NKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGI 416

>KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.284
           YHR048W
          Length = 500

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 104/252 (41%), Gaps = 34/252 (13%)

Query: 11  ESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEY- 69
           E+  E  +E +L V ++ ++           F  + D + D +   +N +     W++Y 
Sbjct: 13  ETAMEVHSEIKLEVNETEKEE----------FEVTFDSIDDIDP--ENVSLRMSTWRKYY 60

Query: 70  ---LFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISG 126
              L  FT M+  +++   T  +  IM     S   E +     +  F L  G   L   
Sbjct: 61  ISLLITFTAMVITMISSCWTFVSPHIMAKYGIS--HEVSVLGITLYVFGLACGPLFL--S 116

Query: 127 RLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGII 186
            + ++YG +   +   VL +I+  +   T +S +    +  R   G    F   + L + 
Sbjct: 117 PISELYGRRITFIFSLVLSMIFQCL---TTWSATIEGVMFGRFLSG----FFGSSFLSVA 169

Query: 187 GNIYVGGTFRKN---IVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFI 243
           G   +   F KN   + ++F      +G +LG L +G + T    ++ W F  + I++ +
Sbjct: 170 GGT-ISDLFDKNQITVPMTFFTTAGLLGPSLGPLISGAMYT---VEYRWTFVLFLISSGV 225

Query: 244 NFVLSIYAIPST 255
            FVL I  +P T
Sbjct: 226 CFVLIILTVPET 237

>KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease;ureidosuccinate
           permease; expression is constitutive but sensitive to
           nitrogen catabolite repression
          Length = 521

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 69/174 (39%), Gaps = 10/174 (5%)

Query: 86  TTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLV 145
           T    SIM +  D     GN  SW+   F L    F + S      + + K   V  V +
Sbjct: 95  TNSYASIMGLRKD-LKMHGNQYSWVGTCFYLGYMIFEIPSSLALQRFPIAK---VSAVFI 150

Query: 146 IIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVG 205
           ++W  +  +T    +   FI +R   G+  + V P  + +    Y      + +  S   
Sbjct: 151 VLWGFVLCMTSLPKNYASFIATRTVLGILESAVTPAFMLLTSQWY--RREEQFLRTSIWS 208

Query: 206 AMAPIGATLGCLFAGLIGTEDPKQWPWAFYA--YSIAAFINFVLSI--YAIPST 255
           A A +GA LG L A  +   DP   P A +   Y +   +  VL +  + +P T
Sbjct: 209 ASAGLGAILGSLIAYGLAVRDPSSLPIASWRLLYVVLGVVTIVLGVAFFFVPDT 262

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 12/149 (8%)

Query: 91  SIMNILSDSFGSE---GNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147
           +I+  L  +  SE    N  SW+  S+ L   +F  + G+L D++G K +L+   +    
Sbjct: 50  TIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGF 109

Query: 148 WSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAM 207
             ++CG   ++ S     I R   G+G   +  N L  I    +    ++ +       M
Sbjct: 110 GCILCG-APFTKSLWMLCIGRFIAGVGGGGL--NSLSTITTSDIIPLRQRGV----YQGM 162

Query: 208 APIGATLGCLFAGLIGT--EDPKQWPWAF 234
             I   LGC    LIG   +    W WAF
Sbjct: 163 GNIVFALGCASGSLIGAFLQQRIGWRWAF 191

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 53/272 (19%), Positives = 107/272 (39%), Gaps = 38/272 (13%)

Query: 26  KSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQ-EYLFIFTCMISQLLNQA 84
           +SS D+ I E  ++  FT   D+  ++  +     Y ++  + ++  +  C  +   +  
Sbjct: 34  RSSFDHKIDEGESSEPFT---DDKSNTEPEDVPVPYTRFGPRAKFGLVMQCAFTGFFSSI 90

Query: 85  GTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVL 144
                  ++ ++   F       +  +  + +  G    + G L D  G +         
Sbjct: 91  AGAIYYPVLTVIEKKFSITEEQVNITVVVYFIFQGLSPSLMGGLADSLGRRP-------- 142

Query: 145 VIIWSLI-----CGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNI 199
           V++WS++     C     S + T  II R  Q  GI+ V+    GI+G++       +  
Sbjct: 143 VVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIMGDVTTKA--ERGG 200

Query: 200 VISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAAFINFVLSIYAIPSTIP 257
            + +V     +G+ LG     LIG     +W W   F+  +I +    ++S + +P T  
Sbjct: 201 YVGYVAGFQILGSALG----ALIGAALSSRWDWRAIFWFLAIGSGACALVSFFVLPETKR 256

Query: 258 TNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPI 289
           T + + S+                 V+N+API
Sbjct: 257 TVVGNGSIR-------------PKPVFNRAPI 275

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 57/135 (42%), Gaps = 11/135 (8%)

Query: 126 GRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGI 185
           G L D  G + ++L     ++++   C     S + T  ++ R  Q  GI+ V+    GI
Sbjct: 157 GGLADSLGRRPVVLFS---ILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAINSGI 213

Query: 186 IGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAAFI 243
            G+I       +   + +V     IG+     F  LIG      W W   F+  +I + I
Sbjct: 214 CGDITTRA--ERGAYVGYVSGFIVIGSA----FGALIGAGLSSTWGWRSIFWFLTIGSGI 267

Query: 244 NFVLSIYAIPSTIPT 258
             ++SI  +P T  T
Sbjct: 268 CLMISIIVLPETKRT 282

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 66/145 (45%), Gaps = 8/145 (5%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           +I+  ++  FGS  +   WL   + L +    LI GR+    G K+ +L   V+  I SL
Sbjct: 89  TIIEEVAKQFGSY-SEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSL 147

Query: 151 ICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 210
           I  +   + S +  I  R   G+G    + ++  +IG+  V  + ++ I+I+ +     I
Sbjct: 148 ISAL---ANSMSMLIGGRVIAGVG-GCGIQSLSFVIGSTLVEES-QRGILIAVLSCSFAI 202

Query: 211 GATLGCLFAGLIGTEDPKQWPWAFY 235
            + +G    G+  +     W W FY
Sbjct: 203 ASVVGPFLGGVFTSS--VTWRWCFY 225

>ZYRO0D12628g Chr4 (1069722..1071425) [1704 bp, 567 aa] {ON} similar
           to gnl|GLV|CAGL0A01243g Candida glabrata CAGL0A01243g
           and weakly similar to uniprot|P25346 YCR098C
           Saccharomyces cerevisiae GIT1 Plasma membrane permease
           mediates uptake of the phosphatidylinositol metabolite
          Length = 567

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 66/151 (43%), Gaps = 19/151 (12%)

Query: 39  ATAFTQSE---DEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQ-LLNQAGTTQTLSIMN 94
           ATA   SE   +E+VD   + +  N+ KY     L     + S   +N + +T +  +  
Sbjct: 48  ATALPNSELKEEELVDGQPRKKKRNFRKYG--AILTTGAGLFSDGYINTSISTVSACLKR 105

Query: 95  ILSDSFGSEGNSKSWLMASFPLVSGSFI--LISGRLGDIYGLKKMLLVGYVLVIIWSLIC 152
           +  D +    NS +    S    +G+ I  L  G   D Y  K  +++G  ++I++S++C
Sbjct: 106 VYKDEYA---NSSAMQNVSSIAFAGTVIGQLFFGWFADYYNRKVSMVIGTSIIIVFSILC 162

Query: 153 ------GITKYSGSDTFFIIS--RAFQGLGI 175
                 G T       F  I+  R F GLGI
Sbjct: 163 AGAWGVGTTATHAGGLFTAITAYRFFIGLGI 193

>ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]
           {ON} similar to uniprot|P38142 Saccharomyces cerevisiae
           YBR241C Hypothetical ORF
          Length = 488

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 21/135 (15%)

Query: 119 GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC-GITKYSGSDTFFIISRAFQGL--GI 175
           GSF   +G L D++G KK  L+  VL +  SL+  G   Y+      ++ R   GL  G+
Sbjct: 100 GSFF--AGPLADMFGRKKASLIASVLGLFGSLVLFGSNSYAA----LLVGRVIVGLASGV 153

Query: 176 AFVLPNV-LGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE--DPKQWPW 232
             V+ ++ +  I  I + G F         G+M  +    G L    +  +  D  +W W
Sbjct: 154 YVVITSLFINEICPIELKGAF---------GSMNQLSINSGILLTQTLALKLADTYRWRW 204

Query: 233 AFYAYSIAAFINFVL 247
             +A  IA+ INF L
Sbjct: 205 LMFAAGIASVINFFL 219

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 49/249 (19%), Positives = 98/249 (39%), Gaps = 29/249 (11%)

Query: 23  PVKKSSRDN-----NIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAW-QEYLFIFTCM 76
           P  +S RD      + GE+ +  A + S+ E V +   ++   Y +++  Q+ L +  C 
Sbjct: 15  PEGESERDEIGSGPDHGET-SGLAVSNSQSE-VGNESDFELEPYSRFSHTQKMLLVVQCA 72

Query: 77  ISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKK 136
            +   +    +    ++ ++   F       +  +  + +  G    I G L D +G + 
Sbjct: 73  FTGFFSTVAGSIYYPVLTVIEKKFNITEELANVTIVVYFVFQGLAPSIMGGLADTFGRRP 132

Query: 137 MLLVGYVLVIIWSLI---CGITKYSGSDTF--FIISRAFQGLGIAFVLPNVLGIIGNIYV 191
                   V++W+++   C     + S  +   +  R  Q  GI+ V+    GI+G++  
Sbjct: 133 --------VVLWAVLTYCCACIGLASSHNYAQILALRCLQAAGISPVIAINSGIMGDVTT 184

Query: 192 GGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAAFINFVLSI 249
                +   +  V     +G      F  LIG     +W W   F+  +I + I  V+S 
Sbjct: 185 --KVERGGYVGLVSGFQVVGTA----FGALIGAGLSSRWGWRAIFWFLAIGSGICLVVSA 238

Query: 250 YAIPSTIPT 258
             +P T  T
Sbjct: 239 LLLPETKRT 247

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 94/235 (40%), Gaps = 20/235 (8%)

Query: 1   MGNQSLVVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPN 60
           M N SL    E+K ++E + +  V     D     + +    T   ++ V  N +    +
Sbjct: 5   MSNPSLHS-KEAKQQHEQKRQFAV-----DQKFAHTSSEHDETSIPEDNVKKNVELSKGS 58

Query: 61  YFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGS 120
                   Y+ +    +S  L         +I+  ++   GS  +   WL   + L +  
Sbjct: 59  IL------YVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSY-SEIGWLFTGYSLPNAL 111

Query: 121 FILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLP 180
            +LI GR+    G K  +L   V+  I SLI  +   + S    I  R   G+G    + 
Sbjct: 112 LVLIWGRIATPIGFKATMLFAIVIFEIGSLISAL---ASSMNMLIGGRVIAGIG-GCGIQ 167

Query: 181 NVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFY 235
           ++  +IG+  V  + ++ ++I+ + +   I + +G    G+  +     W W FY
Sbjct: 168 SLSFVIGSTLVEES-KRGMLIAILSSSFAIASVVGPFLGGVFTSS--VTWRWCFY 219

>Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON}
           (117855..119801) [1947 nt, 649 aa]
          Length = 648

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 61/147 (41%), Gaps = 8/147 (5%)

Query: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNV 182
           LI G   DI G K + L   +L+ I +++           +F+  R FQ    + V+   
Sbjct: 225 LIWGHFADICGRKWLYLCSLLLMTIVNILLASLPAKIGLLYFL--RIFQAFSSSSVMSMG 282

Query: 183 LGIIGNIYVGGTFRKNIVISFVGA-MAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAA 241
            G + +I       K I    +G  M PI A +    AG+I   D   W W F   SI +
Sbjct: 283 AGTVTDITAPKHRGKAIAYFMMGPNMGPIVAPI---IAGVILIND--NWRWLFGFTSIMS 337

Query: 242 FINFVLSIYAIPSTIPTNIHHFSMDWI 268
            + F L +  +P T+   + +    WI
Sbjct: 338 GVAFFLVLVFLPETLRCMVGNGDKRWI 364

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 91/230 (39%), Gaps = 26/230 (11%)

Query: 36  SLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLF-IFTCMISQLLNQAGTTQTLSIMN 94
           SL  T   Q  +  +D       P Y ++  +E +F +  C  + L +    +    +++
Sbjct: 71  SLYKTKSGQHNEPTLD------EPPYSRFGRKEKIFLVIQCAFTGLFSSIAGSIYYPVLS 124

Query: 95  ILSDSFG-SEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL-IC 152
           ++   F  +E      ++  F   + S  L+ G L D  G + ++L   VL     + + 
Sbjct: 125 VMEKEFYITEEQVNVSVVVYFIFQALSPTLMGG-LADSLGRRPVVLSSIVLYFCACIGLA 183

Query: 153 GITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGA 212
             T YS      I  R  Q  GI+ V+    GI+G++               G M  +  
Sbjct: 184 RCTNYSQ----LIGLRCLQAAGISPVIAVNSGIMGDVTTKAERG--------GYMGLVSG 231

Query: 213 T--LGCLFAGLIGTEDPKQWPWA--FYAYSIAAFINFVLSIYAIPSTIPT 258
           T  LG  F  LIG     +W W   F+   I + I  ++SI  +P T  T
Sbjct: 232 TQVLGTAFGALIGAGLSSRWSWRSIFWFLVIGSGICLIVSIIVLPETKRT 281

>YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}
           HXT2High-affinity glucose transporter of the major
           facilitator superfamily, expression is induced by low
           levels of glucose and repressed by high levels of
           glucose
          Length = 541

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 22/136 (16%)

Query: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTF--FIISRAFQGL---GIAF 177
           L  GRLGD+YG +    +G + V++  ++  + + + SD +  + I R   G+   GIA 
Sbjct: 122 LTLGRLGDMYGRR----IGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAV 177

Query: 178 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTEDPKQWPWAFYA 236
           + P ++      ++ GT      +SF   M  +G  LG C   G     +  QW      
Sbjct: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSVQW------ 226

Query: 237 YSIAAFINFVLSIYAI 252
             +   +NF  +I+ I
Sbjct: 227 -RVPLGLNFAFAIFMI 241

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 62/143 (43%), Gaps = 11/143 (7%)

Query: 125 SGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLG 184
           SG L DIYG + ++++G ++ +  S+    +   G   F    R  Q   I+  +    G
Sbjct: 119 SGGLADIYGRRPVIVIGMIIYVAVSVGLACSNSYGVLVFL---RILQSACISPTIAISSG 175

Query: 185 IIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWA--FYAYSIAAF 242
            +G+  +   F +    +FVGA +   A LG  F  LIG      W W   F+   I   
Sbjct: 176 FVGDFTL--KFERG---TFVGATSGF-ALLGQAFGSLIGAALAAAWDWRAIFWFLVIGCG 229

Query: 243 INFVLSIYAIPSTIPTNIHHFSM 265
           +  ++    +P T  T + + S+
Sbjct: 230 VCMLIIFTLLPETKRTLVGNLSV 252

>Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 57/137 (41%), Gaps = 10/137 (7%)

Query: 12  SKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQN-PNYFKYAWQEYL 70
           S  EY  + +  V       N GE+ + T    S++E  DS  +  + P     AW    
Sbjct: 55  SAKEYSKKADDKVTDIESQPNWGETTSRTH--DSDNEKEDSEDEADSFPEGGAKAWIVTF 112

Query: 71  FIFTCMISQ--LLNQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGR 127
             F  +++   LLN  G  ++    ++  +    E  S   WL + F  V  +  +ISG 
Sbjct: 113 GCFMGLVACFGLLNSTGVMES----HLQDNQLAKESVSTIGWLFSLFLFVCFASCIISGT 168

Query: 128 LGDIYGLKKMLLVGYVL 144
             D  G + ++++G V 
Sbjct: 169 YFDRNGFRTIMIIGTVF 185

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (46%), Gaps = 13/116 (11%)

Query: 119 GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFV 178
           GSF L  GRLGDIYG +  L+V  V+ II ++I   +  +     ++I R   GLG   +
Sbjct: 134 GSFFL--GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQ--YMIGRIIAGLGCGLI 189

Query: 179 LPNVLGIIGNIYVGGTFRKNI---VISFVGAMAPIGATLG-CLFAGLIGTEDPKQW 230
                 I+  + +     KN+   ++S    M  +G  LG C   G     + +QW
Sbjct: 190 -----AILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKKYHNSRQW 240

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%)

Query: 314 YEIRFAKTPLLPRAVIKDR 332
           +EI+F+K PL P A+IKDR
Sbjct: 339 WEIKFSKVPLTPWALIKDR 357

>Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094C
           (REAL)
          Length = 547

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGL---GIAFVL 179
           L  GRLGDIYG +++ L+  VLV I  ++  I   +    +F I R   G+   GIA + 
Sbjct: 122 LTLGRLGDIYG-RRIGLMCVVLVYIVGIVIQIASSNKWYQYF-IGRIISGMGVGGIAVLS 179

Query: 180 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTEDPKQW 230
           P ++      ++ GT      +SF   M  +G  LG C   G     +  QW
Sbjct: 180 PTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYTNSVQW 226

>Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345C
           (REAL)
          Length = 541

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 22/136 (16%)

Query: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTF--FIISRAFQGL---GIAF 177
           L  GRLGD+YG +    +G + V++  ++  + + + SD +  + I R   G+   GIA 
Sbjct: 122 LTLGRLGDMYGRR----IGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIVSGMGVGGIAV 177

Query: 178 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTEDPKQWPWAFYA 236
           + P ++      ++ GT      +SF   M  +G  LG C   G     +  QW      
Sbjct: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSVQW------ 226

Query: 237 YSIAAFINFVLSIYAI 252
             +   +NF  +I+ I
Sbjct: 227 -RVPLGLNFAFAIFMI 241

>KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON} 
          Length = 516

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 48/253 (18%), Positives = 98/253 (38%), Gaps = 12/253 (4%)

Query: 3   NQSLVVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYF 62
           ++S V  +    +   + E  +       N G ++         D+  D     +  + +
Sbjct: 13  SESEVCSSMESSDCSVQAEHSLGYGKETVNDGTAINYEVCFNGPDDEADPEDIARRLSMY 72

Query: 63  KYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFI 122
           +  +   L   T M+  +++   T  +  I+     S   E +    ++  F L  G   
Sbjct: 73  RKYYIAVLITVTSMVITMISSCWTFVSPHIIEKFHVS--REVSVLGIMLYVFGLAFGPLF 130

Query: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNV 182
           L    + ++YG +   +    L I+W  +   T +S + T  +  R   G   +  L   
Sbjct: 131 L--SPISELYGRRATFIFSLTLSIVWQCL---TTWSRTLTGVMFGRFLSGFFGSSFLSVA 185

Query: 183 LGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAF 242
            G I +I++    +  + +S     A +G +LG + +G + T D +   W F  + IA+ 
Sbjct: 186 GGAISDIFLKS--QITVPMSLYTTAAMMGPSLGPIISGALYTVDFR---WTFVTFIIASG 240

Query: 243 INFVLSIYAIPST 255
           +  V  +  IP T
Sbjct: 241 VCLVAIVVTIPET 253

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/109 (18%), Positives = 51/109 (46%), Gaps = 1/109 (0%)

Query: 45  SEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEG 104
           +E  +VD+ ++    +      +  + +   ++   L+   TT   +++  ++    +  
Sbjct: 17  TETALVDTGEESTTSHSELPPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDAS- 75

Query: 105 NSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICG 153
           +  SW+  ++ L   +F  + G+L DI+G K +L++  +   +   ICG
Sbjct: 76  SQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG 124

>Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 82/187 (43%), Gaps = 23/187 (12%)

Query: 36  SLTATAFTQSEDEMVDSNQKWQN-PNYFKYAWQEYLFIFTCMIS--QLLNQAGTTQTLSI 92
           S T +   +S+ E  DSN + +N P     AW      F  +I+   LLN  G  ++   
Sbjct: 77  SETTSRTHESDSEEGDSNGEAENFPEGGLKAWVVTFGCFLGLIACFGLLNSTGVIES--- 133

Query: 93  MNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLI 151
            ++  +   +E  S   WL + F  V  +  +ISG   D  G + +++VG V       +
Sbjct: 134 -HLQDNQLANESVSTIGWLFSLFLFVCFASCIISGTYFDRNGFRTIMIVGTVF-----HV 187

Query: 152 CGITKYSGSDTF--FIISRAF-QGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMA 208
            G+   + S  +  FI+S A   G G   VL  ++ +  + +     R+   +    AMA
Sbjct: 188 AGLFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYFFK---RRGTAL----AMA 240

Query: 209 PIGATLG 215
            IG ++G
Sbjct: 241 TIGGSVG 247

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 67/161 (41%), Gaps = 14/161 (8%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           +I++ +  SFG    S  W++  + L +  F L+ GRL  + G +  ++   +L    SL
Sbjct: 66  TIIDTVCTSFGDYTKS-GWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSL 124

Query: 151 ICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 210
           I  + K   S    I  R   G+G    L  +  +IG   V    R  +V+S +     +
Sbjct: 125 ISALAK---SMNMLISGRVIAGVG-GSGLQTLSLVIGCQLVNEKSRP-LVLSLLNCTFAV 179

Query: 211 GATLGCLFAGLIGTEDPKQWPWAFY------AYSIAAFINF 245
            + +G    G   T     W W FY        +IA FI F
Sbjct: 180 ASIVGPFLGGAFTTH--VTWRWCFYINLPIGGLAIAIFIFF 218

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 74/190 (38%), Gaps = 15/190 (7%)

Query: 8   VLTESKGEYEN---ETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKY 64
           VL E   E +N   E    ++K+    ++ +S    +   S      S   +    Y ++
Sbjct: 23  VLEEHATEPQNLYMEHAEKIQKTDNRLDVTDSNRQLSLLNS----TKSETNFDGIPYTRF 78

Query: 65  AWQEYLF-IFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFIL 123
           +  + LF +  C +S   +    T     ++I+   F    +  +  +  + L  G F +
Sbjct: 79  SKHDKLFLVVICALSGFYSTIAQTIYFPALSIIEKEFNVSVSLVNVTVVVYSLCQGIFPV 138

Query: 124 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTF--FIISRAFQGLGIAFVLPN 181
           I G L D  G + +      +  I    C     +   TF   I  R  QG GI+ ++  
Sbjct: 139 IMGGLADRLGRRPV-----AMFCIMVYFCACIGIACCRTFGEMIFLRCLQGGGISPIIAI 193

Query: 182 VLGIIGNIYV 191
             G++G+I V
Sbjct: 194 NNGLMGDITV 203

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 48/127 (37%), Gaps = 7/127 (5%)

Query: 109 WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISR 168
           WL+  + L +    L+ GR G + G K  +L+  V+  + SLI        S T  I  R
Sbjct: 114 WLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAAT---SMTMLIGGR 170

Query: 169 AFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPK 228
              G+G + +      I   +    T  +   IS +     + +  G    G   T    
Sbjct: 171 VISGIGGSGIQTLCFVITSTLVTDRT--RGTAISILSCAFAVASVAGPFLGGAFATH--V 226

Query: 229 QWPWAFY 235
            W W FY
Sbjct: 227 TWRWCFY 233

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 62/151 (41%), Gaps = 20/151 (13%)

Query: 91  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150
           +I+  +S  FG + +   WL   + L +   +LI GR+  + G K   L   V+  + SL
Sbjct: 65  TIIEEVSQKFG-DYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSL 123

Query: 151 ICGITKYSGSDTFFIISRAFQGLG------IAFVLPNVLGIIGNIYVGGTFRKNIVISFV 204
           +  +   + S    I  R   G+G      + FV+ + L    N        + ++I+ +
Sbjct: 124 VSAL---ANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERN--------RGLIIAVM 172

Query: 205 GAMAPIGATLGCLFAGLIGTEDPKQWPWAFY 235
            +   I + +G    G   T     W W FY
Sbjct: 173 SSSFGIASVVGPFLGGAFTTH--VTWRWCFY 201

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 18/22 (81%)

Query: 314 YEIRFAKTPLLPRAVIKDRHMI 335
           +EI+F++ PL P A+IKDR +I
Sbjct: 335 WEIKFSRHPLTPWALIKDRGII 356

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 314 YEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGT 373
           +EI+FAK PL P   +KDR +   ++   F   +F +   Y +   L     T   A   
Sbjct: 328 WEIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATRI 387

Query: 374 YFMFLIWGIIAALLVGFTIKNVSPSV-FLFFSM 405
             +F     ++  L+G  I  V  +  F+FF +
Sbjct: 388 NSLFTFVTALSGTLLGLVIVKVRRTKEFIFFGI 420

>TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa]
           {ON} Anc_6.155 YBR241C
          Length = 482

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 60/143 (41%), Gaps = 15/143 (10%)

Query: 109 WLMASFPL--VSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFII 166
           W+ + F L  + GSF   +G   D YG KK+ +   V+V I SL   +  YS +    +I
Sbjct: 78  WITSIFSLGGLLGSFY--AGSWADHYGRKKVSIASSVVVTIGSL---VLFYSNTYLQLLI 132

Query: 167 SRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE- 225
            R   G+     L     +I  +Y+            +GAM  +   LG L   L+    
Sbjct: 133 GRTIVGIACGVYL-----VITPLYINEIAPAQHR-GALGAMNQVAINLGILLTQLLALRY 186

Query: 226 -DPKQWPWAFYAYSIAAFINFVL 247
            D  +W W F+A  +   +  V+
Sbjct: 187 TDSFRWRWLFFAGVVLGLLTLVM 209

>Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON}
           YMR011W (HXT2) - high affinity hexose transporter-2
           [contig 245] FULL
          Length = 570

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGL---GIAFVL 179
           L  GRLGD+YG +++ L+  +LV +  +I  I   +    +F I R   GL   GIA + 
Sbjct: 134 LTLGRLGDMYG-RRLGLMAVILVYVVGIIIQIASSNKWYQYF-IGRIVSGLGVGGIAVLS 191

Query: 180 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTEDPKQW 230
           P ++      ++ GT      +SF   M  +G  +G C   G     +  QW
Sbjct: 192 PTLISETAPKHLRGT-----CVSFYQLMITLGIFMGYCTNYGTKTYSNAVQW 238

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 43/108 (39%), Gaps = 11/108 (10%)

Query: 291 GWNQAYXXXXXXXXXXXXXXXXXYEIRFAKTPLLPRAVIKDRHMIQIMLALFF----GWG 346
           GWN                    +E+ FA  PLLP+ V+ +R  I  ++  F     G+ 
Sbjct: 329 GWNNPSMIAMEVVGGILLISYVVFEVFFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYF 388

Query: 347 SFGIFTFYYF-QFQLNIRQYTAL---WAGGTYFMFLIWGIIAALLVGF 390
           S   FT Y F    L+ R +  L      G  F  ++WG   AL  GF
Sbjct: 389 SLLFFTSYTFVVLNLSYRDWVYLSNTTTMGLCFFGVVWG---ALFRGF 433

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 109/259 (42%), Gaps = 31/259 (11%)

Query: 17  ENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFT-C 75
           + +T++    S +D+N   SL  T+  +S+  +   + + + P Y ++  ++ L +   C
Sbjct: 4   DTDTKVVFDSSQKDSN---SL-KTSDQKSDGSLAGKDNESEIP-YSRFKRRDKLLLVAQC 58

Query: 76  MISQLLNQAGTTQTLSIMNILSDSFG---SEGNSKSWLMASFPLVSGSFILISGRLGDIY 132
             + L +    +    ++  +   F     + N    +   F  +S SF+   G + D  
Sbjct: 59  ASTGLFSSIAASIYFPVLTTVERKFHITEEQANITVVVYYVFQGLSPSFM---GNMADTL 115

Query: 133 GLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV- 191
           G + ++LV    V+I+ + C       + +  I  R  Q  GI+ V+    G++ +I   
Sbjct: 116 GRRPVILVS---VLIYFVACLGIASCNTYSQLIGLRCLQAAGISPVIAINSGMMTDITTR 172

Query: 192 ---GGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPW--AFYAYSIAAFINFV 246
              GG         +VG  +     LG  F  LIG     +W W   F+  SI + I  V
Sbjct: 173 AERGG---------YVGYTSGC-QVLGSAFGALIGAGLSSRWGWRSVFWFLSIGSGICLV 222

Query: 247 LSIYAIPSTIPTNIHHFSM 265
           +S   +P T  T + + S+
Sbjct: 223 ISTLLLPETKRTIVGNASI 241

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 53/252 (21%), Positives = 101/252 (40%), Gaps = 20/252 (7%)

Query: 9   LTESKGEY-----ENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFK 63
           LT ++ E+     +   +L ++ +S   N G+      F    +++ D     ++ +  +
Sbjct: 15  LTSTEEEHCSINSDKAAKLDLELTSERKNDGKQSHEVTF---NEDIADPEDIARHMSTAR 71

Query: 64  YAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFIL 123
             +   L  FT M+  +++ + T  +  I+     S   E ++    +  F L  G   L
Sbjct: 72  RYYISSLITFTSMVITMISSSWTLPSTHIIEHFHIS--HEVSTLGITLYVFGLGIGPLFL 129

Query: 124 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVL 183
               L ++YG +   L    L IIW     +T +S + T  +  R   G   +  L    
Sbjct: 130 --SPLSELYGRRITFLYALTLSIIWQC---LTIWSKTITGVMFGRFLSGFFGSAFLSVAG 184

Query: 184 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFI 243
           G I +I+     +  I ++     A +G +LG +  G +  +  K   W F    I +  
Sbjct: 185 GAIADIFDKD--QIGIPMAIYTTSAFLGPSLGPIIGGALYHQSYK---WTFITLLITSGC 239

Query: 244 NFVLSIYAIPST 255
             V+ I+ IP T
Sbjct: 240 CLVMIIFTIPET 251

>TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {ON} 
          Length = 522

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 13/111 (11%)

Query: 72  IFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDI 131
           +FTC+   LLN  G  +T    N LS+   S   S  W+ +    V+ S  + SG   D 
Sbjct: 118 LFTCL--GLLNAIGIVETYIQENQLSNESSS---SIGWIFSLLLFVNFSSCIFSGTYFDR 172

Query: 132 YGLKKMLLVGYVLVIIWSLICGITKYSGSDTF--FIISRAFQ-GLGIAFVL 179
            G K  ++VG +L      +CG+   + S     FI+S +   GLG  F++
Sbjct: 173 NGFKIPVIVGTIL-----HVCGLVAMANSTKLWQFILSLSIAVGLGNGFIM 218

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAF 177
           L+S  + D  G K  L   +V  I+W + CGI   S      ++ R   G+GI F
Sbjct: 83  LLSPSVSDALGRKCSL---HVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGF 134

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 75/177 (42%), Gaps = 22/177 (12%)

Query: 87  TQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVI 146
           T TL++  I S  F       +W +    ++     ++ G +GD YG K   ++    ++
Sbjct: 93  TVTLNVKKI-SHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMM 151

Query: 147 IWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRK--NIVISFV 204
           +  +I G  K++    +F+I+RAF G+ +        GI GN      F        SF+
Sbjct: 152 VLEIITGFIKHNFK--YFLIARAFFGVVLG-------GIFGN-SAAQCFDDCPPEAHSFI 201

Query: 205 GAMAPIGATLGCLFAGL----IGTEDPKQWPWAFYAYSIAAFINFVLSIYA--IPST 255
                 G TLG L A +    +      +W   F+    AA I F+L I+   +P T
Sbjct: 202 SGFFQQGYTLGYLLAVIFTRALADTTKDRWRSCFW---FAAGITFLLIIFRALLPET 255

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,287,112
Number of extensions: 2082211
Number of successful extensions: 7592
Number of sequences better than 10.0: 296
Number of HSP's gapped: 7705
Number of HSP's successfully gapped: 307
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)